Descriptive Catalogue of Govt Collections of Manuscripts Part 1 Svetambara Works

Author(s): Hiralal R Kapadia
Publisher: Bhandarkar Oriental Research Institute
Catalog link: https://jainqq.org/explore/018041/1

Page #1
GOVERNMENT COLLECTIONS OF MANUSCRIPTS BHANDARKAR ORIENTAL RESEARCH INSTITUTE ASTITO POONA FOUNDED 1917 Published by Bhandarkar Oriental Research Institute 1967

Page #2
DESCRIPTIVE CATALOGUE OF MANUSCRIPTS IN THE GOVERNMENT MANUSCRIPTS LIBRARY PREPARED UNDER THE SUPERVISION OF THE MANUSCRIPTS DEPARTMENT OF THE BHANDARKAR ORIENTAL RESEARCH INSTITUTE, POONA KATUT NSTA POONA FOUNDED 1917 jasvinAva nAvadhItamastu Bhandarkar Oriental Research Institute 1967

Page #3
Copies can be had direct from the Bhandarkar Oriental Research Institute, Poona 4 ( India ) Price: Rs. 20 per copy exclusive of postage Printed and published by Dr. R. N. Dandekar, M.A., Ph.D., at the Bhandarkar Institute Press, Bhandarkar Oriental Research Institute, Poona 4,

Page #4
Descriptive Catalogue of the Government Collections of Manuscripts deposited at the Bhandarkar Oriental Research Institute COMPILED BY HIRALAL RASIKDAS KAPADIA, M. A., Formerly Lecturer in Mathematics and Subsequently Professor of Ardhamagadhi and University Teacher for Ph.D. in Ardhamagadhi ( Bombay University ) JAINA LITERATURE AND PHILOSOPHY Volume XIX Section II: Narratives Part I: Svetam bara Works Bhandarkar Oriental Research Institute POONA 1967

Page #5

Page #6
CONTENTS PAGE No. PREFACE I-XII LIST OF PRINTED CATALOGUES AND REPORTS ABOUT MANUSCRIPTS XIII-XV DESCRIPTIVE CATALOGUE OF MANUSCRIPTS IN THE GOVERNMENT MSS. LIBRARY XVI-XVII REGULATIONS OF THE MANUSCRIPTS DEPARTMENT XVIII-XIX SYSTEM OF TRANSLITERATION XX (D) Narratives (1) The Svetambara Works ( Nos. 1-319) PAGE 1 Agadadattacatuspadi ( Agadadattacopai ) 2 Agadadattacaritra 3 Do (dir.) 4 Agadadattarasa s Aghatakumarakatha 6 Ajaputrakatha 7 Do (dif.) 8 Do (dif.) with vivarasa 9-10 9-10 Anjanasundaricatuspadi ( Anjanasundaricopai ) 11-13 1 Anjanarasa 13-14 12 Anathisadhusandhi 14-15 13 Do (dif. ) 15-16 14 Anukam pacatuspadi ( Anukampacopai ) 16-17 15. Anyoktimuktavali 17-19 16 Abhayakumararasa 20-21 17-18 Amaradatta-Mitrananada-caritra [ Amaradatta'Mitrananda-rasa ] 22-24 19 Amaradvasaptatika 24-26

Page #7
6 No. PAGE 26 Amarasena-Vajrasena-nrpakathanaka Amarasena-Vajrasena-rasa ( Amarasena-Vayarasena-rasa) 26-27 Do (dif.) 27-28 23-24 Do (dif.) 29-31 20 21 22 P 25 Ambadakathanaka 26 Contents Do (dif.) Do (Ambada-devangana-caritra) 27 28 Ambadacatuspadi (Ambadacopai) 29 Ambadacaritra 30, Arjunamalakaracaritra 31 Avantisukumalacatuspadi (Avantisukumalacopai) Asokacandra-Rohini-rasa " 32 33-34 Astaprakaripujakathanaka [ Atthappayaripuyakahanaya] 35 Astaprakaripujaprakarana [Atthappayaripuyapagarana] 36 Astaprakaripujarasa 48-51 37 Astamadanivaranasvadhyaya (Athamadanivaranasajjhaya) 51-52 38 Astavidhapujakathanaka ( Atthavihapuyakahanaya) [Anantanathacaritragata-pujastaka-kathanaka ] o 39-40 Astabikavicara ( Atthahiaviyara) 4 Anandaprathamo pasakasandhi ( Anandapadhamovasaga sandhi) 42 Anandasravakacaritra 43-45 Anandasandhi 46-47 Anandasundarakavya 48 Anandadisravakacarita (Anandaisavagacaria) 49 Amaprabandha 50-51 Aramasobhakatha 52-54 Aramasobhakathanaka Si Ardrakumararasa 56-57 Asadhabhutirasa 58-59 Asanadanakatha 60 latiputrakathanaka 31-32 33-34 34 35-37 37-38 38-39 39-40 41-44 44-46 46-47 52-53 53-56 $7 57-59 59-62 62-66 66-67 67-69 69-71 71-73 74-75 75-78 78-79 78

Page #8
Contents PAGE 82-85 88-89 89 No. 61-62 Ilaputrarsirasa ( Ilaputratsirasa ) 80-82 63-64 Uttamakumaracarita 65 Uttamacaritrakumarakatha 85-86 66 Do (dif.?) 86 67-68 Do (dif.) 87-88 69 Udainspacaritra 70 Upadhanasandhi 71-74 Upamitibhavaprapancakatha 90-99 75 Upamitibhavapra pancakathasaroddhara 100-102 76 Upamitibhavaprapancakathoddhara 102-103 77 Rsabhajinacaritra 103-104 78 Rsabhadevadhavala bandha ( Rsabhavivahalau ) 104-105 79 Rsikathanaka ( Isikahanaya ) 105-106 80 Rsidattakatha (Isidattakaha ) 106-107 81-84 Rsidattakhyana 107-111 85 Kathakosa (?) 112 86 Do (dif.) Do (Kahakosa ) 113-115 Do (dif) 116 Do (dir.) 117 Do (dir.) 91 Kathamahodadhi ( Karpuraprakarakatha ) 119-120 92-95 Katharatnakara 120-127 96 Kathasangraha 127-128 97-99 Do (Antarakathasangraha ) [ Vinodakatha. sangraha] 128-132 100 Do (dif.) 132-133 101 Do (dif.) 133-134 102 Do (dif.) 134-135 103 Kathoddhara 136 104 Kanakarathakatha TOS Kanakarathakathanaka 137 113 90 18 137 1 Is this a narrative or purely a ritualistic work?

Page #9
Contents No. PAGE 106-108 Kayavannacatuspadi ( Kayavannacopai) [Kstapunyarasa] 138-141 109 Karakanducaritra 141-142 110 Kalavatikatha 142 I Kalakacaryakatha [ Kalayayariyakaha ] 142-143 112 Do (dir.) 143-144 113 Do (dif.) 145-146 114-115 Do (dif.) 146-148 116 Do (dif.) 148-149 117 Do (dif.) (illustrated ) 149-151 118-119 Do (Kalagayariyakaha) (dif.) ( illustrated) 151-153 I 20 Kalakacaryakathavacuri 153 121 (110 a) Kartikasaubhagyapancamimahatmya [ Jnana pancamimahatmya ] [ Saubhagya pancamikatha ] [ Varadatta-Gunamanjari-kathanaka ] 154-155 122 Kirtikallolini 155-156 123 Kumara palacarita (Samskrta-dvyasraya-mahakavya ] (Cantos I-XX ) with vivsti 157-161 124 ( 122 a) Kumarapalacarita ( Cantos 1-XX ) 161-163 125 ( 122 b) Do [Cantos III-X) 163-164 126-127 Do with vivsti 164-166 128 Do (Cantos 1-XIV ) with vivsti 166-167 129 Do (, 1-X) do Do 167-168 130-131 Do ( , I-III) do Do 168-171 132 Do ( , I-III) do tippanaka 171-172 133 Do [ Kumaravalacariya ] (Praksta-dvya. sraya-mahakavya ( Cantos I-VIII ) 172-173 134 Do with tika 173-175 135-136 Kumara palacarita 176-179 137 Do ( dif.) 179-180 138 Do (dis.) 180-181 139-143 Kumarapalaprabandha 181-187 144-146 Do ( dir. ) 187-190 147-148 Kumara palarasa 191-195 149 Kumarapalavamsavali 195-196

Page #10
Contents No. PAGE 150-153 Kumaraviharasataka 196-200 154 Karucandramantrikatha 201-202 155 Do ( dif.) 202 156 Kuladhvajakumaraprabandha 202-204 157 Kuvalayamala 204-208 158-162 Kurmaputracaritra ( Kummaputtacaritta ) 208-211 163 Kulavalakakatha 211-212 164 Ketapunyakatha 212-213 165 Krsnacaritra ( Kanhacaritta ) 213-214 166 Krsna-Yudhisthira-dharmagosthi with artha 214-215 167 Kesikumaracatuspadi (Kesikumaraca upar) 216-218 168-69 Kesi Pradesi-rasa (Kesivacana-Paradesi-prabodhaj 218-220 170 Ksmarsiprabandha 220-221 171 Ksullakakumaraprabandha 221-222 172 Gangadattakathanaka [ Gangadattakahanaya ] 223 173-175 Gajasimhabhupacaritra 224-227 176 Do ( dir. ) 227-229 177 Gajasukumalakatha 229-230 178 Gajasukumalarasa 233-231 179 Girinarakalpa 232 180 Girinaroddhara 232-234 181 Gita 234-235 182-183 Gunakarandaka-Gunavali-rasa [ Gunavalicatuspadi] (Gunavalicopai ) 236-238 184 Do (dir.) 238-239 185 Gunaratnasarakumararasa ( Ratnasarakumararasa ] 239-270 186-188 Gunavarmakatha 241-246 189-190 Gurugunaratnakarakavya 246-250 191 Godhanakatha 250 192 Gopakatha (Govakahi ) 251 193 Gautamasvamirasa [ Goyamagururasa ] 251-252 194 Gautamiyamahakavya with Gautamiyaprakasa (vyakhya) 195 Catuhpratyekabuddhacaritra [ Cara pratyeka buddhani dhala ] 256-257 252-256

Page #11
Contents Page 196 Caturgatibhavasvarupavijnapti 257 197 Caturdasasvapnavicara 258-260 198 Caiurvimsaticatuspadi ( copai) 260-261 199 Caturvimsatijinacaturvidhasanghasankhyagita 261 200 Caturvimsati-jinendra-sanksiptacarita 262-263 201 Candana balacarita ( Candanabalacatuspadi ] ( Candanabalacopai) 263-264 202 Candana-Malayagiri-catuspadi ( Candana-Malayagiricopai ] 265-266 203 Candradutakavya 266-267 20+ Candradhavala-Dharmadatta-katha [ Dharmadattakatha. naka ? 267-268 205 Candranarendracaritra with tabba 269-270 206-208 Do [ Canda rajano rasa ] ( dif.) 270-275 209-214 Candraprabhacaritra 276-285 215 Candra-Bhanu-Bhima-Krsna-Sundara-katha 285 216-217 Candralek barasa 286-288 218 Campakamalakatha 288-290 219-221 Campakasresthikatha 290-292 222-223 Campakasresthicatuspadi (Campaka Sethni caupai) 292-294 224 'Campakebhyakathanaka 294-295 225 Jagaducarita 295-298 226-227 Jambukumaracaritra [ Jambukumaracatuspadi ] 298-300 228-229 Jambukumararasa 301-305 230 Jambusvamikathanaka 305-306 231 Jambusvamirasa 306-308 232-233 Jayantavijayakavya 308-314 234 Jayavijayakatha 314-315 235 Jayavijayarasa 315-316 236 Jayanandacaritra 317-319 237 Jambuvaticaritra 319-320 238 Javaoikatha 239 . Jinaguna sampattikatha 1 Is this a Digambara work? 2 Is this a Digambara work? 320 321

Page #12
No. 240 Jinadattasuricaritra 241-243 Jainakumarasambhava 244 Jainakumarasambhava with vivrti 245 Jainakumarasambhavavivrti 246-247 Dhalasagara-harivamsa prabandha 248-249 Dhola Maru-catuspadi [ Dhola-Maru-copai ] 250 Tarakatha 251 Tilakamanjari 252 Tilakamanjariprabandha 253-254 Tribhuvanadipakaprabandha 255 Trisastisalakapurusacaritra ( Parvans I-X) 256 Do (Parvan II) [ Ajitanathacaritra ] Do (Parvans VII-VIII) Do (Parvan VII, 1-13) 257 258 259 260 261 Do ( 262-268 Do ( 269 Do ( 270-271 Do ( 272 Do ( 273 Dasarnabhadra-rajarsi-rasa 274-275 Danakalpadruma [ Dhanyacaritra ] Do with artha 276 277 Danaphalakatha ( Danaphalakaha) 278 Digvijayamahakavya 279 Dipalikakalpa 280 Do ( Do ( 32 "" "" >" Contents r ") wr 281-282 Do (dif.) VII, 1-10) VII, - 8) VII, 1- 4 VIII, 1-12) VIII, 4-12) X, 1-13) X, 6-7) Do (dif.?) with tabba 384-386 386-387 387-389 389-391 283 Do (Divaliyakappa) (dif.) 391-392 284 Dipotsavakalpa ( Divucchavakappa) [ Apapabrhatkalpa ] [Pavapurikalpa ] 285 Durghatakavya [ Kriyadiguptakavya ] 286 Drdhapraharikatha 287 Devapalakatha 11 PAGE 321-322 323-326 326-328 328-329 329-332 332-334 335 335-337 338-339 339-341 341-344 345-346 346-349 349-352 352-353 353-354 355-356 356-367 367-368 368-375 375-376 376-378 378-381 38.-383 383-384 392-393 393-394 394-395 395

Page #13
Contents No. PAGE 288 Devaraja-Vatsaraja-katha ( Devaraya-Vaccharaya-kaha) 396 289 , -Vatsaraja-rasa (Devaraja. Vaccharaja-rasa) 397-398 290-29! Draupadirasa 398-399 292-294 Dvadasavratakatha 400-403 295 Dhanapatikatha 403 296 Dhanamitrakatha 404 297 Dhanyakatlia 405 298 Dhan yarajarsirasa [ Dhannarasa ] 405-407 299 Dhanya-Salibhadra-caritra (Dhanna-Salibhadra-copai] 407-408 300 Dbam mila caritra 408-410 301 Dhammilarasa 410-411 302 Dharmakatha 411-412 303. Dharmadattakatha 412-413 304 Do ( dir. ) 413-414 305 Dharmadattakathanaka 414-405 306 Dhurtakhyana ( Dhuttakkhana ) 415-416 307 Do ( dif.) 416-418 308-309 Dhurtakhyanabalavabodharupakatha 418-419 310-311 Dhvajabhujangakatha 420 SUPPLEMENT 421-434 429 312-313 (41a-41b) Anandamandirarasa [ Sricandrakevalirasa ] 421-427 314 Do with tabba 427-429 315 (171a) Khimarsicatuspadi [ Khimarisicopai ] 316 (195a ) Candapingalakatha with tabba 430 317 (204a ) Candradhavala-Dharmadatta-katha 430-421 318 (2402) Jinadasakatha with tabba 431-432 319 (295a ) Dhanapatikatha 432 320-321 ( 305a-305 b ) 'Dharmapariksakatha 433-434 Addenda 435-440 Errata 441-444 1 This is a Digambara work,

Page #14
PREFACE In October 1930 I was invited by the Bhandarkar Oriental Rescarch Institute to prepare a Descriptive Catalogue of the Jaina Manuscripts about 4500 deposited therein by the Government of Bombay. I willingly accepted this invitation and left Bombay for Poona and commenced my work on 23-11-'30. Since no definite plan for grouping up of Mss. was chalked out till 1933, I went on describing M s. alphabetically irrespective of their subjects. Consequently at least somc Mss. dealt with in this Part I were described by me as far back as 1930 and none after June 1936. In the beginning the Institute had allotted two Volumes XVII and XVIII 10 " Jaina Literature and Philosophy" but after a couple of years the Jaina Mss. were spread over the third Vol. numbered as XIX so that Vol. XVII was to deal with the canonical literature, Vol. XVIII with philosophical works and Vol. XIX with the remaining works-works treating hymnology, narratives, pattavalis and gurvavalis, ritualism and miscellanea. This arrange ment was modified in April 1956 when the section on hymnology was assigned an independent place and was named as Vol. XIX. This led to the remaining portion of Vol. XIX being thenceforth looked upon as forming Vol. XX. In April 1961 it was however decided that the original Govt, plan of having 20 Vols. of the Descriptive Catalogue should not be changed. This resulted in dividing Vol. XIX into three sections as under : ( i ) Hymnology. ii) Narratives (sheets 1786+492 = 2278 ). (iii) (a) Pattavalis & Gurvavalis ( sheets 1-22 ). (b) Ritualistic works ( 9 23-468 ). (c) Miscellarica ( 469-562 ). (d) Supplement ( ,,563-570). Hymnology is already published in two parts. Narratives are to be issued in three parts. They are as under :

Page #15
ii Preface (i) Part I: Svetambara works 1-321 (sheets 1-765). (ii) , II: ,, ,, 322- ( 766-1786) & ten Appendices (iii) ,,III: Digambara works (sheets 1-492 ) & ten Appendices As regards Vol. XVIII ( sheeis 3065 +1422 =4487 ) it is to be published in five parts. Of them Part I (works 1-305; sheets 1-681 ) was issued in 1952. The printing of the remaining parts will be commenced as soon as the textual matter of Parts II & III of Sec. II of Vol. XIX gets printed, in case Sec. III of Vol. XIX is to be printed last. These parts of Vol. XVIII will include the following : Part II Svetambara works (contd.) ,, III , (contd.) & ten Appendices ,, IV Digambara , ,, V (contd.) & ten Appendices There is practically nothing new to add so far as the plan followed by me for the presentation of this Part I of Section II of Vol. XIX is concerned. It is based upon the general lines laid down in 1930 by Rao Bahadur Dr. S. K. Belvalkar, the then Hon. Secretary of the Institute and adopted by me for Vol. XVII ( Parts I-IV ), Vol. XVIII ( Part I ) and Vol. XIX ( Section 1, Parts I-II ). These lines have determined the inter-arrangement of the descriptive sheets dealing with the same text and the system of transliteration. Works composed in languages other than Sanskrit, are assigned Sanskrit iitles, in addition to those in the very languages (Sanskrit excluded in which the works are composed. The latter titles are placed in brackets just below the former ones. At times an alternative title or even a popular one is indicated, and it is placed in rectangular brackets for the sake of distinction.

Page #16
Preface All independent works have been arranged alphabetically according to their Sanskrit titles whereas the commentaries pertaining to them are arranged chronologically as far as possinle. Especially in the beginning I had to copy extracts from the Jaina M;s Later on I was assisted in this work at a time by one or two of the following persons employed by the Institute:--- Messrs. D. V. Shintre, M. M Patkar, G. V. Gulavani, G. S. Deshmukh, B. M. Deo and S. N. Savadi. Their assistance proved fruiful after my acquainting them with the Jaina Nagari characters in special. In this connection I may note that the work of Mr. S. N. Savadi was particularly commendable. Addenda given here does not belong only to this Part I of Sec. Il of Vol. XIX but it pertains to even 'portions of the laina Catalogue of Mss. so far published. This is due to the fact that (1) the printing of the Jaina Catalogue has been going on very very slowly, (2) some works have been published during the years 1957 to 1965 and (3) some discrepancics-have teen casually noticed. This Part I (f Section II of Vol. XIX opens a new vista, for it presents narratives, altogether a new branch of the non-canonical literature, the canonical one having been treated by me in Vol. XVII. Other branches of the non-canonical literature are: - (i) Philosophy, (ii) hymnology and (iii) ritualism etc. A portion of philosophical works is published as Part I of Vol. XVIII and hymnology as Parts I and II or Section 1 of Vol. XIX. Section Il of Vol. XIX consists of works of both the seets of the Jainas viz. Svetam bara and Digambara. As already stated its first two parts will include only Svetambara narratives and their corresponding Appendices whereas the third, Digambara ones and ten appendices pertaining to them. 1 These portions are as under : Vol. XVII, Pts. I-V; Vol. XVIII, Pt. 1 and Vol. XIX, Soc. I, Pts. 1--2. As regards errata' only this Part I is concerned.

Page #17
iv Preface I shall now give a bare outline of the Jaina 'narrative literature. It is very vast, varied and vivid. It forms an important factor of the Jaina literature (canonical and non-canonical as well.) in general, and the Jaina applied ethics in particular as its composition has mostly a didactic motive in view. * The canonical treatises are primarily religious and philosophical in outlook. Nevertheless some of them and some sections of other treatises furnish us with varratives. Even the exegetical literature pertaining to the Jaina canon and commentaries of the Jaina philosophical works, too, are not lacking in narratives which illustrate and elucidate one or the other cardinal principle of Jainism. They are already treated in Vols. XVII and XVIII. Consequently I shall here deal with works included in this Part I of Section II of Vol, XIX. Some of the narratives furnish us singly or jointly with biographies of the 24 Tirthankaras beginning with Lord Rsabha and ending with Lord Mahavira and some along with their lives and those of 12 Cakravartins (sovereigns-emperors), 9 Vasudevas or Ardha-cakravartins, 9 Prativasudevas or the rivals of Vasudevas and 9 Balatamas, step-brothers of Vasudevas. These are the 263 ( 24 + 12 +9+9+9 ) towering personalities. All of them flourished in India during the present avasarpini ( the descending cycle of the time wheel ). Their narratives give us an idea of the Jaina mythology. The great personages of the Jaina clergy and laity legendary and historical, too, form a subject-matter of this section. Some of the stories point out the benefit of practising virtues and disadvantages resulting from resorting 10 vices. Narration is of various kinds such as allegory, anecdote, autobiography, ballad, biography, dialogue, fable, fairy-tale, fiction, folk-tale, legend, novel, parable, pattern-story, romance, story, story in-story, tale etc. Some of the corresponding Indian names 1 For its detailed sorvoy the roader may rofer to the English introduction (pp. 17-39) of Brhat kathakos'a and my Gujarati introduction (pp. 6-12) of Tarargalola. 2 This number refers to the status (designation ). Othervise it is 60 or orod 59, for three of the Tirtharkaras wore Cakravartins prior to thoir renunciation ( seo p. 343, fn. 2 ) and Lord Mahavira was the first Vasudeva in one of his previous births.

Page #18
Breface are indicated by me on pp. vii-viii. It is neither possible nor essen. tial that I should here point out one and all the narratives which illustrate the various forms of narration. So I shall mention only a few forms and the works (or their sections) illustrating them: Allegory -- Upamitibhava prapancakatha. Ballad - Uttarajjhayana. Biography - Ayara, sPajjosavanakappa and 4Viyahapannatti. Dialogue - Uttarajjhayana (IX, XII-XIV, XXII, XXIII & XXV). Parable --SSuyagada, Nayadhammakahaz and 'Uttarajjhayana. Pattern-story-Uvasagadasa. Romance --Tarangavai. The Jaina Classifications of Narratives Some of the Jaina authors have classified narratives. For instance, Sudharmasvamin has said in Thana ( III, 3,; s. 189) that a narrative is of three kinds : athakahA (arthakathA ), dhambhakahA (dharmakathA) and kAmakA (kAmakathA ). Further, in this Thana (IV. 2 : 5.282) four varieties of dhammakaha along with four sub-varieties of cach of them is noted as under: "caubihA ghamnakahA paNNattA, taM jahA-aphavevaNI, vikhevANI, saMveyaNI, nivegaNI / akhevaNI kahA cauvihA paM0 20 AyAra-akarakhevaNI, vavahAra akhe vaNI, pannatti akvevaNI, didibAta akhevaNI / vikAvevaNI kahA cauvihA paM. taM. sasamayaM kahei, sasamayaM kahittA parasamayaM kahei 1, parasamayaM kahettA sasamayaM ThAvattitA bhavati 2, sammAvAtaM kahei, sammAvAptaM kahettA micchAvAtaM kahei 3, micchAvAtaM kahattA sammAvAtaM ThAvasittA bhavati / / saMvagaNI kathA caundhihA' paM. taM. ihaloge duJcinnA kammA ihaloge duhaphalavivAgasaMjuttA bhavanti 1, ihaloge duJcinnA kammA paraloge dahaphalavidhAgasaMjuttA bhavanti 2, paraloge duJcinnA kammA ihaloge duiphala vivAgamaMjunA bhavanti 3 yaraloge duJcinnA kammA paraloge duhaphalavivAgasaMjuttA bhavanti 4 ihaloge succinnA kammA hAloge suhaphalavivAgamajunA bhavanti 1, ihaloge succinnA kammA pagloge suiphala. vivAgasaMjunA bhavanti 2, evaM caumaMgo 4 / " - mutta 282 / / 1 Some section ( or sections ) is meant here and not the entire work. 2-6&8 See foot note l. 7 The story of Maya di given here is a developed form of a mariner's tale.

Page #19
Preface All these varieties and sub-varieties are elucidated by Abhaya. deva Suri in his commentary ( pp. 2118-212a ) on this Thana. Haribhadra Suri in his Samaraiccacariya ( bhava 1, p. 13) divides narratives into the following four groups: ***FUT, TAFSI, TAFEI & RITTEET ( HERMOSEMI) Uddyotana Suri alias Daksinyacihna Suri mentions in his *Kuvalayamala (89) three varieties of narratives viz. $987, 39797.and FIAT and four sub varieties of dharmmakaha as noted in Thana (s. 282). In $7 he however mentions five varieties of narratives as below: #TJEET ( Eur), KOTFET (BUTEU), 7914661 (terTEN), arrarheor (RFETESTI ) & at|( 5TIFU ). This Suri has here ($ 7) mentioned 'sankinnakaha', 100. Siddhassi points out the following classification of narratives in his Upamitibhavaprapancakatha ( prasiava I; p. 2): stef#91, #2, RED & poftur. Hemacandra Suri in his Kavyanusasana ( VIII, 8 ) has defined" katha". Khandakatha and sakalakatha are mentioned by him in his Alankaracudamani wbile commenting upon this Kavvanusasana ( VIII, 8 14. Here he has referred to Indumati as kbandakatha and to Samaradityakatha ( Samaraiccacariya ) as sakalakatha'. It is desirable that narratives dealt with in all the three parts of Section II of Vol. XIX should be classified by taking into account their forms of presentation. Consequently I group these 1 This refers to the edition of Pt. Bhagavandas issued with << Sanskrit rendering of the text in A. D. 1938. 2 On p. 20 thore is mention of Vangala rsi and his astrological work, 3 These are named as under : akhevaNI, viksevaNI, saMvegajaNaNI & nivveyajaNaNI. 4 The following are the additional varieties noted here :AkhyAna, nidarzana, pravAhnikA, manthallikA, maNikulyA, parikathA, upakapA & T.

Page #20
Preface narratives according to their languages. I reserve their full treatment for Part III. In the meanwhile I mention numbers of works included in this part I : (a) Sanskrit 716719-307 341-75-76, 103, 180 **r-5, 6, 8, 29, 50-51, 57-58, 65-68, 71-74, 88, 89, 90, 91, 92-95, 96, 97-99, 101, 102, 104, 105, 109, 110, 114, 115, 116, 117, 121, 154, 155, 163, 164, 165, 177, 186-188, 191, 104, 215, 218, 219-221, 234, 238, 239, 250, 251, 286, 287, 292, 293-294, 295, 296, 297, 302, 303, 304, 308-309, 310-311, 316, 317, 318, 319, 320-321 017-20, 25, 26-27, 52-4, 59, 85, 86, 100, 224, 230, 305 85/60-15, 46-47, 122, 189-190, 203; 232-233, 272, 285 -166 R-135-136, 138, 200, 225 gitar-29, 109, 137, 205, 209-214, 227, 240, 255-269 (AE1%{*T) 374-276, 300 49*~49, 139-143, 144-146, 170, 254 ANTI-123-132 (TCU), 194, 241-244, 255-269, 270 271, 278 W15-150-153 (b) Prakrit FUTE-306 -80, 111, 118-119, 192, 277, 288 $81974-33-34, 38, 79, 87, 172 770157 -48 T -158-161, 165 ITY--112

Page #21
-viii Preface cupaI-315 pagaraNa-35 mahAkavva-133-134 viyAra (?)-39-40 sandhi -41 (c) Gujarati AkhyAna--23-24, 81-84 kathA-7, 23-24, 101, 113 gIta-181, 199 carita-63-64, 81-84, 201, 299 caritta-69 caritra-2, 3, 17-18, 30, 41, 77, 173-175, 176, 195 (dAla), 236 ( rAsaprabandha ), 237, co(cau )pA( pa )i-1, 9-10, 14, 28, 31, 55, 106-108, 167, 174-175, 198, 202, 222-223, 226, 248,249 ghavala--78 prabandha--156,167, 171, 246-247, 253-254 rAsa-I, 4, 11, 16, 17-18, 21, 22, 23-24, 32, 36, 55, 56-57, 61-62, 147-148, 156, 168-169, 178, 182-184, 185, 193, 206-208, 2:6-217, 228--229, 231, 235, 273, 289, 290-291, 298, 301, 312-314 vaMzAvalI-149 vicAra-197 vivAhalau-78 vInati--196 sajjhAya-37 sandhi-12, 13, 43-45, 70 (?), saptatikA (?)-19 One of the noteworthy feature of ihis Part I is that it deals with Mss. which furnish us with icompendiums of narratives named as 1 For their survey the reader may refor to the introduction (pp. 39-47 ) of Brhatkathakosa,

Page #22
Preface kathakosa (Pr. kahakosa ), Kathanakasangraha, Kathamahodadhi, Katharatnakara, Katliasangraha and Kathoddhara. They are as under : kathAnakasaGgraha - No. 100 -Nos. 85, 86, 88, 89, 90 33 kathoddhAra - No. 103 -No. 91; 157 stories -No. 92; 12y narratives out of 258 - No. 97; 84 small and amusing stories No. 101 (Sk., Pr. & Vernacular) 8 102 -No. 87; 8 stories 2 I may add that Brhatkathakula composed by Harisena in Saka 853 i. e. A. D. 931 contains 165 Sanskrit stories. There are two Mss. of this work in the Bombay Govt. Mss. Library. A description of both of them prepared by me is assigned a place in Part 3 of Sec. II of Vol. XIX. Puzzles This Part I furnishes us with two puzzles, the corresponding page-numbers being 25 and 428. Of them the answer for the first is indicated on p. 25. Intercalary months -This topic is dealt with by me in my Preface (p. x of Vol. XIX, Sec. I, Pt. a). Here I may add the following: Year 1670 1524 1556 1937 Intercalary month JUT jyana jyaSTha ix No 35 TOI 174 270 ASADha Desire for stability --Some of the Jaina authors have expressed at the end of their work a desire that their work should last till the stability of any one or more of the following objects: Sun, Moon, Meru, Himalaya, the Pole star, the Lavana sea, Page 47 134 225 372

Page #23
Preface the earth, r'imana the liberated souls, the Jaina doctrine, a sea with a heap of jewels and the like. I shall here mention the page-numbers of such works so far as this Part I is concerned? They are: 35 (the Sun, the Moon, a sea and Meru ), 178( the earth in a lotus ), 268 ( Meru, the earth, the Sun and the Moon ), 280 (Himalaya ), 3:8 ( Meru, the pole star, stars, the Sun & the Moon ), 328 ( Meru ), 331 ( Meru ), 337 ( the Sun & the Moon ), 353 ( Meru, a sea having a heap of jewels ), 360 ( Meru, a celestial vimana, the liberated sculs & the Jaina doctrine ), 424 ( the Sun, the Moon etc.), 428 ( Meru, the Moon & the Sun ), 431 ( Meru, the earth, the Moon & ihe Sun and 434 ( the Moon, the Sun & Stars! On p. 204 it is said that the regime of Jina ( Tirthankara ) may remain victorious till Meru shines. On p. 218 a similar desire is expressed for Jainism and on p. 390 for the Jaina church. Amongst the non-Jaina authors Sivaditya ( c. 950 A. D. ) has concluded his Saptapada: thi as under:-- "BATETIT TITTIET ACA TUTI: 1 tAvata saptapadArthIyamastu vastuprakAzinI // " Assurance of fructification - This is designated as phalasruti'in Gujarati. Some of the Jaina authors while concluding their work have asserted that one would get a particular benefit by reading, reciting, studying or hearing his work. For details the following pages of this Part I may be consulted : 9 ( h ic & # ), IS (HE), 21 ( e ), 57 ( 1), S8 (HTTAISI ), 83 (IA), !05 (gifo', 217 ( #ta ), 222 ( Fnaragiati, #S&TRICE ), 228 (FFA), 237 ( FACEIT, 57 & FT ), 267 (ap) 273 (ANJALI ). 299 ( JUTATA ), 303 ( Angarg), 305 (ANJATI 1 At timos such a desire is expressed by scribes for the Mss, written by them. Vide pp. 229, 283, 284 and 428. 2 For quotations etc. the reader may refer to my article - Treat Atagit TOT" published in " Jaina Dharma Prakaga" (Vol. 81, No.5).

Page #24
Preface & kalyANa), 308 (Rddhiddhi ), 316 ( nava nidhi ), 331 ( sukha & saMpatti ), 333 ( Rddhi, sukha & sapAtta ), 334 ( sukha ) and 403 ( nava nidhAna ). In this connection I may quote the following verses from Kuvalayamala : " jo paDhai bhAva juno ahavA Ni puNei ahava vAei / jai mo bhanyo vassaM sammana jAyae tas / laddhaM pi cira hohida viya iTo kaI ga pattA / tamhA kubala yamAlaM vA ejja suDo payataNa / / "- p. 26 / Bhale - This is the name of a symbol occurring in the beginning of several Jaina Mss. It is designated as " a Jaina diagram " by Prof. A. B. Keith.' Its three simple forms are noted by me in the first three squares of Appendix II (p. 4) of DCGCM ( Vol. XVII, Pt. 2)and two ornamental forms in squares 68 and 69. This symbol " bi.ale" occurs in various combinations some of which are indicated by me on p. 12 of this Appendix II and in this Part (p. 85), too. Prof. A. B Keith has ovserved that this Jaina diagram " is sometimes held to be intended as an abbreviation of arbam". In my humble opinion this view is not correct for bale is distinct from ar ham as it is at times mentioned along with arham", and this symbol is a reprtientation--an image of a goddess named as " Bhale". In support of my opinion I quote the following lines from Vinayacandra Suri's Kavjasiksa also named as Kavisiksa ( pariccheda I, p. ! ), a work of the 13th century A. D.: ' 'bhale 'zabdavyAkhyA - AdyA zaktirasA parA bhagavatI kunAkRti bibhratI reSA( khA) [ kuNDalinIti ] varNanapadA sAmAntavidyotinI / prekSyA pu[staka mAtRkAdilikhitA kAryeSu ca zrUyate devI brahmamayI punAtu bhavataH siddhi bhale vishunaa|| 3 / ahamiti siddhacakrasya prathama bIjam akArAdi haparyantam" I may translate the above-noted verse as under: .... i Seo pp. 12 and 13 of Appendix II of DOGCM ( Vol. XVII, Pt. 2). 2 Seep.94 of DCGCM (Vol. XVII, IPt. 2) and pp. 171, 172, 176, 188, 289, 309,313,325,346,349 and 350 of this very Part I. 3 This is published by L. D. Institute of Inclology in A. D. 1964,

Page #25
Preface The goddess who is a primordial potentiality, who is supreme and divine, who bears the form of a hump-backed person, whose rekha (? line ) is described ( as kundalini), who illuminates the entire space, who is worth looking at, who is written in the begin. ning of the alphabet of a book, who is invoked in functions, who is an embodiment of brahman, who is an accomplishment and who is well-known as " Bhalo" may purify you. It may be mentioned en passant that my wife Indira has assisted me as usual in correcting the proofs of this Part I. To her credit I may add that her noble nature and especially her full and constant *co-operation irrespective of her health have enabled me to carry on my literary activities for the last fifty years with the result that there are 60 publications of mine, 20 unpublished works, about 2750 published articles and about soo unpublished ones. In the end I earnestly request the authorities of the Bhandarkar 0. R. Institute to devise means to publish in the near future the remaining portion of the Jaina Catalogue ( Vol. XVIII, Pts. 2-5 & Vol. XIX, sec. 2, pts. 2-3 & sec. 3 ) and thereby oblige ihe Jaina community in general and scholars interested in Indology in particular. Further, I hereby express my indebtedness to Dr. R. N. Dandekar for the latitude he has given to me as the Hon. Secretary of B. O, R. I. during the privuing of this Part I and request him to continue to do so for the portion to be published hereaster. Kayastha Street, Gopipura, ? SURAT 23-10-'66 Hiralal R. Kapadia 1 This pertains to preparation of Appendicos and such other laborious I work, 2 A list of articles published up to 1961 is given by me in my booklat " Hiraka gahitya vihara ".

Page #26
A LIST OF PRINTED CATALOGUES AND REPORTS ABOUT MANUSCRIPTS The following is the list of works (Catalogues, Reports, etc.) already published embodying the results of the search and preservation of Sanskrit and Prakrit manuscripts in the Bombay Circle from 1868 to 1924. All lists published up to 1884 have been incorporated in our consolidated Catalogue prepared by Mr. S. R. Bhandarkar, M.A., in 1888. The lists for the subsequent years are to be found embodied in the various Reports published thereafter. These Reports are of considerable value, in as much as they give in many cases the history of individual manuscripts, personal details of authors, their chronology, and such other items. All these works are therefore here put together in one place for ready reference. Papers relating to the Collection and Preservation of the Reports of ancient Sanskrit Literature, were edited by order of Government of India, Calcutta, 1878, by Mr. E. A. Gough. This is a useful work for the general history of the Search during the earlier period upto 1878 and contains, among other things, lists of manuscripts bought for Government during the years 1868-69, 1869-70, 1870-71, 1871-72, 1872-73 and 1874-75. All these lists, originally published at different times, were also included in our consolidated catalogue (to be mentioned below) published in .888. Report on the results of the Search for Sanskrit Manuscripts in Gujarat during 1871-72, by G. Buhler, Surat, 1872, 11 pages in folio. Report on Sanskrit Manuscripts 1872-73, by G. Buhler, seven and seventeen pages. Bombay, 1874. Report on Sanskrit Manuscripts 1874-75, by G. Buhler, 21 pages. Girgaum, Bombay, 1875. Detailed Report of a Tour in Search of Sanskrit Manuscripts made (in 1875-76), in Kashmir, Rajputana and Central India, by G. Buhler. Extra No. XXXIVA, Vol. XII of the Journal of the Bombay Branch of the Royal Asiatic Society, Bombay, 1877.

Page #27
A List of Printed Catalogues and Reports Lists of the Sanskrit Manuscripts purchased for Government during the years 1877-78, and 869-78, and a list of the Manuscripts purchased from May to November 1881, by F. Kielhorn, Poona, 1881. xiv A Report on 122 Manuscripts, by R. G. Bhandarkar, Bombay, 1880, 37 pages in folio. Report on the Search for Sanskrit Manuscripts in the Bombay Presidency during 1880-81, by F. Kielhorn, Bombay, 1881. A Catalogue of the Sanskrit Manuscripts in the Library of the Deccan College (being lists of the two Visramabag collections). Part I prepared under the superintendence of F. Kielhorn; Part II and Index prepared under the superintendence of R. G. Bhandarkar, 1884, 61 pages in folio. A Report on the Search of Sanskrit Manuscripts during 1881-82, by R. G. Bhandarkar, Bombay, 1882. A Report on the Search for Sanskrit Manuscripts in the Bombay Presidency during 1882-83, by R. G. Bhandarkar, Bombay, 1884. A Report on the Search for Sanskrit Manuscripts in the Bombay Presidency during 1883-8, by R. G. Bhandarkar, Bombay, 1887. A Report on the Search for Sanskrit Manuscripts in the Bombay Presidency during 1884-87, by R. G. Bhandarkar, Bombay, 1894. A Report on the Search for Sanskrit Manuscripts in the Bombay Presidency during 1887-91, by R. G. Bhandarkar, Bombay, 1897. A Consolidated Catalogue of the Collections of Manuscripts deposited in the Deccan College (from 1868-1884) with an Index, by S. R. Bhandarkar. A Report on the Search for Sanskrit Manuscripts in the Bombay Presidency during 1891-1895, by A. V. Kathawate, Bombay, 1901. Detailed Report of Operations in Search of Sanskrit Manuscripts in the Bombay Circle, August 1882 to March 1883, by P. Peterson, Extra No. XLI, Vol. XVI of the Journal of the Bombay Branch of the Royal Asiatic Society, 1883, Bombay.

Page #28
XV A List of Printed Catalogues and Reports A Second Report of Operations in Search of Sanskrit Manuscripts in the Bombay Circle, April 1883 to March 1884, by P. Peterson, Extra No. XLIV, Vol. XVII of the Journal of the Bombay Branch of the Royal Asiatic Sociezy, 1884, Bombay. A Third Report of Operations in Search of Sanskrit Manuscripts in the Bombay Circle, April 1884 to March 1886, by P. Peterson, Extra No. XLV of Vol. XVII of the Journal of the Bombay Branch of the Royal Asiatic Society, 1887, Bombay. A Fourth Report of Operations in Search of Sanskrit Manuscripts in the Bombay Circle, April 1886 to March 1892, by P. Peterson, Extra No. XLIX A of Vol. XVIII of the Journal of the Bombay Branch of the Royal Asiatic Society, 1894, Bombay. A Fifth Report of Operations in Search of Sanskrit Manuscripts in the Bombay Circle, April : 872 to March 1895, by P. Peterson, Bombay, 1896. A Sixth Report of Operations in Search of Sanskrit Manuscripts in the Bombay Circle, April 1895 to March 1898, by P. Peterson, Bombay, 1899. This contains also a list of manuscripts purchased by Professor Peterson from 1898-99. Lists of Manuscripts Collected for the Government Manuscripts Library by the Professors of Sanskrit at the Deccan and Elphinstone Colleges containing the following Collections : (i) 1895-1902, (ii) 1899-1915, (iii) 1902-1907, (iv) 1907-1915, (v) 1916-1918, (vi) 1919-1924 and (vii) 1866-68.

Page #29
DESCRIPTIVE CATALOGUE OF MANUSCRIPTS IN THE Government Manuscripts Library VOLUMES PUBLISHED No. Rs. P. Vol. I, Part I-Vedic Literature, Samhitas and Brahmanas pp. xlviii + 420, 1916, compiled by the Professors of Sanskrit, Deccan College, Poona 4-00 Vol. II, Part I-Grammar (Vedic and Puniniya ) pp. xvi + 348, 1938, compiled by Dr. S. K. Belvalkar 4-00 Vol. IX, Part I--Vedanta (all schools ) pp. xx + 478, 1949, compiled by Dr S. M. Katre 6-00 Vol. IX Part 11-Vedanta pp. xxiv + 420, 1955, compiled by Dr. S. M. Katre 6.00 Vol. IX, Part III-Vedanta, pp. xx+281, 1963, compiled by Dr. S. M. Katre 6-00 Vol. XII- Alamkara, Saingita and Natya, pp. xxii + 486, 1936, compiled by Dr. P. K. Gode 5-00 Vol. XIII-Kavya compiled by Dr. P. K. Gode Part I-pp. xxiv + 490, 1940 5-00 ,, ,, Part II-pp. xxix + 523, 1942 6-00 Part III ---Stotras, etc. pp. xxiv + 515, 1950 6-00 Vol. XIV-Nataka, pp. xx + 302, 1937, compiled by Dr. P. K. Gode 4-00 Vol. XVI, Part I-Vaidyaka, pp. xxiv + 418, 1939, compiled by Dr. H. D. Sharma 4-00 Vol. XVII--Jaina Literature and Philosophy ( Agamika Literature ) compiled by Prof. H. R. Kapadia. ,, Part I pp. xxiv + 390, 1935 4-00 Part II pp. xxvi + 363, + 24, 1936 4-00 Part III pp. xxxvi + 530, 1940 5-00 >> Part IV-pp. xxiv 280, + 1948 4-00 Part V (Ten Appen.)--Pp. xxix+298, 1954 5-00

Page #30
No. Vol. XVIII-Jaina Literature and Philosophy, (Logic, Metaphysics etc.) Part I pp. XXVIII + 498, 1952, compiled by Prof. H. R. Kapadia 33 Vol. XIX-Jaina Literature and Philosophy, Section I (Hymnology) compiled by Prof. H. R. Kapadia. Part I, Svetambara works pp. xxviii + 368, 1957 Part II, Svetambara and Digambara works along with Appendices I-X pp. 16 + xx + 454, 1962 dr wr Descriptive Catalogue of Manuscripts 39 Volumes in Press Vol. I, Part II-Upanisads by Dr. P. K. Gode. Vol. XVI, Part II-Tantra by Dr. H. D. Sharma. Vol. VII, Part I-Dharmasastra by Dr. H. D. Sharma. xvii Rs. P. 7-00 6-00 10-00

Page #31
Regulations of the Manuscripts Department 1. "The Government Manuscripts Library "formed and maintained by the Government of Bombay, and formerly deposited at the Deccan College, Poona, is now, subject to the general control of the Department of Education, Bombay, placed under the direct charge of the Bhandarkar Oriental Research Institute, Poona. 2. The Department is administered by a Superintendent appointed by the Executive Board of the B. O. R. Institute subject to the approval of Government. 3. The Manuscripts are available at the Institute, during working hours, for purposes of bona fide study. 4. The Manuscripts in the Library, if, in good condition, and subject to the requirements of Department, are lent out to bona fide scholars on their applying for them in writing to the Superintendent of the Department or to the Secretary of the Institute. Such scholars shall, however, execute a bond for the value of the manuscripts required, this value being fixed by the officers in charge of the Library. s. In the case of scholars from outside India all requisitions for loans of Manuscripts shall be made to the diplomatic representatives of the Government of India in the respective countries. In countries where there are no representatives such demands should be made through the High Commissioner for India in Great Britain. Such scholars shall execute the necessary bond with that authority at his discretion. 6. In the case of scholars in India the execution of the bond shall be necessary before the manuscripts are lent out. When the applicant is not sufficienily known to the Superintendent of the De. partment, this latter officer shall have the power to call upon the applicant to produce a certificate as to his interest in the study of Sanskrit Literature, and of his being a fit person to be entrusted with Government manuscripts. Such a certificate shall have to be signed by Orientalists of recognised position, or by Government officers of provincial or other higher service, not below the rank of a Depury Collector or Extra Assistant Commissioner. The certificate should contain a reference to works or essays published by the applicant. 7. All applications for manuscripts shall state the reasons for which the manuscripts are required and the period for which the loan is sought.

Page #32
Regulations of the Manuscripts Department xix 8. If any manuscripts belonging to this Library have been used in the publication of an edition, or in any other learned disquisition, the authors should present to the Manuscripts Library a copy of the work or works so published. 9. The number of manuscripts to be lent out at time to a scholar, and the period of loan, is determined by the officer in charge of the Library. Usually, however, in the case of Indian scholars, not more than five manuscripts are allowed to remain with them at a time, and the period of loan shall not normally exceed six months. 10. Immediately on receipt of manuscripts, the scholars are requested to examine them carefully before signing and returning the receipt-form accompanying the manuscripts, as no complaints will be entertained thereafter. II. When the manuscripts are returned to the Library they are duly examined, and if found in their original condition, the receipt formerly signed for them is returned and the bond cancelled. The liability of the borrowers ceases only after the return of this receipt. 12. If scholars find that, owing to the work on the manuscripts not being completed within the stipulated period, they cannot return the manuscripts when due, they shall, sufficiently in advance, apply in writing to that effect to the Superintendent of the Department. The period of loan will be extended at discretion. In no case, however, shall any manuscripts be allowed to remain with a scholar longer than two years in India, and five years outside India. 13. The Manuscripts Department reserves to itself the right of refusing to lend out any manuscript to any scholar at any time, and in the case of manuscripts lent out, of demanding their return before the expiry of the stipulated period, if the manuscripts be required for library or other purposes. 14. All postal charges shall be borne by the applicant. 15. The Department undertakes to procure on loan, for the members of the Institute, manuscripts from other lending Libraries.

Page #33
SYSTEM OF TRANSLITERATION ___ a a A / i i I 1 u u U // x ka la ! ee ai ai o 0 au au k k kh gUg [ gh ii ca c _ch - j jha jh Ji T ! th d da dh N ! t + th th d d 5 dh - n p p ph ph bU b bh bh m m - ra ra l 1 v v z / oss eh visarga h, anusvara m.

Page #34
JAINA MANUSCRIPTS

Page #35

Page #36
JAINA LITERATURE AND PHILOSOPHY VOLUME XIX SECTION II: NARRATIVES PART I (a) The Svetambara Works agaDadattacatuSpadI Agadadattacatuspadi ( 10789719) (Agadadattacopai ) 605 ( a ). No. 1 1992-95. Size.-- 104 in. by 4 in. Extent.- 14 folios ; 13 lines to a page ; 42 letters to a line. Description.- Country paper not very thick and grey in colour ; Jaina Devanagari characters with TTHETS ; bold, quite legible, elegant and uniform hand-writing ; borders doubly ruled in red ink; upper edges of all the foll. eaten is away by white ants in a number of places though slightly; condition tolerably good; pauses marked vertically in red ink; yellow pigment used more often in the end than in the beginning ; foll. numbered as usual ; complete ; composed in Samvat 1625 in Viramapura; this Ms. contains an 20 additional work named as Tahita; it begins and ends on fol. 146. Age.- Samvat 1653. Author.- Vacaka Kusalalabha, pupil of Abhayadharma. His other works are : (1) metara argenta (2) PATRITA-FSTATIST-HAT: V. S. 1621.

Page #37
10 Jaina Literature and Philosophy [1. (3) DolAmArucopAi V. S. 1617. (4) tejapAlarAsa V. S. 1624. (5) navakArachanda (6) mAdhavAnalacopAi V. S. 1616. (7) zrIpUjyazAhaNagIta (8) stambhanapArzvanAthastavana Subject.-- A narration of Agadadatta in Gujarati in singable metres. Begins.- fol. !" pAsa jiNesara paya nemI / sarasati devi (? samarevi ) / amayadharma uSajjhAya gurupayapaMkaja paNamedi / 1 / vItarAga zrImukhi bdi| dharmaha cyAri prakAra / dAna sIla tapa bhAvanA / vividha bheda vistAra / 2 / etc. Ends.- fol. 14 tihAthI cavInaI uttama ThAmi / uttama kuli saMyama abhirAma / ghaNA jIva pratibodhI karI / anukrami pAmesi za(zivapurI // 17 // saMvata bANa pakSa siNagAra 1625 / kAtI sudi pUnimi guruvAra / zrI bIramapura' nayara majhAri / karI caupaI mati aNusAri / 18 / zrIjinacaMdrasAra gururAya / guruzrI abhayadharma ubajjhAya / bAcaka kuzalalAma ima bhaNai | sukha saMpati thAi ApaNaha // 19 // iti bhIagaDadattarAsa saMpUrNaH / / / saMvata 1653 varSe pauSavadi bhaumavAsare caturthItithau liSitaM. Reference.- For an additional Ms. and extracts from it see Jaina Gurjara Kavio ( Vol. III, Pt. I, pp. 686-687 ). 20 agaDadattacaritra 8. Agadadattacaritra 328. No.2 1871-72. Size.-91 in. by 4g in. Extent.- 28 folios ; 16 lines to a page; 40 letters to a line. Description.-Country paper thin and white; Jaina Devanagari characters'; sufficiently big, legible and fair hand-writing ; borders ruled in two lines in red ink; red chalk used ; foll. numbered in the right-hand margin only; complete3B composed in Samvat 1787 in Patana; condition tolerably good.

Page #38
3. The Stetambara Works Age. Not modern. Author:- Santasaubhagya, pupil of Premasaubhagya. Subject.-- Life of Agadadatta based upon Nandisutra as stated by the author. Begins.-- fol. I" // 50 // zrIgurubhyo namaH sAradAya namaH 10 bhImahimA jaga vistaraI nIna japatA jasa nAma / se jina pAyanA praNamAI lahihAMData kAma // 1 // etc. agaDadatta munIvara bhalo pAmyo bhavano pAra | mArIcaritra bilokanI athara jANI saMsAra 7 etc. Ends.-- fol. 286 ehavA carItra je nArinA jANI alagA rahajo tumo prANI he.h.||6|| meM to kAhA cha bAlakrIDA huM saMjoDI jAMNu he.s.||7|| gurUne pasAra karIne jAMNu agaDadatta RSI yazApuM he.I. // 8 rAjasAgarasarIzvarasISya sakala paThita mAhe dakSa hai. sN.| baghadharI namI vRdhasAgarasUrI eka jAnamA mata jaharI purI ... // lakSmIsAgara paTTarAyA kalyANasAgara pada pAyA hai. sN.| bAcaka mAha sIromaNI jANo satpano bhAgyazANo hai. saM. 8 vAcaka idrasaubhAgya guruyA vIrasaubhAgya pada pAyA he.. sasa pATeM guru ehayA rAje jJAna karani gAje he. su|| 10 // premasAMbhAgya eka supasAyeMthI zAMtasaubhAgya guNa gAyA he. 6. // 10 // mAcho adhiko je meM kATo mI(mi)cchA mI(mi) duka(kaDa meM dIdhA he.. 'pATaNa'mAhe e guNa gAyA jAta nisANa bajAyA he.sN||11|| nandisatramA e tumo jANo tAhAMthi ema ANo he. su. 12 saMcata (saM)jamaguNa ANo nAga parvata (1787 ) ANI he.. chadhImI ekahI DhAla hojo maMgalamAla hai. sa. 12 (1) ||bhaadrvaa sada ekAdasa jANo vAra te vkhaanno|| iti bhIagaDadattacarAMtraNa dvItIya paMDa saMpUraNa bhIpArzvaprasAdeNa kRtaM 7 bhAdarayo mAsa tame jANo sarva gAthA 846 zloka 256 Reference. - This very Ms. is noted in Jaina Gurjara Kavio (Vol. II, p. 562). 20 30

Page #39
Jaina Literature and Philosophy [3. agaDadattacaritra Agadadattacaritra No.3 1568. 1891-95. Size.- 7. in. by 47 in. Extent.- 23-3%D20 folios; II lines to a page; 37 letters to a line. Description.- Country paper thick, tough and greyish in colour ; Jaina Devanagari characters; legible, bold, big and fairly good hand-writing ; borders ruled in three lines in red ink; even their edges ruled in double red lines; red chalk used for marking the numbers of couplets; foll. numbered in the right-hand margin ; fol. 236 blank; foll. 2, 3 & 8 missing; white chalk used in place of yellow pigment ; condition very good except that edges of some of the foll. are slightly gone; complete; composed in Samvat 1703 in Vairayara. Age.- Samvat 1732. Author.- Punyanidhana, pupil of Vimalaudaya. Subject. - Life of Agadadatta described in Gujarati in verse in __metres such as dUhA, copaI etc. Begins.- fol. I. aiM namaH / duuhaa| paramesara dhuri praNAmi kari / sadaguru praNami ulAsa / sarasati paNi praNameva kari / viracisi vacanavilAsa // 1 // paramesara yai macala pada / sadaguru zruta savicAra / sarasati vacanavilAsa dyai / tiNi tIne tatasAra // 2 // etc. Ends.-- fol. 23. zAlibhadra cha(gha)nA RSinI pari / jaisaI gajasukumAlI / " // 2 // saba prajunna mahARSi DhaMDhaNa / tima kahai jAla myaalii| jabU vairakumAra taNu jasa / avaMtIsukumAlI // 3 // 10 | abhayakumAra acala vijayAdika balabhadra muni suvicaarii| dha(?)ramarucI aNagAra cilAtI / anaMta anIka aNahAra // 4 // __ a0| bIse thAnaka tapasyA tapatau / bAvIsa parIsaha dhaarii| anukrami aNasaNa pacaSi anopama / pahUtA saraga majhArI // 5 // a. saMvata guNa nabha (muni) zisa (1703) varasaha vijayadazami / de(di)na rNgh| 20 23 30

Page #40
The Svetambaru Works agaDadattacaritra paripUraNa / kIdhau atiucharaMgai // 6 // a0 iNi paribhASita jAgai je jana / nisadina te muvicaarii| agadatta tiNanI pAra pAvaha / suSa saMpati naranArI // 7 // a0 zrIbhAvaharaSa gura anaMtahaMsamaNi | vimalaudaya sapakArI / puNyanidhAna vaNArasa pamaNai / tAsa sIsa suvicArI // 8 // adeg5 'bArAyara' puravara caumAsai / kIyu caritra annuhaarii| sumatinAtha zItala jinasAnidhi / zrAvaka guru suSakArI // 9 // a. iti bhIagaDadattacaupaI saMpUrNaH / saMvat 1732 varSe likhitaM pA(0) shriidevcNdrjii| tataziSya pA(0)zrIdhIracaMdrajI ciraM naMdyAt / / zrIH Reference.- For another Ms. and extracts therefrom see Jaina 10 Gurjara Kavio ( Vol. III, Pt. 2, pp. 1139-1140). - 15 20 bhagaDapattarAsa Agadadattarasa 1569. No.4 1891-95. Sizc.- 9 in. by 4 in. Pxtent.-- 19 folios ; is lines to a page; 32 letters to a line. Description.-Greyish country paper ; Jaina Devanagari characters; legible, bold and tolerably good hand-writing; borders carelessly ruled in three lines in black ink; upper edges rather tinged with red ink ; the first and the last foll. have each a white paper pasted to them; condition on the whole good ; foll. numbered as usual ; complete ; com. posed in Samvat 1679 in Bhuja. Age.- Sarmvat 1780. . Author.-Lalitakirti, pupil of Labdhikallola. Subject - The life-story of Agadadatta in Gujarati in different metres. The work is divided into sections styled as pras. It is based upon Uttarajjhayana (ch. IV). Begins.-- fol. 1 CET nAbhimahIpatisapta jaNau | AdIsara arihaMta / mana vacanaha kAyArI / paNamI zrIbhagavaMta // 1 // bacanasudhArasa gharasatI / sarasati paNamI pAya / kAlivAsanA tAkIyau / saraSathI kavirAya // 2 // etc. 25 30.

Page #41
Jalna Literature and Philosophy Ends.-fol. 190 bhapramattamapaNahajo pagi e rahyo re| agaDadatta aNagAra / bhApada Tali pagi pagi saMpada lahI re / lahisyaha bhavano pAra // 10 // ima bhIuttarAbhyayanaha pa riSi bhASIyo jI / cAuthA ajjhayaNa rsaalaa| agaDadatta muninA guNa gaavtaare| phAlIya manorathamAla / / 11 // ima saMbata sola iguNAsI (1679) baccharaha re| zrI bhuja' nayara majhAri / meThA vi panima raliyAmaNI re / dinakara moTau bAra // 12 // ima bhI kharataragacchanAyaka dIpato re| shriijinraajmriNd| tehanA rAjA iNi munivara taNAre / guNa gAyA ANaMda // 13 // ima sakala AcArija mAhi dIpatore kIrAtaratanasUrIsa / mAnI sApA gaccha mAhi gahagahAre / pUraba manaha jagIsa // 14 // ima // haraSavisAla savAcaka tehana re / pATaha ugyA mANa / haraSadharama vAcaka pali tasaM taNahare / sAghumadira Na jANa / / 15 // hano sIsa vinayaguNa Agalau re / vimalaraga mani tAsa / lavadhikalolagaNi vAcaka te sobhatAre / tAsa sIsa ullAsa // 16 // lalitakIrati kahA bhaviyaNa sAMbhalo re / sAdhu taNA guNa gaai| rasanA kI pavitra mA ApaNI re / labAdhikallolasapasAya / / 17 / / ima sAMgalatAM bhaNatAM guNa sAdhunA re / roma roma suSa thaay| nita ANaMda raMga badhAmaNAM re / avicala saMpada thAya // 18 // iti zrIagaDadattarAsaH saMpUrNaH // graMthAgraMtha 5031 // zrIsaMvat 1780 varSe jyeSThasadi 9 dine budhavAsare zrI pATodhI'nagare vA. zrI 5 zrI. nAnanidhAnagaNiziSyavA-vidyAbimalagaNilikhitaM tattariSyapa-mahimA sukhamanipaThanArtha taziSyapaM.)raMgaSemamanibhAtR mataSemamanirA parata sa. Reference.- For additional Mss. see Jaina Gurjara Kavio (Vol. III, Pt. I, p. 992). 20 25 aghaTakumArakathA Aghatakumarakatha 606. No.5 1892-95. Size.- 10 in. by 43 in. Extent. - 6 folios; 17 to 18 lines to a page; so letters to a line.

Page #42
6.1 The Svetambara Works Description.- Country paper very thin and greyish in colour ; Jaina Devanagari characters; bold, uniform, quite clear and sufficiently big hand-writing ; borders ruled in three lines in red ink ; foll. numbered as usual; corners slightly worn out; condition tolerably good. Age.-Old. Subject.- A narration of King Agharakumara in 269 verses in Sanskrit by way of illustrating the fructification of merit. This narration exists in three recensions. Of them one is in prose, and it is translated into German by Dr. 10 Miss Krause and published in " Indische Marchen", Leipzig in A. D. 1922. Begins.-- fol. 1 prANinAmasahAyAnAmapi puNyavatAmiha // aghaTasyeva jAyate ravipadorpiha saMpadaH // 1 // bhaghaTita ghaTitAni ghaTayati / sughaTitaghaTitAni jarjarIkate / vidhireva tAni ghaTayati / yAni pumAn naiva ciMtayati // 2 // Ends. fol. 66 pApairayaM saghaTitakSitiballabho(a)pi prApa prasiddhastarAjyaSiyogaHkhaM / pako(5)gaNyairaghaTastu puNyaH prAjyaM samAsAvayati sma rAjyaM // 6 // iti puNyaviSaye aghaTakumArakathA samAptAH // // paMcA // 29 // // zrIH / / shriiH|| cittavittasapAtrANAM yoge dAnaM jinotmaiH| 35 proktaM deyaM svasya vyAya / zAlibhadra ivAMgibhiH // 1 // Reference.-- For additional Mss. see Jinaratnakosa ( Vol. I, p. 1). ajAputrakathA Ajaputrakatha No.6 607.. 1892-95. Size.- 104 in. by 4: in. Extent.- 9 folios ; 16 lines to a page ; 36 letters is a line. Description.- Country paper very thin and greyish ; Devanagari characters with pals; bold, elegant, quite clear and uniform hand-writing; borders ruled in four black lines 35

Page #43
's Jaina Literature and Philosophy [ 6. with a little space between the two pairs; foll. numbered as usual ; red chalk used occasionally; condition tolerably good. Age.- Appears to be at least 150 years old. Author.- Not mentioned. Subject.-- A narration of Ajaputra in Sanskrit starting with Sanskrit verses which are intercepted by .prose passages and quotations. On the whole it is an interesting work. Begins.-- fol. 1 puNyaprabhASato jariha loge(ke)'pi saukhyabhAg / Testigat a GIFTIAI fuga: 11 9 11 etc. Ends.-- fol. 96 Faretra ar aizrazATAHTI Hat varia ya fasta 97.1 ca tasyAH kiva(ya)tkAlaM viyogaduHkhaM dattavAn / taduHsvakarmataH pitrAtiniyogato bhramana yat puNyaM tattavyAstena rAjyasaMpado vyAptakAnityajAputrakathA 11 11TH * 11 w all ligi yoo Reference.- Only this Ms. is noted in Jina atnakosa (Vol. I, p. 2). 10 20 ajAputrakathA Ajaputrakatha 1571. No. 7 1891-95. Size: - toj in. by 43 in. Extent.-- 13 folios ; 16 lines to a page ; 40 letters to a line. Description.- Country paper thick, tough and grey ; Devanagari characters.; bold, clear but not very good hand-writing; borders ruled in two lines in red ink ; their edges ruled singly in the same ink; foll. numbered as usual; white chalk used in place of yellow pigment; complete; condition excellent; composed in Sini(ji) in Samvat 1561. Age.-- Samvat 1926. Author.- Pandita Dharmadeva, pupil of Saubhagyaratna Suri, successor of Gunadhira Suri. Subject - Life-story of king Ajaputra in Gujarati in singable metres. 30

Page #44
10 8.] The Svetambara Narratives Begins.- fol. . namaH // dahA // ATha mahAsiddhi pAmiiM samare jehane nAmi praNathaM jinavara AThamo zrIcandraprabhasvAmi / 1 // goyama gaNahara pAe namI samarI:zArada mAya / sahi guru baMdI varNatuM ajAputra nararAya // 2 etc. Ends.- fol. 136 deha beTAne rAjya sIpa ajAputra rAI lIdhi dISya vikSA pAli mani siddhi devalokani pAmioziddha 76 'pUnima' pakSi kareM jayakAra zrIguMNadhIrasUripATazRMgAra zrIsaubhAgyaratanasargasa munivara dharmadeva tehano sIsa 77 saMvata panara ekasaThe (1561) nAmi rahiyA caumAsi te sINI' prAmi zrIcaMdraprabhasvaM(svA)mIcarItra vAMcyuM caumAsI pustaka tatra 78 ajAputranI kathA rasAla tasa dhari bhASI cha mavizAla tihAM taNo zrIsaMgha mujANa:vinave tehatuM suMNI vaSAMNa 79 mulalita AMNI 'cupahabaMdha eha kathAno kayoM prabaMdha dharmadeva paMDita karyoM prabaMdha mAMhiM AMNyo che sarva saMbaMdha 80 prabaMdha nAhvAno karyo AkSepa kAMi navi kIdho varNanakSepa to have caupAIsaMkhyA milI triNa se ne byAsI (382) balI 81 prabaMdha ajApU(pu)tra bhUpati taNo udyama AMNI bhadhIyaNa bhaNo bhaNatA hoiM nirmala buddhi bhaNatAM hoI maMgala riddhi 82 iti zrIajApUtrano rAsa saMpUrNa // saMvat 1926 nA pezApa yadi 7 Reference. For an additional Ms. and extracts therefrom sec Jaina Gurjara Kavio ( Vol. I, pp. 108-109). 20 25 ajAputrakathA Ajaputra katha vivaraNa sahita with vivarana 1570. No.8 1891-95. Size.- 98 in. by 41 in. Extent.-- 30 folios ; 12 lines to a page ; 38 letters to a line. Description.- Country paper thin, brittle and very greyish in colour; Devanagari characters with very rare pRSThamAtrAs%3 bold, legible, uniform and big hand-writing ; borders trebly ruled in black ink; edges of several foll, worn out; IJ. L. P.1 30

Page #45
10 Jaina Literature and Philosophy [8. foll. numbered as usual; foll. 1 and 20 as well as the last three foll. have strips of paper pasted to them and the missing letters written on them; condition fair ; red chalk used at times; yellow pigment used very rarely; both the text and its commentary complete. Age.- Old. Author of the text.- Not mentioned. __ , , , elucidation.--, ,, Subject.-- A narration of Ajaputra in Sanskrit and Gujarati inter mixed ; the Gujarati portion being mostly explanation of the preceding Sanskrit one which is neither solely in prosc nor in verse. Begins.- ( text ) fol. !"zrIvItarAgAya namaH // dhammo maMgalamuttamaM narasarazrIbhuktimuktiprado dharmaH sidhyati baMdhuvada dizati vA kalpadruva vAMchita dharmassaguNasaMkramo gururiha svAmI ca rAjyaprado dhamma jyoti piteva vatsalatayA mAteva puSTIti vaH // 1 // "-(com. ) lol. 1" e dharma vItarAganu bhASiu / sarva maMgalIka mAhi utkRSTaM maMgalika jANiSu / paNi e dharma kahe chaH narasarazrIbhuktimuktipradaH nara bhaNI manuSya pura bhaNI devatAM teha taNI zrI bhaNI lakSmI teha taNaM deNa. hAra chaha / etc. Ends.- (text ) fol. 30 tataH kyunvA mu(ma)na(na)jatve rAjyatvaM prApya bhIcaMdraprama svAmino datta iti nAmnA gaNadharo bhUtvA kevalajJAnaM prAdhya siddhi jagAma / "-(com. ) Hol. 30deg hiva te ajAputra devatAnA suSa bhogavI / (ma)niSpamaye AdhI munakSa sabaMdhIyA sopyA bhogI / zrIcaMdraprabhasvAmina prathama gaNadhara patta nAmA thaIni kevalajJAna upArjI mokSa paratu / / // ajAputrakathanipaM kRtA mANitejakuzalapaThanArthe / pAzaM pustake dRSTvA / tAdRzaM liSitaM myaa| yadi zudamazuddhaM vA / mama doSo na dIyate / 1 / muni jAnani parati chaha sahA 2 Reference.-- Mss. of two anonymous works named as 'Ajaputra kathanaka' are noted in Jinaratnakosa (Vol. I, P.2), 20 30 -

Page #46
The Svetambara Narratives ajanAsundarIcatuSpadI Anjanasundaricatuspadi (anAsundarIcopAi) (Anjana sundaricopai ) 330. No. 9 1871-72. Size.- 10. in. by 4 in. Extent.- 24 folios ; Is lines to a page; 39 letters to a line. Description - Country paper thin and white; Jaina Devanagari characters; big, clear and very fair hand-writing: borders Tuled in three lines and edges in one in black ink; red chalk and yellow pigment used; foll. numbered as usual; 10 fol. !' blank ; complete; 3 khandas in all; condition very good. Age.- Samvat 1762. Author.- Punyasagara Vacaka, pupil of Labdhisagara of 'Pipala' gaccha. Subject.- Narration of the life of Anjanasundari, wife of King Pavananjaya and mother of Hanumat in verse in Gujarati. Begins.- fol.7deg zrIzaSezvarAya namaH // haa| 20 bhIgaNadhara gotama pramukha ekAdaza abhirAma / manapaMrita saSa sNpjii| niti samaratA nAma // 1 // etc. pavanaMjaya rAjA taNI / aMjanAsaMdari naari| tAsa kathA muNatA thakAM / hosi alpa saMsAra // 8 // etc. Ends. - fol. 24*iti zrIaMjanAsUMdarIpavanaMjayakumArasaMbaMdhapUraSabhavavarNanaM / mAtula pure samAgamanapavanaMjayakumAra punarapi gRhAgamana / aMjanAsuMdarIdaryadarzanAra 35 birahavilApasamana / RSabhadattaddhikaraNAya mAtulapure samAgamane aMjanA. saMdarIpavanaMjayakumAra ekatra maulana-sAdhusamIpadIkSAgrahaNa-uraloke gamanAvikAravarNanA tRtIyakhaNDa saMpUrNa / saMvat 1762 varSe AsAra yadi 13 eke mahopAdhyAyazrIpadIptivijayagaNiziSyagaNiyAvijayapaThanArthe / zrI saMkheDA' nagare ga harSavijayalapItaM / tc.e. 30 Reference.- For additional Mss. see Jaina Gurjara Kavio (Vol. III, Pt I, pp. 1027-1028 ). N. B.- For other details see No. 1o.

Page #47
12 Jaina Literature and Philosophy [ Io. adhanAsundarIcatuSpadI Anjanasundaricatuspadi No. 10 ___26. 1877-78. Size.- 91 in. by 4 in. Extent. -- 28 folios; 12 lines to a page; 40 letters to a line. s Description. - Country paper somewhat thick, tough and white-; Jaina Devanagari characters; big, quite legible, uniform and very good hand-writing ; borders ruled in three lines and edges in one in reddish ink; red chalk used; foll, numbered in the righr-hand margin; fol. 1' blank ; yellow pigment used while making corrections ; condition excellent except that edges of the first and the last foll. slightly gone ; based upon Silatarangint ; complete ; com. posed in Samvat 1689; extent 939 slokas ; the entire work is divided into three khandas as under : Khanda I foll. 1 to .. ... II , 9 , 18b. " III , 18 " 28. Age.- Not modern. : Begins.- fol. 1 560 OM namaH zrIgurubhyo namaH 20 . zrIgaNadhara gautama etc. as in No. 9. - fol. 9" iti zrIaMjanAsudariparihAravarNano nAma prathamakhaMDa ___ samAptaH // 1 // - fol. 185 iti zrIaMjanAsuMdarIpavanaMjayakumArasaMbaMdhe dvitIyakhaMDa samAptam // Ends.- fol. 18 bhAhe sIlataraMgiNI graMthI e racIo saMketa kAMika kadhimata keladhI mahaM kIu chaha heta 3 Ahe te dUSaNa mata kADhayo grahajyo kaviguNaraMgI somatti mh| bhANIo lAgi sarasa mucaMga Ahe bhiimunisuvrtsvaaminaa| bArahaI cyA vAta kehI jina vici e gayA kuNa jAMNara bhavadAsa // 4 // Ahe yugapradhAna jiNesari kahIyA jJAnapramANa taam| bacana satya mAMnIi kuo vahIe jinaann| 30

Page #48
.] The Svetambara Narratives bhAhe tAsa vacana lopa karI jima bhASyau mitisAra / se pakSa 'micchA mi dukkaDaM' sAbhalajyo naranAri // 5 // Ahe bhI paDhagacchaguru gAIDa sAMtisari gaNadhAra / cakkesari padamAvatI devI Avaha vAraMvAra / bhAhe bhaMgacchavaTTaNNa tApIo / dhUlikoTa saMketa chaMdava 'zrImAlI' sAta saiM ugAsvAryA) guNaheta // 6 // Ahe bhoja caurAsI rAjamaI jItvA vAda vizAla / sAsanajina somAvio vAdI birudavetAla // Ahe tiNi gaccha 'pIpala' thApIo ATha zAkhA vistAra / saM(ba)ta rudra bAvIsaha (1122) samai huA te sapakAra / / 7 // 10 bhAhe te gaccha dIsai dIpatau zrI sAcora' majhAri / ghAra ji'Nasararau jihAM tAratha pragaTa udaar| Ahe vA(tA)su pATi anukrami huA / zrIlabdhisAgaramA vimayasAja karmasAgara vAcaka doi sanurI // 8 // Ahe tAsa sIsa puNyasAgara vAcaka pamaNai ema / aMjanasuMdarIcaupaI pUraNa vadhatai prema / Ahe saMbata sola navyAsIDa (1689) zrAvaNa mAsa rasAla / hadi tithi paMcamI niramalI RddhiddhimaMgalamAla // 9 // iti zrIaMjanAsuMdarIpavanaMjayakumArasaMbaMdhe pUrvabhavavarNano nAma tRtIya khaMDa samApta prathama khaMDe DhAla 7 dUhA 182 dvitIya khaMDe DAla 7 dahA 207 20 vatIya khaMDe DhAladahA gAthA 242 graMthAgraMtha zloka mili 939 sarva saMdhyA jANavI // zrIkalyANamastu / N. B.-- For additional information see No.,. 5 ananArAsa Anjanaraga No. 11 ____329. 1871-72. Size. -109.in. by 44 in; Extent.- 13 folios ; 15 lines to a page ; 42 letters to a line. Description.-- Country paper tough and white; Devanagari charan cters; big, legible and good hand-writing ; borders ruled in three lines and edges in two in red ink ; red chalk used ; foll. numbered in both the margins as usual; fol. ! blank; complete so far as it goes; condition very good. 30

Page #49
Jaina Literature and Philosophy Agc.-- Sathvat 1840. Author.-- Not mentioned. Subject.-- Life of Anjana in verse in Gujarati. Begins.-- fol. 1b Il pahilene kaDave ho pAya namuM bhavaduSamaMjaNa je bhagavaMta to|| karmakA yA(ghA)taNA kApasaM hivai pApanA paramava AMNasaM aMta to|| rAsa bhaeM satI aMjaNA dAna dayA guNa sIla saMtoSa to etc. Ends.-- fol. 13 sIla taNA rAMNa dharaNagyA hivai satIne sAdhavI aMjaNA heja to // pa kathA saMbaMdha pUrI thayau hive Agali sItA taNI kSAta to|| biha(ra)NI valI vairAgaNI rAmanI bhArajyA jagatanI mAya to / sa058 / iti aMjaNArAsa saMpUrNa / saMvata 1840 phAlguna mAse vada 11 dine some 'siddhapura'madhye liSataM kaSajeSThamalla samaNopAsakaamIcaMdajIpaThanArthe / kalyANamastu etc. Reference.-For additional Mss. and extracts see Jaina Gurjara Kavio ( Vol. III, Pt. 2, p. IS3I). 10 5 20 anAthisAghusandhi Anathisadhusandhi No. 12 1575. 1891-95. Size.--10d in. by 4t in. Extent.-- 2 folios ; 17 lines to a page ; 64 letters to a line. Description.-- Country paper rough and white; Devanagari chara. cters; small, legible and good hand-writing; borders ruled in four lines and edges in two in black ink : red chalk used; foll. numbered twice as usual, complete ; composed in Samvat 1647 in Kasurapura ; condition very good. Age.-- Not modern. Author.-- Vimalavinaya, a devotee of Nayaranga, pupil of Guna sekhara. Subject.-- Life of Anathi muni in verse in Gujarati, based upon Uttarajjhayana (XX). 30

Page #50
13.1 The Svetambara Narratives S Begins.-- fol. !' DAla sidhaMnI / zrIjinazAsananAyaka niiko| sidivasiri saMdara TIkao // varddhamAna jinavara mana dhyAI / siddha sadhe samarI suSadAI // 1 // vIsamaha uttarAye(dhyaya)na vicAra / nAtha anAtha(thi) taNao adhikAra // sUtra sApa zurumamA jima maNIyaha | tiNa saMbaMdha sayala ra bhaNiyaha // 2 // etc. Ends.-- fol. 20 saMvata solasaI satatAle (1647 ) phAguNa bIja divasa ajUAlA / bhI kasara pura ghara mana mohA / solama saMti jiNesara sohh| zrIjinazAsana mahimAvaMta / zrIjinacaMdrabhIra jayavaMta // 69 // sahayaka bhIguNaseSarasIsa / vAcaka bhInayaraMga jatIsa / tAsa payAsa lahI cita caMgaha / vimalavinaya pamaNai manaraMgai // 70 // bhAgama aratha jugati suvicArI / e saMbaMdha kAo jykaarii| je bhAvaI gAva nara nArI se pAMmai saSa saMpati sArI // 71 // iti zrIanAthIsAdhusaMdhiH saMpUrNaH / zrIrastu etc. Reference.-- For additional Mss. and extracts from one of them sec Jaina Gurjara Kavio (Vol. III, Pt. 1, pp. 783-784). I anAthisAdhusandhi Anathisadhusandhi No. 13 610. 1892-95. Size. - II in. by 4g in. Extent.-- 3 folios; 11 lines to a page; 49 letters to a line. Description.-- Country paper grey and very thin but not brittle ; Devanagari characters with occasional pRSThamAtrAs; quite bold, uniform, legible, big and very good hand-writing ; borders as neatly and carefully ruled in four black lines; all the three foll. slighily damaged owing to their being eaten up by white ants; condition fair ; red ink used to denote numbers for couplets; complete. Age.-- Not modern. 30 Author:-- Not mentioned. According to Jaina Gurjara Kavio (Vol. III, Pt. I, p. 646) he is Punyalabdhi, pupil of Rajahamsa Gani. Subject. -- A story of Anathi muni in 6o stanzas in Gujarati.

Page #51
16 Jaina Literature and Philosophy [13. Begins.-- fol. 1 siddhi sabe na(I) karaI praNAma | ji pAmiDa chaha uttima ThAmi / sAdhu save namUuM kara joDi / bhava maya(ma)vA jiNi bhAjI SoDi / 1 / alIya vayaNa bolAyai je ya | micchA tukkaDa hoijyo te ya / artha dharmagati tattha(sa)vicAra / bhaNatA guNa - atihi rasAla // 2 // etc. Ends.-- fol. 30 romarAya te savi Usasaha / karai pradakSaNa rAjA tisaI / karaha baMdaNa suddha praNAma / taba rAjA pahutau nija ThAmi // 59 // uttara guNe karI saMyutta / guptigupto daMDe virati / paMSInA pari halaya uppaI / mohavirata te vicarA mahI // 60 // iti AjJAnAthIsaMdhi samAptamiti // // zubha vaza // cha // shrii|| Reference.-- For an additional Ms. and see Jaina Gurjara Kavio ( Vol. III, Pt. I, P. 646). 10 anukampAcatuSpadI Anukampacatuspadi 18 (aNukaMpArI copAi) ( Anukampari copai) 611(a).. No. 14 1892-95. Size.- 10 in. by 48 in. Extent.-- 40 folios ; 8 lines to a page ; 28 letters to a line. ___Description.-- Country paper thin, rough and white; Jaina Deva nagari. characters; very big, quite legible, uniform and very good hand-writing; borders of the ist fol. ruled in two lines while those of the rest, in three lines in red ink ; edges of all the foll. ruled in one line in the same ink; the Ist line, dandas, numbers for some of the verses etc. written in red ink; yellow pigment used while making corrections ; foll. numbered in both the margins ; in the left-hand margin the title written as 370*9r; condition very good ; 9 dhalas of anukampa complete ; this Ms. contains an additional work viz. binItaavinItabhAva ; it begins on fol. 40' and ends on fol. 406; it is incomplete. Age.-- Not modern. Author.-- Not mentioned. The author is said to be Bhikhamaji formerly pupil of Raghunatha and subsequently the founder of Terapantha a Jaina sectin V. S. 1817. He died 35 in V.S. 1860. 25 30

Page #52
15.] The Svetambara Narratives Subject.-- A poem in 9 dhalas. It deals with compassion. Begins.-- fol. 1' / 60 // zrIjinAya nama // zrIgurubhyo namaH // / / atha aNa(Nu)kaMpArI copaI liSyate / / pote haNAve nahI / para jIvArA prANa // haNe tiNane bhaloM jAMNe nahI / / e nayakoTa pacaSAMNa // 1 // abhayadAna dayA kahI // zrIjiNAAgama mAMhi // to piNa dudha uThAdhIyoM / jyAMnI nAMsa dharAya // 2 // etc.' Ends.-- fol. 40 cha kAyaro baMche maraNo jIvaNo te to rahasI ho saMsAra majhAra // gyAMna darasaNa cArata tapa bhalA / AdarIyAM ho AdarAyAM co(dho) pAra // bhava // 25 // iti aNukaMpArI DhAlAM // 9 // saMpUrNam // ||shrii|| Reference.- See Jaina Gurjara Kavio ( Vol. III, Pt. 2, p. 1547). 10 15 - anyoktimuktAvalI No. 15 Anyoktimuktavali 1171 1886-92. 20 Size.-91 in. by 41 in. Extent.- 19 folius; 15 lines to a page ; 32 letters to a line. Description -- Country paper somewhat thick, tough and white; Jaina Devanagari . characters; big, quite legible, uniform and beautiful hand-writing ; borders ruled in two pairs of lines in black ink; space between them coloured red; foll. numbered in both the margins ; dandas written in red ink; fol. 1 blank except that only iwo letters Fat written on it; red chalk used ; condition very good ; yellow pig. ment used while making corrections ; composed in Samvat 7736; complete so far as it goes; the entire work is divided 25 1 These are the opening lines of the 6th dhala out of 13 occurring in Situbitasiksa ( Part il) published by Dhansukhdaa Hiralal Aiichalia in v.s. 1987 2 These are the ending lines of the 5th dhala ocourring in tbe abovementioned book. IJ.L.P.]

Page #53
Jaina Literature and Philosophy [15. 5 into eight pariccbedas ; of them the first two are as under :Pariccheda I foll. 10 to 1 II , , 19. Age.- Pretty old. Author.-- Hamsavijaya Gani, grand-pupil of Vijayananda Sari. Subject.-- A collection-necklace of anyoktis looked upon as pearls. Begins.- fol. 10 e60 // aI namaH / zrIzaMkhezvarapArzvanAthAya namaH / ||aiN namaH / sakalabhaTTArakacakrazakabhaTTAraka zrI19zrIvijayANaMdasAraerubhyo namaH / / OM namaH zAsvatAnaMdasiddhisaMtAnadAyine / bhIzaMkhezvarasatapArzvatIrthAdhIzAya tAyine // 1 // yasyottamAMgake sapta / phaNA rejulphaNabhRtaH / mamye kimu saptatavapAdapAnAM navAMkurAH // 2 // jayazriyaM yacchatu pArzvadeva ssadeSa nirmaapitpaadsevH| phaNAmiSAd yena vidIrNavAdi. smayAnayAH sapta dhRtAH svamaulau / / 3 / / etc. -fol. 20 zrImada tapA'gaNanabhoMgaNabhAsanaka bhaasvtprbhaabhrsubhaasurbhvybhaanoH| saMbhyate vijayarAjaguroniyogAn muktAvalI lalitavRttamanozamuktA // 21 // zAstrAMburAzeradhigamya ramya zrImadurorAnananIrajAca / anyoktimuktA janaraMjanAya / muktAvalIyaM kriyate('bhirAmA // 22 // etc. -fol. 2' atha mUladvAravRttAni athAnukramadvArANi / viradhyaMte'tra vAGmaye / anyoktisUktamuktAlI / samu(da)kRtya shrutaaNbugheH||25| devAH pUrvaparicchede 1 / dvidhA paceMdriyAH punaH / sthalAMbusaMbhavAssarve / tiryacazca dvitIyake 2 // 26 // khagAlyaM cAkSatiryacaH / paricchede tRtIyake 3 / tridhA turyaparicchede 4 / jJeyA ca vikleNdriyaaH| 27 // pRthadhIkAyikAH jIvAH / paricchede ca paMcame 5 / jalAniyAyava 6SaSThe paricchedai 6 budhairmatAH // 28 // sabai dhanaspatikAyAH / samAkhyAtAzva saptame 7 /

Page #54
15.1 The Svetambara Narratives aSTame 8 marusthalyuktiH / saMkIrNoktistathA smRtA // 29 // atha pratidvAravRttAni tatrAdimaparicchede / subodhArtha vishesstH| pakSyaMte pratidvArANi / prodyanmodapradAni ca // 30 // sUryasyAnyoktayaH 1 pUrva saamaanyedusddhuktyH| palakSapakSapratipaccaMcacaMdramasa(m)ktayaH 3 / 31 / / dvitIyA dvijarAjoktI 4 / rAkArAdhikaroktayaH 5 / zanairanyokti 6 rAkhyAtA grahAnyokti 7 stataH param // 32 / / IzvarAnyoktaya 8 stadidirAnyoktayaH 9 punH| sAmAnya nIradAnyakti 10 / rakAlajaladoktayaH 11 // 33 // 10 prakAzAMbhodharAnyokti 12 / ragatyukti 13 dhruvoktyH(14)| kalpadrumoktayo 15 jJeyA / pArijAtoktayo 16 'parA // 34 // etc. -fol. 80 nItyA tAvadamI narAdhitapayaH pAMti prajAH putravat tAvanItividaH svakarmaniratAstApahaSINAM tapaH 15 tAvanmitrakalatraputrapitaraH snehe sthitAH satataM yAvat tvaM pratiSatsaraM jaladhara ! kSoNItale varSasi 18 iti pAThAMtaram / -fol. II* iti zrImat tapA0' etc. up to muktAvalyAM as below ____ followed by devAnyoktinirUpakaH prathamaparicchedaH // 1 // Ends.- fol. 19 re pakSinAgatastvaM kuta iha sarasastata kiyad bho vizAlaM / kiM maddhAmno(5)pi bADhaM nahi nahi sumahat pApamAbrUhi mithyA / itthaM ka(ka)podarasthazzayati taTagataM darduro raajhNs| -nIcaH svalpena garbI bhavati hi viSayo nAparo yena dRSTaH / / 5 // 35 tAvad garjati mahakaH / rUpamAzritya nirbhayaH / yAvat karikarAkAraM / kRSNasarpa na pazyati // 6 // iti dardurAnyoktayaH // 12 // iti zrImata'tapAgacchAdhirAja / zrIgautamagaNadharopamaguNasamAja / sakalabhaTTArakasuMdaradArakavaMdArakarAja / paramagurubhaTTAraka19zrIvijayAnaMdasari. 30 ziSyabhujiSyapaM / hasavijayagANasasaJcitAyAmanyoktimuktAvalyAM sthala. carajalacarAnyoktinirUpakaH dvitIyaH paricchedaH // 2 // aiM namaH // ahe nmH|||| zrIgurubhyo namaH // Reference. - For additional Mss. and the date of composition see Jinaratnakosa ( Vol. , p. 12). 20

Page #55
20 Jaina Literature and Philosophy (16. abhayakumArarAsa Abhayakumararasa No. 16 1577 1891-95. Size.-- 104 in. by 4; in. Extent.-- 48 fulios ; 13 lines to a page ; 39 letters to a line. 5 Description.-- Country paper thick, tough and whitish ; Devanagari characters ; bold, legible, uniform, big and fair hand-writing; borders neatly and doubly ruled and edges singly in red ink ; red chalk used at times ; half the portion of the first fol. pasted with a strip of paper thicker than the paper IO used for writing; other foll. similarly pasted though to a smaller extent ; at times corners are so worn out that the required letters are missing ; the body of some of them is also partly dainaged: condition fair; complete ; com. posed in Samvat 1687 in Trambavati ( Cambay ). IS Age.- Samvat 1771. Author.-- Rsabhadasa, son of Sangana. His additional works are as under:(1) MARFAITTIA V. S. ? 1(13) aitarentaar V. S. 1667 ( 2 ) frais THICO'rnah 1(14) 'ar rar' FATA V. S. 1678 20 V. S. 1666 (15) HTA-TIET-Trae V. S. 1678 (3) BrattaiETS V. S.? 1 (16) ALETTATI# V. S. 1685 ( 4 ) JOITTAIJITIA V. S. 1680 (17) Frigio V. S. 1688 c ) ETHIATIA V. S. 1662 (18) DATEITIE V. S. 1666 ( 6 ) UTENTIE V. S. 1683 1 (19) STATTA V. S. ? 25 ( 7 ) EHITTISTIE V. S. 1670 ( 20 ) JUETIH V. S. 1682 (8) HARATATIR V. S. 1678 (21) JANUAGTIH V. S. 1668 (9) TATA FIT V. S.? (10) Callin TA V. S. 1682 |( 22 ) HAITIA V. S. 1668 (11) FITA V. S. 1676 |( 23 ) scafetariTIA V. S. 1682 30 ( 12 ) AraluaTTHT V. S. 1667 (24) Citia ATEITTIAE V. S. 1685 Subject.-- The life-story of Abhayakumara in different metres in Gujarati, in verses numbered in succession. This Abhayakumara is a son of King Srenika. Verses here given are mainly singable...

Page #56
16. J Begins. - fol. 1 zrIgurave namaH Ends.- fol. 48b The Svetambara Narratives Reference. // cUhA // (caMda) kamala caMdana jatI / mahI motI ghRta pIra / vANI yo vAgazvarI / ujjala 'gaMgA 'nIra // 1 // haMsagAminI brahmasutA / brahmavAdinI nAma | brahmANI brahmacAraNI | tripurA karaje kAma // 2 // devakumArI sAradA / vadane pUre vAsa / nI (ni) kAraNa joDasyuM / abhayakumArano rAsa / 3 // etc. 21 rathyo rAsa 'bAgI' mAMhai jihAM bahu jinano vAso jI / dUraga bhalo jinamaMdIra moTAM / sAyaratIrakhaM atrAso jI // 1000 // mu0 // poSadhazAlA svAmIcchala / pUjA mahocchava thAI jI / teI thAnakiM e rAsa racyo meM / sahagurucaraNa pasAI jI // 1001 // mu0|| 'tapa' gachanAyaka zubha zu (su) padAvaka | vijayAnaMda guNadhArI jI / mITho madhurI jehanI vAMNI / jeNeM tAryA naranArI jI // / 1002 // mu0 // bhAvaka tehano samakItadhArI / pUjai jitavarapAI jI / 'prAga' vaMza sAMgaNata sohai / roSabhadAsa guNa gAI jI // 1003 // mu0 // 'tU' sAyara dI rasa dharatI (1687) / kArttika mahIno sAro jo / bahupa (kSa) dIna navami bhalerI / vAra guru cita dhAro jI // 1004 // 0 // abhayakumAra maMtrIsara kero| kIdho rAsa rasAlo jI / Sabha hai raMga je suteM / te suSIA cIra kAlo jI // / 1005 / / mugatipurImAMhiM jhIlesiM // chaH // iti bhI riSabhadAsaviracite abhayakumArarAsa saMpUrNa | lekhakapAThakociraM jIyAt || barahAMnapure // saMvat 1771 varSe / / azvinaSadI 2 bhaume fol. 48b there is only one line as follows : pAMvaDI bhAvikAnI parata chaI sahI 3 For additional Mss. and extracts from one of them see Jaina Gurjara Kavio ( Vol. III, Pt. I, pp. 923-924 ). 10 15 20

Page #57
Jaina Literature and Philosophy [17. amaradattamitrAnandacaritra Amaradatta-Mitranandacaritra [amaradattamitrAnandarAsa] [Amaradatta-Mitranandarasa ] No. 17 1578. 1891-95. Size.- 98 in. by 41 in. s Extent.-- 15-1=14 folios ; 17 lines to a page ; 48 letters to a line. Description.- Country paper not very thin, smooth and white; Devanagari characters with occasional geaTIS; bold, legi. ble and fair hand-writing but closely written; borders ruled in four lines in black ink with the intervening space between the pairs filled up by red colour ; every fol. decorated with a small figure in the centre; yellow pigment used ; foll. numbered as usual; the 12th fol. missing; otherwise the work complete; composed in Samvat 1606 in Unjha ; fol. 155 blank ; condition very good. 15 Age.- Old. Author.- ( Siddhi Suri, pupil of Jayasagara ), pupil of Deva. gupta Suri. He is the author of i) Kuladhvajakumara. rasa ( V. S. 1618 ), (ii) Sivadattarasa and (iii ) Simha sana batrisi ( V. S. 1616). 20 Subject.- Life of Amatadatta and that of Mitrananda extracted , from the biography of Lord Santi, in verse in Gujarati. Begins.- fol. I' zrIgurubhyo namaH sakalaguNanidhi sakalaguNanidhi sakala janarAya / payapaMkaja praNamI karo bhalai bhASi bhArati nabhevIya / sahigurucaraNa sira namI ekAcatti kavirAja sevIya / karmaphalAphala jANavA mitraanNdcritt| bolisa bahu buddhi kro| muNayo sahu ekaciti // 1 // cupai samagasa samarI sAsara satI / amIya samI vANI brstii| payakaja praNamI tasa taNA | bolisa guNa mitrAnaMdana taNA | // 2 // 30 nAma jisu tehabu pariNAma | amaradatta bIju abhirAma // etc. Ends.- fol. 15EUR pAmo sahigumanu upadesa / jANI zAstra taNo lavalesa / amaradattanu racIu rAsa | bhaNatAM guNatAM atiulhAsa / / 18 //

Page #58
18.] The Svetambara Narratives 'be vaMdaNIka'gacchi sahigura(ru)sAra / sakala kalA keru bhaMDAra / zrIdevagupta vaMdUM sUrIsa / kara joDI kahai tehanu sIsa // 19 / / saMghakathanithiu ulaTa ghaNu / raciu rAsa mitrAnaMda teN| kuMtha(thu) jiNe sara taNai pasAya / karI copaI 'ujhA'mAhi // 20 // kuNa saMvacchara kahai mAsi / kariu gasa je kahuM vimmAsa / saMvata sola chahotara (1606) jANi / zAka ca uda bahuttiro (1472) vaSANi // 21 // yadi dhaizASa cauthi tithi sAra / mUla naSetra nirmala ravivAra / teNai dini racIu e rAsa / sAMbhalatAM pahucAi sadhi Asa // 22 // sarva graMthanI saMkhyA muNu / duhA copaI eka ThAM gunno| gAhA vastu tehamAMhiM milI / zataka paMca ekatrIsaha balI // 23 // vastu eka copaI saya cyAri / balI cyAlIsa adhikIya vicAri / prAkRta gAthA jANu paMca / dUhA paMcahuttirinu saMca // 24 // etc. The last verse is as under:-- 'meru' mahIdhara mahIdhara mahI(ya)li sAra / jihAM pratapaha dinakara sNsaari| 15 tihAM e rAsa sadA suSakAra / jayu jaghu zrIsaMgha majhAri // 27 // iti zrIzAMtinAthacaritrAdu(da)tazrIamaradattamitrAnaMdarAsa saMpUrNaH Reference.- For additional Mss. and extracts see Jaina Gurjara Kavio ( Vol. I, pp. 200-201 & Vol. III, Pt. I, pp. 673674). 20 10 amaradattamitrAnandacaritra Amaradatta-Mitranandaca ritra 1579. No. 18 1891-95. Size.- 8 in. by 4 in. Extent, -- 25 folios; 13 lines to a page ; 32 letters to a line 25 Description.- Country paper thin, smooth and greyish; Deva nagari characters with FAITIS; bold, clear, uniform and good hand-writing; borders ruled in three lines in red ink ; strips of paper pasted to fol. 1'; it is decorated with a beautiful figure in red and yellow colours; unnumbered 30 sides marked with a small circular disc in red colour, in the middle, whereas the numbered ones have over and above this two more such discs, one in each margin ; foll. numbered as usual ; fol. 19 wrongly numbered as 18; the 25th fol. has a strip of paper pasted to it at the corner; 35 condition on the whole very fair ; complete.

Page #59
3 10 20 25 24 30 Age.- Pretty old. Begins. fol. 1 e // zrIpArzvanAthAya namaH // Ends.- fol. 25 Jaina Literature and Philosophy amaradvAsaptatikA No. 19 sakalaguNanidhi sakalaguNanidhi sakala jinarAya etc. as in No. 18. pAMmI sahigurunau etc. up to jaya jaya zrIsaMgha majhAri as in No. 18. This is followed by the lines as under : // / 14 ( 514 ) // iti amaradattamitrAnaMdarAsa samAptaH mumukSumuna (khya) zrIkSimAsAgaragaNipaThanArthe || zubhaM bhavatu || laSitaM zrI' sthaMbhatIrthe' || zrIrastu // N. B. For other details see No. 17. Size. 10 in. by 43 in. Extent. 5 folios; 11 lines to a page; 36 letters to a line. 15 Description. Country paper thin, tough and greyish; Jaina Devanagari characters with frequent gears; big, quite legible, uniform and beautiful hand-writing; borders ruled in four lines in black ink: foll. numbered in the righthand margin; fol. 5b blank except that a line is written there as under : Age.- Old. Author. Subject. [ 18. Amaradvasaptatika 613. 1892-95. hastatalapramANaM tu po bhUmi karpaye (v) dvijaH ; there is some blank space kept in the centre of the numbered end the unnumbered sides as well; marginal portions of each and every fol. more or less gone; condition tolerably good; complete. Pasacandra. In the begining we have 8 verses in Prakrit. They are followed by verses in Gujarati. In this metrical composision Nayadhammakala, Jivajivabhigama, Dasa etc. are referred to. At the end there is a puzzle.

Page #60
19.] The Svetambara Narratives Begins.- fol. " puNaMtu te mo amurAiyA surA je ci(vi)tarA joimiyA ya devA bemANIyA kappagayakappatIyA / je saMti sammatavimuddhacittA 1 nAmArihate uSaNArihate dambArihaMte jiNasAsaNaMmi hIlaMti mannaMti na pUNije namaniyA bhAvajiNA vi tehiM 2 etc. -fol. . aMgami evaM paDhamaMmi vuttaM puNo dsaannjjhynne(5)dvmNmi| aMgami cha;mi ya teNa devA namA(mi buddhA / NayabohagANaM socaeseNa jiNA surANaM bujhaMti mujjhati na te sahehiM jeTreNa tamhA gurukAraNeNaM pAlA bhANijjati kahaMtu devA DhAla ima volyau chai udRi aMgi sohama gaNadhari mananA raMmi tetaliputra maMtri boDiyau kanakadhvaja rAjA mohiyau 9 Ends.- fol. 5. iha kAraNa koI je husyai gItAragha(tha) samaragha(tha) jANisparDa se pUchI ANiyai viveka jinamata thaiyai sahuai eka 72 sAdhu zrAvaka sura ika hu~ti zruta dharmi jinapa ema kahaMti caraNadharmi aMtara cahAri jorDa lejyo sUtravicAri 73 jinazAsani niMdA TAlijyo jiNavaraANa parI pAlijyo pAsacaMdra e karaI bInatI saMbhalijyo sahaaha jinamatI 74 ityamaradvAsaptatikA samAptaH // 7 // 5 // 7 // nIra naraNya kavaNa ? / kamaripu kavaNa bhnnijd| kuNa sohA suramajjhi ? suguNa mANAsi syauM kijjA ? / nara bahu pIDai kavaNa ? / nadI sAyara kuNa taarh?| gibhittinI ya satti valiya vali kavaNa vdhaarh?| sapta zroNi biDaM varNanI pahaluuM akSara jehanau / nAma prakaTa huNi harapa dhari kara siraNa huM tehanau / pAla 1 tapa 2 iMdra 3 zAMti 4 tisa 5 nAva 6 dha(tha)ra 7 / / hastalatapramANaM u / yo bhUmi karSayedijaH [I.L.P.]

Page #61
Jaina Literature and Philosophy [20. 10 amarasena-vajrasena Amarasena-VajrasenanRpakathAnaka nrpakathanaka 1351. No. 20 1891-95. Size.- 93 in. by 4 in. Extent.- 6 folios; I4 to 15 lines to a page ; 38 letters to a line. Description.-- Country paper very thin and grey in colour ; Deva nagari characters; bold, legible and sufficiently big handwriting ; borders carelessly ruled in three lines in black ink ; foll. numbered as usual ; complete ; condition very good. Age.-- Samvat 1658. Author:- Not mentioned. Subject.- A story of Amarasena and Vajrasena, the meritorious and virtuous sons of king Surasena, in prose in Sanskrit. It illustrates the fruit of giving donations. Begins.-- fol. !" bhIgaNalA(zAya) namaH / / jAyai supattadANaM bhogANaM kAraNaM sivaphalaM ca / jada dunha bhAUANa suANa nivaseNasUrassa // atraiva bharatakSetre ' usamapuraM' nAma nagaraM tatrAbhayaMkaro nAma vyavahArI mahaddhiko vasati etc. Ends.-- fol 6deg iti amarasenavara (ya)ya(ra)senanRpakathAnakaM saMpUrNaH / saMvat 1658varSe bhASaNamudi 13 da(di)neH sAhAH haraSA la(li)kha (khi)taM gAmAH 'hAlIvAhA'grAme gaNaH buddhakuzalaNThanArtha bhadra Reference - For an additional Ms. see Jinaratnakosa (Vol. 1, p. 14 ). S 20 25 amarasena-vajrasena-rAsa Amaraseny-Vajrasena-rasa (amarasena-cayarasena-rAsa) (Amarasena-Vayarasena-rasa) 614. No. 21 1892-95. Size.-- 104 in. by 4s in. Extent.-- 12 folios; 17 lines to a page; 46 letters to a line. 30

Page #62
The Svetambara Narratives Description.-Country paper thin, greyish and tough; Devanagari characters; bold and clear but not beautiful hand-writing ; borders indifferently ruled in two lines in black ink; red chalk used; greenish pigment used instead of yellow; this Ms. shabby and unpleasant to the eye; complete ; num - bers for verses in continuation up to the end; composed in Samvat 1640 in Anahilapurapattana. 226 J Age.-- Not modern. Author - Kamalaharsa, a Jaina monk. Subject. - Lives of Amarasena and Vayarasena ( Vajrasena) des 19 cribed in Gujarati in verse. The work is divided into four main sections styled as khandas. Begins. fol. 11 zrIgurubhyo namaH // dUhA // amara sakalasaM sevitA / jagajjananI viSyAya | haMsavAhanI zrIzAradA / samaruM huM tujha pAya // 1 // Ends. - fol. 12b // cha // cha // racio rAsa e kIhi varasi / te saMdhyA havai guNayo harasi / iMdu rasa veda biMdu (1640 ) ya / mAgazara tritIyA setu ya / / 392 // guruvAra dvaM racIo olhAsi / vaMchita pUrai zrIsupAsa / , aNahilabADhaDe' pattana mAMhi / karyu kaSita te mana ucchAhi // 393 // cutha SaMDha raciuM ya sucaMga / suNatAM bhaNatAM hue AnaMda / kamalahaba muni kahi UcchAya / zrIguru sarasati lahIya pasAya / 394 // iti zrI amarasenavayara senaprabaMdhe. nisthAnAgamana | akkayAparIkaraNa / bhUpati milaNa | sAdhudarazaNa | jAtIsmaraNa | surAvataraNa 25 nAmmI (mnI) caturthaH SaMDa saMpUrNaH // cha // zubhaM bhavatu // vAcyamAnAzviraM naMdatu ! (Vol. III, Pt. I, p. 748 ). ... 400 Reference. Only this Ms. is mentioned in Jaina Gurjara Kavio 2.7. amarasena - vajra sena -rAsa ( amara sena - vayarasena -rAsa ) No. 22 Size.-- 84 in. by 44 in. Extent. - 14 folios; 17 lines to a page ; 40 to 42 letters to a line 35 Amarasena- Vajrasena -rasa (Amarasena-Vayarasena-rasa) 15 615. 1892-95. 20 30

Page #63
15. Author.-- Jinaharsa, pupil of Santiharsa Gani. to Subject. A story of Amarasena and Vayarasena in Gujarati in different singable metres like dUhA, copAI etc. It illustrates the prowess of worship of the Tirthankara and that of donation. This work is based upon Farsvanathacaritra. Begins. fol. 1 dUhA 20 25 30 Jaina Literature and Philosophy [22. Description.- Country paper thick, tough and somewhat white; Devanagari characters; bold, legible, uniform and beautiful hand-writing; borders ruled in two lines in red ink ; their edges however ruled singly; red chalk used; every fol. slightly damaged, there being two or three small holes ; condition tolerably good; composed in Samvat 1742 in case ' yuga' here means two and not four; complete. Age. - Pretty old. 35 28 zrI arihaMta anaMta guNa doSa aDhAra rahitta kevalajJAna prakAsakara praNatuM bhASa sahita 1 guru garuyA uttama guNe suddha prakAsaka jeha tAraka Atama para bhaNI trikaraNa praNamuM tei 2 etc. Ends.- fol. 14b jinapuSpapUjAthI lahyAM / varasena baMchita ziddha / balI amarasena saSa lahyAM / dAMnathI rAjanI vRddhi / 57 / ma / dAna dIjai mAnasaM / poSIyaha pAtravizeSa / jina bhagati kIja jugatisuM / lahIyaha suSa aseSa / 58 / bha zrI pArzvanAthacaritrathI / deSI kathA suvilAsa / naranArina suNivA bhaNI / kIdhaDa chai e rAsa / 59 / ma / rAsa jhuNijyo raMgasaM / pAMmisau mana ucharaMga | paramAda dUrai pariharI / AMNI bhAva suraMga / 60 / ma yuga veda nisi (za) si (zi) (1742) bacchara / hRdi bIja phAguNa mAsa budhavAra 'pATaNa' nayaramai / eha racyau maha rAsa / 61 / ma / zrI ' parataragaccha pati jayau / jinacaMdrasUrisUrIsa | gaNi zAMtiharSa vAcaka taNau / kahai jinaharaSa esIsa / 62 / ma / pArzvanAtha sAha | e kIyau rAsa jagasa / cyAri saha saThi ehanI / gAthA DhAla chavIsa / 63 / bha iti dAnajinapUjopari amarasenavayarasenarAsaH samAptaH / zrIrastuH // leSaka pAThakasya zubhaM bhavatu

Page #64
23.] The Svetambara Narratives 29 amarasena-vajrasena-rAsa ___Amarasena-Vijrasena-rasa (amarasena-vayarasena-rAsa) (Amarasena- ayarasena-rasa) 1580. No. 23 1891-95. Size.- 101 in. by 4} in. Extent.- 33 folios; In lines to a page; 38 letters to a line. Description.- Country paper thick, tough and grey; Devanagari characters with quarzis ; clear, bold, uniform and big hand-writing; borders doubly ruled in red ink rather carelessly; red chalk used; fol. to decorated with three 10 small circles in red ink, one being in the centre and the other two, in each of the two margins ; foll. numbered as usual ; corners of the first fol. slightly damaged ; foll. 7 to 32 more or less spoiled perhaps due their being exposed to rain; the last fol. has its, nether border pasted to a strip of 15 paper; condition very fair; yellow pigment rarely used; composed in Samvat 1649 in case.udadhi' stands for four and not seven ; complete. Age.- Sainyat 1697. Author.- Saighavijaya, pupil of Gunavijaya, Subject. - A narration of Amarasena and Vayarasena in different metres in Gujarati. This work is styled by the author as kathA, rAsa and AkhyAnaka as well, whereas the scribe designates it as rAsa. Begins.- fol. 1'aI aiM namaH // zrIgurubhyo nmH|| prathama DhAla dUhA / / rAga AsAurI // sakala siddhi mukha saMpadA / lahI buddhi vinaann| paMcaparameSTI praNamIha / hui ghari koDi kalyANa // 1 // zrIAdIzvara zAMti jina / yadupati nema jiNaMda / pAsa vIra prabhu pAe namuM paMca tIratha sukhakaMda // 2 // etc. The 8th couplet is: brahmalatA vAgezvarI / Apo Sacana rasAla / kathA bhaeM vayarasenanI / amarasena bhUpAla // 8 // The 16th stanza is as under :-- prakaraNa puSpamAlA taNI / gAthA bhaNI sujANi / rasIka saMbaMdha zravaNe puNyo / rAsa racuM zubha vANi // 16 // 20

Page #65
30 Jaina Literature and Philosophy 123 Ends.- fol. 329 punarapi cAritra Adarai vizuddha hIra guru hAthi paMca mA(ma)hAvrata uccarai aThAdhIsa RSinai sAthi 62 RSi meghajI udi)dhotAMvajaya nAma anopama dIdha RSi gano tasa guNavijaya dI, nAma paramiddha 63 nAma thApA anukramai kIdhI zrIgururAja pAmyo lAbha purai atighaNo sAryA bahu tasa kAja 64 zrIhIravijayasUrgazvara guNavaMta tasa taNo zIsa giruo gurNAvajayagaNi guruANA baha nija sIsa 65 tasa vinayI va(vi)gatA vibudha saMghavijayo pabhaNaMti sarasa saMbaMdha zrotA muNai pugai baktA mana pAMti 66 samva saMpaja maNatAM avaNi nAsaI tasa ucaTa . bhaNai guNa ima nibhASarayu tasa ghari hui gahagaTTa 17 caMdrakalA udadhi nidhi ( 1649) barasa mRgazira mAsa zudi paMcamI uttarA raki pUraNa racau rAsa 68 etc.. ol. 33deg rAjaRSi doya prAtarnu / AkhyAna tasa amirAma / maNatAM eha guNatAM muNatAM mAvA pAmai anaMtasukha ThAma / atha 752 / iti zrIamarasenava(ya)rasenarAjaRSiAkhyAnaka saMpUrNa / liSitaM saMvata 1697 varSe mArga(ga)zIrSamAse zuklapakSe dasa(za)yAM saraguruvAsare bhI(1) / subhaM bhavatu / / zrIH / kalasa rAga dhanyAsI (zrI) zrIvIrathI anukramaha pATai 'tapagacha zuddha prNpraa| zrIvijayadAna guru hAra 'jesaMgajI vijayatilaka sUrIzvarA / tasa paTodhara udayagiri jima udayo avicala dinakarUM / abhinayo gautama bhavika baMdo zrIvijayANada suuriishvruu| 82 / saMprati vicaraha gugapradhAna guru chatrIsa guNa aMgai dharaha / sAdhupuraMdaramahimAmaMdira amRtavANi mukhi uccrh| zrIhIravijayasUdisevaka guNavijayagaNi munidharU / tasa zIsa saMthuNyA rAjaRSi do sakalasaMghamaMgalakarU / 83 / iti rAsanI cUlikA saMpUrNA kalyANamastu / 1 This moam vijayasanamuri,

Page #66
Ends. 25.1 amarasena- vajrasena -rAsa ( amara sena - vayarasena -rAsa ) No. 24 Size.9 in. by 4 in. Extent.- 22 folios; 13 lines to a page; 40 letters to a line. Description. Country paper grey, tough but not very thick; Devanagari characters; bold, legible, uniform, tolerably big and good hand-writing; borders ruled in three black lines; red chalk and yellow pigment as well used; foll. numbered as usual; complete; condition very good. Age.- Old. Begins. - The Svetambara Narratives Amarasena-Vajrasena-rasa Amarasena-Vayarasena-rasa) fol. 12 paMDita vimalacaMdragaNigurubhyo namaH // sakala siddhi Sa saMpajai / lahIi etc. as in No. 23. fol. 22 N. B. For other details see No. 23. 1581. 1891-95. rAjaRSi etc. up to supaThAMma // 21 // as in No. 23. 31 Ambadakathanaka 1256. 1884-87. Age.- S-aka(?) Samvat 1859. Author.- Pandita Amarasundara. Subject. A narration of Ambada, a recluse in Sanskrit mostly in prose. ambaDakathAnaka No. 25 Size. 9 in. by 41 in. Extent. 36 folios; 12 lines to a page; 32 letters to a line. Description. Country paper thin, smooth and whitish, Devanagari characters; bold, big, uniform, quite legible and 25 elegant hand-writing; the initial line and a part written in red ink; borders as well as edges doubly ruled in red ink; foll. numbered; as usual; fol. 36b blank; the 29th fol. slightly damaged in the body; same is the case with fol. 31; condition on the whole good; complete. IO IS 20 30

Page #67
Jaina Literature and Philosophy Begins.-- fol. !' bhIgautamAya namaH // sakalapaMDima(na)ziromaNipaMDita(a)zrI. 108zrIratnasAgaragaNiparamagurubhyo namaH dharmAta saMpadyate lakSmI( : ) dharmAd rUpamaniMdita dharmAta saubhAgyabhAgyazca dharmAt sarvasamIhitaM 1 atha dharmopari aMbaDAtriyasya saMba(ba)dha kathyate asmin 'bharata bhetre // "zrIvAsa'nagare tatra vikramasiMho rAjA rAjyaM karoti etc. Ends.- fol. 350 sarasavArtikaramyakathAna pravaNahAra nizamya vinodakRta amarasuMdarapaMDitasAdha(dhu)nA ____ sugamagayamayaM jayatAciraM 2 dharmAta saMpadyate bhogA dhamAzva(ca) sukhasaMpadaH dharmAt svoM(5)pagre(ga)ci(zca) dharmAda ruupmn(ni)dii(di)| 3 dharmaciMtAmaNi(:) zreSTho dharmaH kalpa(dru)mo paro dharma kAmadudhAdhenuM dharma saphalapradaM 4 akSaramA padasvarahIna vyaMjanasaMdhividharjitaraphaM sAdhU(dhu)bhireva mama kSatavyaM ko(s) ma(muhyati zAstrasasamudre 5 ajJAtadoSAta mamivibhu(bhra)mAd vA yadarthahInaM likhitaM mayA(s)tra tadarthamAyu pariso(zo)dhanIyaM prAyeNa hA muhyati lekhakAnAM 6 iti zrIaMbaDaparivrAjakakathA gadyabaMdhalirSitA samAtA // // saMvat // 1859nA varSe zAke 25 pravanamAnena / phAlguNa suda 8 dhAramaMgale sakalapaMDItazIromaNipaMDitazrIpaM0 zrIratnasAgarajIgaNI tatzIyapaM0zrIdhanasAgaragaNI tatzrI(zi)papAyarajareNasamAnam / vImalasAgareNa likhitaM aMbaDasya carItraM samAtAH // ___ zlokaH // // shrii|| jaba lage 'meru' thira rahe jayavaMtA zasi bhAMNa ___ tapa lagA ehi ja apU(pu)stikA vAco catura sujANa 1 // zreyostuH / / kalyANamastuH // zrIzAMtinAthaprazA( mA dAt zrI(bhi) yNkrH| Reference.- Published by Hiralal Hamsaraj in A. D. 1910. This work is translated into English by Dr. Krause and publish, ed in " Indischen Novellen ", Leipzig in A. D. 1922, For additional Mss. see Jinaratnakosa (Vol. I, p. 15).

Page #68
26.] The Svetambara Narratives foll. II ambaDakathAnaka Amba dakathanaka 573 No. 26 1884-86. Size.--104 in. by 44 in. Extent.-- 32 folios ; 17 lines to a page ; 40 letters to a line. Description.- Country paper thick, durable and somewhat white in colour : Devanagari characters with occasional qrarats ; bold, good and big hand-writing ; borders unruled; numbers for verses etc. written in red ink; foll. numbered as usual ; fol. 1blank ; - practically from the 19th fol. 10 letters are blotted out and hence illegible, perhaps owing to ink on one fol. being absorbed by and spread out on the other ; condition tolerably good ; complete ; 7 adesas in all ; the entire work is divided into parts known as adesas as under :-- Adesa 1 bago 5b-98 96-12 12-18a (7) 18* (?)-210 216-7 , VII 2-326. Age.- Not modern. Author.-- Muniratna Suri.. Subject. -- A narration of Ksatriya Ambada along with 32 25 Putrikas in verse and prose as well, in Sanskrit. Begins.- fol. roll toll dharmAt saMpadyate lakSmIrdharmAda rUpamaniMditaM / dharmAta saubhAgyadIrghAyudharmAt sarva samIhitaM // 1 // dharmasyopari saMbaMdhaH kSatriyasyAMvaDasya ca / / ETOTTENTE TANaigua ingatan a ll etc. Ends,- fol. 320 yatpuryA mujjayinyA sucaritavijayI vikramAdityarAjA vaibhAto yasya tuSTaH kanakanaramadAd viSTaraM putrikAbhi / 5 [J. L. P.) III IV 20 VI 30

Page #69
5 1o 20 25 34 30 Reference. Published in A. D. 1923 from Ahmedabad. additional Mss. see Jinaratnakosa ( Vol. I, p. 14 ). Jaina Literature and Philosophy asminArUDha evaM nijazirasi dadhau paMcadaMDAtapatraM / cakre vIraH kSititalamanRNAM so(S) sti saMvatsarAMkaH / 37 // itthaM goravayoginIvacanataH siddhaubaDaH kSatriyaH / saptAdezavarAH sukautukamarA sUtA na vA bhAvinaH / dvAtriMzanmitaputrikAdicaritaM yad gadyapadyena tat / cakre zrImuniratnasUrivijayI tad vAcyamAnaM budhaiH // 38 // iti zrImuniratnasUriviracite goraSayoginIdattasaptAdezavara aMbaDakathAnakaM saMpUrNam // ambaDakathAnaka [ ambaDadevAGganAcaritra ] No. 27 Size.-97 in. by 44 in. 15 Extent. - 21 folios ; 17 to 18 lines to a page ; so letters to a line. Description. Country paper very thin, grey and smooth ; Devanagari characters; bold legible, uniform and poor hand - writing; borders ruled in four black lines; foll. numbered as usual ; strips of paper pasted to the first fol. at corners; the 13th fol. and the 19th as well slightly torn in the body; condition tolerably good; complete. N. B.-- [26. Ambadakathanaka [ Ambadadevariganacaritra ] For Age.-- Not modern. Begins. - fol. 14 ma ( u ) rubhyo namaH // dharmAta saMpayate lakSmI ( : ) / dharmA (d) rUpamaniMdisaM / etc. as in 26. Ends. fol. 21 b itthaM gorayoginI 616. 1892-95. (na) te (ta) siddhauMbaDaH / kSi (kSa) triyaH saptAdezavarAH / sakautukamarA / bhUtA na vA sA (mA) vinA / dvAtriMzamitAputrikAdicaritaM / yad ga ( pa ) yena ta cakre zrImuniratnasUrivijayastAvad vAcyamAnaM budhaiH // 95 // iti aMbaDadevAMganAcaritraM / samAptama (mi)ti // For other details see No. 26.

Page #70
28.] The Svetambara Narratives 35 ambaDacatuSpadI Amba dacatuspadi (ambaDacopAi) ( Ambadacopai) No. 28 1172. 1886-92. Size.-- 104 in. by 44 in. Extent. -- 118 folios ; 13 lines to a page ; 30 letters to a line. Description.- Country paper thin, tough and white; Jaina Deva nagari characters with rare pRSThamAtrAs; big, fairly legible, uniform and tolerably fair hand-writing ; borders ruled in two lines in black ink ; red chalk used for marking the 10 numbers for verses etc.; foll. numbered in the righthand margin ; some space kept blank in the centre of the unnumbered and numbered sides as well; yellow pigment used while making corrections ; several foll. more or less worm-eaten ; condition on the whole tolerably good; IS complete ; composed in Samvat 1639 in Ujani ( Ujjen ). Age.- Not modern. Author.- Mangalamanikya, pupil of Bhanubhatta He has com __posed vikramarAja-khApara-cora-rAsa in V. S. 1638. Subject.- A narration of Ambada in Gujarati. It is a translation 20 of Ambada-kathanaka ( No. 26 ) composed by Muni. ratna Suri. Begins.- fol. !* 60 // vastu / sadA saMpada sadA saMpada rUpa jaikAra / parameSTI paMcai sahita / devatriNi sAradAsevita / mahAjJAna AMnadamaya / brhmbiijyogeNdrvNdit|| bhUyaNatraNi guNa(vaNI)maya / vidyA cauda nivAsa / huM praNatuM paramAtamA / saravasiddhisapavAsa / 1 / duhaa|| parama gyo(jyoti parameza je / zrIguru sArada mAya / AdikavIzvara saMta jana nita baMdu tasa pAya // 2 // - fol. 16" iti yo(go)3(ra)SayogAnasaMbaMdhe aMbaDavidyAdharakathAyAM prathamA deza saMpUrNaH /

Page #71
S 10 IS 20 25 30 ! 36 Jaina Literature and Philosophy - fol. 31deg iti zrI aMbaDacaritra goraSayoganI saMbaMdha samAptaM // samAsamadhye dvitIya Adesa saMpUrNAH / - fol. 47deg iti zrIgaurabajoganIdattavara aMbaDa ( ka ) thAna ke tRtIyo Adesa saMpUrNaH / 3 / - fol. 644 iti zrIgauraSayoginIdattasatamAdesa aMbaDa kathAnake caturthAdeza saMpUrNA 4 -- fol. 81deg iti zrIgauraSa yoginIdattasaptAdeze | aMbaDavidyAsiddhakathAyAM paMcamAdesa saMpUrNa // Ends. fol. 117b [28. - fol. 960 iti zrIgoraSayoginIdattasaptadesa aMbaDakathAnake SaSyadesa saMpUrNAH / 6 / capaI // e citrarUpa Aga nadhi huA / hosaha nahI te kIyA jUjUyAM / sIdhAM je je vikaTa upAya / te savi satva taNau mahimAya / 41 / suvihata gaccha 'AgamIyAM' nAma ' vidyAlabI' pATanau ThAMma | 'aNahilapurANa' pAsi / 'gujjara'desa madhyanahaM bAsi / 42 / zrImuniratnasUri gachadhaNI / AnaMdaratnasUri padi guNI / jJAnaratna guru gaNazrRMgAra / udayasAgaravAcaka parivAra / 43 / tAsa paTTi maMgalamANikya / vAcaka vidyArasi cANikya / paMDita AgAle te matimaMda | bhAnubhaTTa guru vidyAvRMda / 44 / racI cupaI tAsa prasAda | aMbaDakathA taNau anuvAda | lADajIya sata dariyA taNau / kIdhara sAMbhalivA Sapa ghaNAu / 45 / ziSya sAdhu vAcivA kAji / bhaNivA sajjana taNI samAji / UmAhu aMgii ati dharI / gurukavi saMtacaraNa aNuMsarI / 46 / baMdha 'cupa' naI baMdhi / kIdhau milI nave saMbadhi | dhuM adhika kahiuM maI jeha / suddha karuM saMtaguru teha / 47 / sAta Adese aMbaDaparva / duhA cupaI vastu sarva thaI / zloka sahita sarvA ki sahI / bAvIsa saddhaM sabati huI / 48 / bisa caurIsI prathama Adesa / bIjai bisaI aThasaTi / asesa bisiAsI bIjai jANi / caigha (tha) i traNisaI chaka varSANi / 49 / aNisaI patrIsa paMcamaha joI chaThThai bisai chAsI hoi / vasaI satAvana sAtamai / caupaI sAta Adese sabai / 50 / saMvata sola uNAlIsa (1639) / kArttika hRdi terasi na (za) sidIsa siddhi yoga nakSatra azvinI aMbaDarAsa caupaI nIpanI / 51 /

Page #72
29. ] The Szetambara Narratives bhaNatAM buddhi sarIiM jA(?lo)ya / buddhithi vaha siddhi savi hoya / siddhi devadharmagurubhakti / gurubhaktithI pAmIi mukti / 52 / navarasamaya aMbaDarAyanI / bhotA vaktA jnpaavnii| vIrakathA mAMdhi je kahiiM / pyAri padAratha sahi jaba lahaI / 53 / nAM rahai aMbara avanI baMda / jAM ravidra tArA giri iNd| sAgara seSa dvIpanau vAsa | tAM lagi raha e kathAprakAza / 54 / 'UjeNAi' rahI caumAsi | kathA racI e zAstra vimAsi / vinoda buddhi vIra rasa vAta / paMDita rasika mAhi vikhyAta / 55 / bhaTISAna nijAmayapasAya / ghidyA bhaNI bhAnubhapAya / mitra lADajI suNivA kAji / vAMcI kathA 'vihAlabIji / 56 / 10 kahai pAcaka maMgalamANikya / aMbaDakathA rasi Adhikya / te gurukRpA taNau Adesa / pUrA sAta hUA Adesa / 57 / / iti zrImuniratnamariviracite / zrIgoraSayoginidattasaptAdesa aMvaDa. kathAnakaM catuSpadikA saMpUrNAH Reference.-- For extracts and a n additional Ms. see Jaina Gurjara 15 ___Kavio ( Vol. I, pp. 248-252). 20 ambaDacaritra Amba dacaritra 3841e). No. 29 1871-72. Size.- 101 in. by 4g in. Extent.- fol. 65* to fol. 87. Description.- Complete so far as it goes. For other particulars see sadayavatsasAvaliGgIkathA No. 384 (a). 1871-72. Author.- Not mentioned. Subject.- A narration of Ambada. Begins.- fol. 65. // zrIpArzvajI(jI)nAya namaH // pAMtu vaH zrImahAvIrasvAmI(mi)no dezanAgira(:) bhanyAnAmatarmalapa(pra)kSAlanajalopamA // 1 // praNamya parayA bhaktA haMsayAMnA sarasvatI tasyA prazAdamAsApakarISyAmi kathAmimAM // 2|| etc.

Page #73
38 Jaina Literature and Philosophy [ 29. Ends.-- fol. 86deg ityAdi bahUbhi sarvajJasvarUpaM kathitaM tavAMbaDena samyach sarvajJadeva jJAtvA stutaH yataH na vaktaM karAlaM na pANe kapAlaM / na kaMThamAlA na hastAkSamAlA gile nAhisaMgo bastyAMgabhogo / ___ jagatsepTaveSTapade vo visiSTa // 1 // evaM nR(na)vanR(na)vaprakAraiH kAvyAnI kRtA stutA pazcAt nATakaM vihitaM evaM dRSTA sarve vIghAgharAzcamatkRtA pazcAt haMzanRpapAzce pRSTa he rAjannAhaM kenArthe atrAnIto(s)smi iti pRSTe hazena gadita zruNuM dharaNeMdracUDAmaNi parvatIyau pUjA jinAnAM namaskAra binA bhojanaM kRtaM tadA nRpazya vidyAbhraSTatvaM jAtaM punaH zarIre kuSTharogo samutpanna tadA rAjJa dharaNedraH smRtaH pratyakSo babhUvaH are mUrkha bhUya kathaM AjJAlopaM kRtaM tenAhaM tava sAMnidhyAM na karomi yataH a(A)jJAbhaMgo nareMdrANAM mahatAM mAnapaMDhanaM marmavAkyaM bilokAnAM asa(za)sravadhamucyate 1 AjJAbhaMgo hi rAjAnAM guruNAM mAnamardanaM pratharAjyAzva nArINAM azatravadhamucyate 2 . arjunamAlAkAracaritra Arjunamalakaracaritra 1476 No. 30 1887-91. Size.- 93 in. by 4g in. 20 Extent.- 4 folios ; 13 lines to a page ; 38 letters to a line. Description.- Country paper thin, tough and greyish; Jaina Deva nagari characters; big, quite legible, uniform and very good hand-writing; borders ruled in four lines in black ink ; space between the pairs coloured red; red chalk used; foll. numbered in the right-hand margin ; unnumbered sides have a small disc in red colour in the centre only whereas the numbered, in each of the two margins, too ; fol. 46 blank; yellow pigment used while making correc tions; edges of each and every fol. more or less gone; 30 condition on the whole tolerably good; complete; 67 verses in all ; composed in Samvat 1621 in Viramapura. Age:- Not modern.

Page #74
3.] The Svetambara Narratives 39 Author. - Nayaranga, pupil of Vacaka Gunasekhara. His additional works are as under: (1) kezI-pradezI-sandhi v.71 v.s.? (2) gautamapRcchA v. 59 V. S. 161(27)3 (3) gautamasvAmIchaMda . 108 v. s.? (4) jinastuti v.? V. S.? (5) sattarabhedI pUjA v.? V. S. 16181 Subject.- A varrative about Arjuna, a gardener in Gujarati. It is based upon Antagadadasa. Begins.- fol. I" e60 // saMdhi DhAla / 10 saMtikaraNa sirisaMti jiNiMda / caraNakamala nami lahi ANaMda / parama lAmanau kAraNa jANI jinavaravANI nija mani ANI / 1 / aSTama aMgi je aMtagaDa nAMmai / jaMbUnai kahyau sohamasAmai / tasa anusAri bhaNisa supavitra / arajunamAlIgAracaritra / 2 / etc. Ends.- fol. 44 solaha sai ekavIsai (1621) varasaI / jeTha sukala dasamI diNi hrsii| vAcakazrIguNaseSarasIsA |nyrNg pabhaNahu / thupau jatIsa / 66 / zrI vIramapuri'maMDana saMti / jahanai nAmi kusala bilasaMti / tasa sAnedhi gAvatAM e munivara / lAbhai sukha ridvi raddhi niraMtara / / 67 // iti zrIarjunamAlAkArasAdhusaMdhi samAptAH // zrIH / / bhI / 20 15 25 avantIsukumAlacatuSpadI Avantisukumalacatuspadi (avantIsukumAlacopAi) ( Avantisukumalacopai ) ____1477. No. 31 1887-91 Size.-93 in. by 4 in. Extent.-- 4 folios ; 16 lines to a page ; 40 letters to a line. Description.- Country paper thin, rough and greyish ; Jaina Devanagari characters ; sufficiently big, quite legible, uniform and vey good hand-writing ; borders ruled in iwo lines and edges in one, in red ink ; dezIs for the DhAla etc. written in red ink ; foll. numbered in the right-hand 1 See Jaina Gurjara Kavio (Vol. III, Pt. I, pp. 698-699 ). 10

Page #75
IO 5 Age. Samvat 1790. Author.-- Santihara Subject.-- A narration pertaining to Avantisukumala. Begins. - fol. 1 50 Is 20 25 40 30 [31. Jaina Literature and Philosophy margin; yellow pigment used while making corrections; edges of each and every fol. more or less gone ; condition on the whole tolerably good; complete; composed in Samvat 1741 in Rajanagara ( Ahmedabad ). Adideva Ade namI | sAdhu taNA guNasAra / kahisyuM nami kamalApatI / mo mani haraSa apAra // 1 // 11 jaMbU' dvIpa majAri e dezI // DhAlA munivara Aryasuhasti / kiNaika avasare / nayara 'ujeNI' samosaryAe / caraNakaraNavratadhAra | guNamaNa Agara / bahu parivAre paricaryA e / / 1 / / vanavADI bizrAma / leI tihAM rahyA / doSa sunI nagara paThAvIyA e / ghAMnikasaMgaNa kAja | munivara maaltaa| bhadrAne ghari AvIyA e // 2 // etc. Ends.- fol. 4deg saMta satare ikatAlIsa (1741) / zukla AsADha kahIsyai jI / 'rAjanagara ' tithi AThami dIvase / kIdhI copI jagI maiM jI // 6 // bhadrA0 // avaMtI sukamAla malhAve / madhura svare guNa gAvaI re / de jinarAja name bahu dAve / zAMtiharaSa sukha pAtrai jI // 7 // bhadrA0 // iti zrIavaMtI sukamAlacopaI saMpUrNa || sakalapaMDita ziromaNipaMDita bhii| zrI lAbhasAgara gaNita ziSyagaNipravI sAgara likhitamidaM // 1 / / saMvat 1790 varSe / zAke 1654 / pravarttamAne / mahAmAMgalyapradamASottama AzvinamAse kRSNapakSe / caturdazItithau / bhaumavAre / tRtIyaprahare || zIghratare // jalAd rakSet tailAd rakSed rakSeccha (thi) labaMdhanAta | parahastagatA rakSedevaM vadati pustikA // 1 // yAdRzaM pustakaM dRSTA / tAdRzaM liSitaM mayA / yadi zuddha zuddhaM vA / mama doSo na dIyate // 2 // jJa (H) pRSTa kaTigrIvA / adhodRSTi... GamukhaM / kaSTena likhitaM zAstraM / yatnena paripAlayee (?) // 3 // .10

Page #76
32.1 azokacandra- rohiNI-2 No. 32 Size. 10 in. by 4 in. Extent. 47 folios; 14 lines to a page; 50 letters to a line. Description. Country paper somewhat thick, tough and white; Jaina Devanagari characters; sufficiently big, quite legible, fairly uniform and very good hand-writing; borders ruled in two lines in black ink; same is the case with edges; red chalk used; foll. numbered in the right-hand margin; fol. 1 blank; so is the fol. 47; the first line and dandas for the verses written in red ink; yellow pigment used while making corrections; complete; composed in Samvat 1772 or 1774 in 'Sendampura (Saiyadpura) near Surat; condition very good. Age. Samvat 1774. Author. The Svetambara Narratives -rAsa Asokacandra-Rohini-rasa (1) praznadvAtriMzikAstotra. (2) zrIpAla caritra ( 3 ) ( 4 ) Nayavimala alias Jnanavimala Suri, pupil of Dhiravimala. This Suri was born in V. S. 1694. His father's name was Vasava and that of his mother Kanakavati. He was named as Nathumala. He took diksa in V. S. 1702 and was named as Nayavimaia. His vidyagurus were Amrtavimala Gani and Meruvimala Gani. He was given the title of "pandita' in V. S. 1727 and was made "Suri " in V. S. 1748 (? 1749 ). He was then named as Jnanavimala Suri. He died in Cambay at the age of 88 in f V. S. 1782.2 He has composed works in Sanskrit as well as in Gujarati. His Sanskrit works are as under: 27. 1877-78. 41 V. S. 1745. A commentary on paNhAbAgaraNa. A commentary on saMsAradAvAnala stuti. TO 20 1 At present this locality forms a part of Surat. For details see my article " saiyadapurAnuM svataMtra astitva " published in the deily named as " gujarAtamitra tathA gujarAtadarpaNa " on 28-61-62. 35 2 See Jaina Gurjara Kavio (Vol. II, p 308), 6 | J. L. P.I 30

Page #77
10 15 20 25 30 35 42 Jaina Literature and Philosophy [32. The following are his additional works. They are in Gujarati-- ( 1 ) (2) ( 3 ) (4) (5) jambUrAsa ( 6 ) (7) ( 8 ) kalpavyAkhyAna ( bhAsa ). kalyANamandira stotragIta. gaNadhara stava rUpa devavandana. rareft. (13) ( 14 ) tIrthamAlA dazavidhayatidharmabRhatasvAdhyAya. ' dIpAvalIdevavandana. narabhavadazahaSTAntasvAdhyAya bAravratagrahaNadIpa (rAsa) ( 9 ) (10) ( 11 ) maunekAdazIdevacandana. ( 12 ) raNasiMharAjarSirAsa zAntijinastavana zrIcanda kebalIrAsa [ AnandamandirarAsa ] (15) sAdhuvandanA ( 16 ) stavantsaGgraha * c. V. S. 1730. V. S. 1750. (1) adhyAtmakalpadruma (2) AnandaghanacovIsI (3) dIpAvalIkappa ( 4 ) navatatta (5) pAkakhayamutta ( 6 ) praznadvAtriMzikAstotra. (7) 2 bhAsattaya. ( 8 ) yogadRSTisvAdhyAya. (9) samaNamutta (10) sADI traNa so gAthAnuM stavana. 3 V. S. 1738. V. S. 1755. This Jnanavimala Suri has composed one balavabcdha on each of the following works: 2 See Vol. XVII, pt. 4, Nos. 1230, 1314 and 1268. 3 See Jaina Gurjara Kavio ( Vol. II, p 309 ). V. S. 1736. V. S. 1770. V. S. 1728. 1 Some of his other svadhyayas, stavanas, stutis and pados are published in prAcIna stavana ratna saMgraha ( pt. I ). V. S. 1770. V. S. 1769. V. S. 1763. V. S. 1739. V. S. 1773. V. S. 1743.

Page #78
32. The Svetambaru Narratives 43 Subject. - A narrative pertaining to Asokacandra and Rohini in Gujarati in verse. Begins.- fol. 10 || 60 // sakalabhaTTArakaprabhupuraMdarabha / zrIzrI 105 zrIjJAnavimala sUrIzvaracaraNakamalebhyo namaH // 15 sukhakara zrIsaMSesarU // pAsa jiNaMda dayAla / praNamI padayuga tehanA / manavaMchita surasAla // 1 // paratA pUraNa paragaDo mahimA mahimanivAsa / / dharaNarAya padamAvatI / / pUre vaMcchita Asa // 2 // etc. Ends.- fol. 46 DhAla 31 mI / sAMbhaliyA guNa gAyA mujha mani hIranari e dezI // dhana dhana suvihita 'tapaMgacchasAdhuparaMparA re ANaMdavimala sUrirAya kriyAuddhAra karI yu zAsana UjalaM re nirabhohI niramAya 1 dhana zrIvijayadAnabhUrIsa tasa pATiM thayAjI te paNi tasa pratirUpa zrIhIravijayasari tasa pa(pA)TiM sohIijI pratibodhyo akabara sUpa 20 thoke thoke lokA tasa guNa gAvatAM re Aja lageM viSyAta / zrIvijayasenarU(sU)pI(rI)sara suraguru sAriSA re buddhi sarasatI sAkhyAta 3 zrIvijayadevasUrIsara tasa paTTadhAraku re AcArija vijayasiMha abhinava jANe surapati suragurune jisyA re suvihita (munimana ) mAhe loha 4 dhana tasa paTiM udayAcala udadayaprabhA jisyA re zrIvijayapramari / saMprati samaye jotA tehanA guNa ghaNAjI kahatAM vAdhaI nUra 5 dhana0 havai zrIANaMdavimalasUri taNA vaDasIsa je re dharmasIha aNagAra vayarAgI gItAratha guru guNarAjIyA re saMvegIsiNagAra 6 dhana . tAsa ziSya gaNi zrIjayavimala nAmeM bhalAjI kIrtivimala kavisIsa zrIvinayavimala kavi tehanA sIsa sobhAgIyA re zrIdhIravimala kavi tasa sAsa gorI jAsa jagIsa 7 dhana sIsa tehano nayavimala nAmeM kavijI vinayI vahe guruANa upasaMpadathI tiNe 'AcArija' pada ladhu re lahI zrIvijayaprabhasUrimANa . . 8dhana. 20 28 30

Page #79
Jaina Literature and Philosophy [32. nAma laghu tiNeM jJAnavimalasari isyuM re tiNi racIo rAsa DhAlabaMdhAe bhavi janane bhaNavA bhaNI re jehathI hoiM buddhiprakAza 9 dhana saMvata yuga muni muni vidhu (1772) vaSa(pa)nA mAnathI re 'sUrati' baMdira pAsa seMdaMpura cha baMdiratilakane sAriSu re tihAM rahI comAsi 10 dhadeg vimala zAMti jinacaraNasevA supasAyI re saMpUraNa e kIdha mAgazira zudi jJAnapaMcami divasa sohAmaNo re manaha manoratha sIddha 11 dhana(0) e saMtoSI saha saMgha taNAM mana rIjhIyAM re sAMta(bha)lo e saMbaMdha ima jANIne tapa tapayoM anidAnathI re upazamano anubaMdha 12 dhana DhAla ekatrIsa emarnu ekatrIsa mu(Na) siddhanA re ekathI adhikA ya suNatAM bhraNatAM pAtikaDA sarva nulAie re maMgalamAlA ghA(?thA)vya (ya) 13 dhana zrIsukhasAgara uvajjhAyai e lipio harSathI re prathamAdarzai e rAsa sobanaphUle vadhAbo bhAveM bhavi janA re jima pohacai mani Asa 14 dhana re dhana dhana suvihitasAdhuparaMparA re // iti zrItapoviSaye zrIazokacaMdranRpatirohiNIrANIcaritra. rAsakaH saMpUrNo likhitH| davevalabhyenasutaparamAnaMdalIkhItaM / / shrii| zaMvada 1774nA varaSe pozamAze zuklapakSe tIthI 5 paMcamI guruvArasya graMtha zubhaM bhUyA lekhakapAThakA bhavau zrIsarasvatI namaH || zrImaMgala jayatu / / kalyANamastu // 6 // zrIgaNezAya namaH / zrIbhagavaMtajI satya cche Reference.-Published in Ananda kavya mahodadhi (Vol. I, pp. 179-318) in A. D. 1913. For an extract and an additional Ms. see Jaina Gurjara Kavio ( Vol. II, pp. 325-328 ). aSTa prakAripUjAkathAnaka Astaprakaripajakathanaka (appayAripUyAkahANaya) (Atthappayaripuyakahanaya ) 351. No. 33 1871-72. Size.- 10% in. by 48 in. Extent.- 15 folios ; 18 lines to a page ; co letters to a line. Description.- Country paper thin, tough and white; Jaina Deva nagari characters; smail, perfectly legible, uniform and beautiful hand-writing ; borders ruled in three lines in red ink ; foll. numbered in both the margins ; red chalk used; 30

Page #80
33.] The Svetambara Narratives 45 there is some blank space kept in the centre of the numbered and unnumbered sides as well; yellow pigment used while making corrections; small bits of paper pasted to some of the foll. ; condition on the whole good ; complete; the entire work is divided into 8 Kathanakas as under:-- 5 Kathanaka I II III IV V " 13 "} " 12 "" " Age. - Samvat 1475. Author. - Not mentioned. Subject. VI VII VIII foll. Ends. fol. 1st " 21 39 "" "" "" "" za " 6a (?), w 10b 124 b to " "" " 3a sb (?) varagaMdhadhUaccukkhakkhaehiM kusumahiM paradIvehiM | nevajjaphalajalehiya / jiNapUyA aTTahA hoi // 1 agaM gaMdhasugaMdha vanaM rUpaM (vaM) suhaM ca sohaggaM // pAva paramapavihu puriso jiNagaMdhapUyAe || 2 etc. 96 Prakrit stories pertaining to the eight sorts of worship of the Tirthankara - the 8 sorts being as under : gandha, dhUpa, akSata, puSpa, dIpa, naivedya, phala & jala. Tob " ,, 15a Isb. 12a 13b These respectively mean: scent, incense, rice, flowers, 20 waving of a light, an offering of eatables, fruits and water. Begins. - fol. 14 // OM // kuMbhasirI vaya AuM / paripAleUNa suddhapariNAmA / mariUNa samupapannA | 'IsANe' suravimANaMmi // 62 bhuNa tattha sukkhaM suranarasukkhaM ca aNuhaveUNaM / jiNavarajalapUyAe / sijjhissai paMcame jaMme // 63 jalapUjAkathAnakaM saMmattaM / samAptaM || 6 || saMvata 1475 varSe mAdrayadi 99 gurudine liSitaM || 6 || zubhaM bhavatu / 6 / cha 10 IS 25 30

Page #81
96 Jaina Literature and Philosophy [ 34. aSTaprakAripUjAkathAnaka Astaprakaripaja kathanaka No. 34 1250. 1886-92. Size.-- 10g in. by 4} in. Extent.-- 17 folios; 19 lines to a page ; 48 letters to a line. 5 Description. Country paper thin, rough and white; Jaina Deva nagari characters; small, fairly legible, uniform and tolerably good hand-writing ; borders ruled in two lines in black ink ; red chalk used; foll, numbered in the righthand margin; there is some space kept blank in the centre of the numbered and the unnumbered sides as well ; yellow pigment used while making corrections; some of the foll. slightly worm-eaten ; condition on the whole good; complete; this consists of 8 Kathanakas as under:Kathanaka I foll. ja to za 39 III IV 1 961 116 126 AN 142 VI VII VIII Age.- Samvat 1495. Begins. -- fol. zdycoll asia etc. as in No. 33. 25 Ends.- fol. 170 kuMbhasirI vi u etc. up to paMcame jamme // 64 etc as in No.33. This is followed by the line as under :-- iti zrIjinapUjASTaka jalakuMbhapUjodyame viprasutAzra(?)somazrIkathA 30 iti pUjASTakaM saMpUrNa // saMvat 1495 varSe kA zu. ravau likhitaM FaqTiQECO II y II Then in a different hand we have: paM zubhazekharagaNiziSyeNa pramodarAjagaNinA pUjATakakathApratifatagaturforatrati afegar.... ll 3 35 1 Letters are blotted out,

Page #82
35.J aSTaprakAripUjAprakaraNa ( aTTappayAripUyApagaraNa ) Ends.-fol. 34 The Svetambara Narratives Astaprakaripujaprakarana (Atthappayaripuyapagarana ) No. 35 Extent. fol. 3b to fol. 34. Description.- Complete. For other details see No. Age - Samvat' 1618. Author. - Not mentioned. Subject. Eight types of worship of the Tirthankara illustrated by means of 8 narratives, one for each. Begins.- fol. 36 paNamahaM nAbhimayaM surabaDasaMkaMtaloyaNasahassaM / kamalasaraM ca virAiya taha nivahaM jassa payajuyale // 1 // etc. niu suNo taha dujjaNo ya / guNadosagahaNakayacitto // siri' vijayacaMdacariyaM parituddhinibaMdhaNaM bhaNimo // 6 // varagaMdha cokkhaehiM kusumehiM pavaradIvehiM / nevajjaphalajalehi ya jiNavUyA aTTahA bhaNiyA // 72 // etc. 579 (b). 1884-86. 47 579 ( a ). 1884-86. avipUyaM bhavvA kAu (U) Na vIrAgANaM / pAviti vigha (gha) rahiyA nitrvasahaM sAsayaM ThANaM // 63 // aSTapagArIpUyApagaraNaM sammatta || || aSTaprakArakathAdRSTAMtaM // cha etc. saMvat 1618 phAlgunamAse zuklapakSe dvAdazyAMyAM punyatithau vArabudhe likhityA etc. paThanAthai sAhabhojarAnI prati // Then in a different hand we have :-- saMvat 1670 dvitIyajyeSTha zudi 1 khau paMDitapravarapaMDita zrI zrIjJAnasAgaragaNicaraNAraviMdacaMcarIkeNa gaNiharSasAgareNA 'kambarapurIya' ci koze svayortha muktA ciraM naMdatAdA caMdrArka | 1 Vijayacandacariya composed by Candraprabha Mahattara in V. S. 1127 is available in two recensions. The longer one is published by Jaina dharma prasaraka Sabha in A. D. 1905 and its Gujarati translation by the same Sabha in V. S. 1962. 2 Cf. v. 8 of No. 33, 5 10 15 20 25 30

Page #83
Jaina Literature and Philosophy [36. aSTaprakArIpUjArAsa Asta prakaripajarasa 1582. No. 36 1891-95. Size. - 10 in. by 4: in. Extent.- 64 folios ; 17 lines to a page ; 35 letters to a line. s Description.- Country paper somewhat thick, tough and white ; Jaina Devanagari characters; sufficiently big, quite legible, uniform and good hand-writing ; borders ruled in two lines and edges in one, in red ink ; red chalk used ; almost the first line completely written in red ink ; foll. numbered in the right-hand margin; of them foll. 3, 4 and 31 in both the margins; fol. 646 blank; at times the title is written in the left-hand margin as aSTaprakArIrAsa; conmplete ; composed in Samvat 1755 in Anahilapur Patan; condition very good. 15 Age.- Samvat 1846. Author.- Udayaratna, pupil of Sivaratna of the 'Tapa' gaccha. This Udayaratna is the author of the following additional rasas. (1) jaMbUskamIrAsa V. S. 1749. (2) dAmanakarAsa V. S. 1782. (3) dharmabuddhimaMtri-pApabuddhinRpa-rAsa V. S. 1768. (4) bAravratarAsa V. S. 1765. (5) bhAvaratnamaripramukha pAMca pATavarNanagacchaparaMparA V. S. 1770. (6) bhuvanamAnukeSalIrAsa =rasalaharIrAsa V. S. 1769. (7) malayamundari-mahAbalarAsa= vinodavilAsarAsa V. S. 1766. (8) mahipatinRpa-matisAgarapradhAnarAsa V. S.? (9) muNi(ni)patirAsa V. S. 1761. (10) yazodhararAsa V. S. 1767. (11) rAjasiMharAsa= navakArarAsa V. S. 1762. (12) lIlAvatI-mumativilAsarAsa .S. 1767.

Page #84
49 v.S. 1770. 36.] The Svetambaru Narra:ives (13) varadatta-guNamaJjarI-rAsa V. S. 1782. (14) zatruJjayatIrthamAloddhArarAsa V. S. 1769. (15) mudarzanaSThirAsa V. S. 1785. (16) sUryayazArAsa V.S.? (17) sthUlibhadrarAsa (navaraso) V. S. 1759. (18) harivaMzarAsarasaratnAkararAsa V. S. 1799. He has composed salokas as under :-- (1) neminAthano zaloko V.S.? (2) bharata-bAhubalino , V.S.? (3) vimala metAno , V. S. 1795. (4) 'zaMkhezvara' pArzvanAthano, V. S. 1759. (5) zAlibhadrano , Some of his stavanas are:-- (1) covIsI V.S. 1772. (2) pArzva-stavana V.S.? (3) 'bhAbhA pArzvanAtha-stavana V. S. 1779. (4) zatrukSaya-stavana V.S.? (5) siddhAvala-stavana V. S. 1789 (1) He has composed a number of sajjbayas some of them being brahmacarya-navavADa-sajjhAya dated V. S. 1763 and DhaMDha muninI 20 sajjhAya dated v. S. 1772. For the rest the reader may refer to Jaina Gurjara Kavio (Vol. II, pp. 413-414). ___He is the author of mahAvIragIta, neminAtha-rAjimatI-bAra(tera)mAsa dated V. S. 1795 etc. and that of the following works known as 'chanda' :-- (1) gautamasvAmIno chaMda. (2) 'zalezvara' pArzvanAtha jinachaMda (3) soLa satIno chaMda' He was born in Kheda. He is said to be a juggler and to have died in Miyagam. He was a teacher of Ratna, a 30 poet, Bhavasara- by caste. Subject. - A narrative pertaining to eight kinds of worship of the Tirthankara in Gujarati in verse. 1 For details see my article "soLa satIno chaMda" published in Atmananda Prakass ( Vol. 51, Nos. 8-10). 2 See Jaina Gurjara Kavio (Vol. II, p. 414). 7 [J. L. F.] 35

Page #85
50 Jaina Literature and Philosophy [36. Begins.-- fol. 1 // 55 // zrIsaMkhesarAya nama // sakalapaMDittottamapaMDitazrI5 zrIgajavijayagaNIgurubhyo nama // ___10 ajara amara avinAsa je agamyaM rupa anaMta / alaSa agocara nIta namuMje parama prabhutAvaMta 1 saSa saMpatI AvI male jaga mAMhi jahane nAma praNamU te prabhu pAsane kara joDI subha kAma 2 etc.. Ends.-f.1. 630 aSTaprakArI carItramA nIramala vijayacaMdra mUnIrAyA harIcaMda nRpane hetane kAji e saMbaMdha ba(ba)tAyo re 2 I0 gAMthAcaMdha carItradhI joi bheda save dIla lAyA jInapUjAphala dRDhavA heti drISTAMta eha deSAyA re 3 iM0 mUla carItranI racanA nIraSI vidhavidha bhASa melAyA premeM jIna pUjAguNa gAMtAM dakrata dUre gamAyA re 4 iM0 sakala manoratha saphalyA aba pUMnyabhaMDAra (bha)rAyA kusalalatA satayASA pasarI maMgala koDi upAyA re 5 iM0 AdicarItrathI nyUna adhIka je saMbaMdha eha racAyA mIchAma dUkaDa hojyo mUjhane saMghanI sA saMNAyA re 6 I. jInaguNa gAvAne budhI jAgI tINa meM mana doDAyA maMdamata hUM koI na jANU sAMdhI lejyo kavIrAyA re 7 iM. saMvata satara paMcAvanA (1755) vara posa mAsa mana bhAyA ravIvAsara vadi dasamI dIvameM puraNa kalasa caDhAyA re 860 zrI tapagacchagayaMgaNabhuSaNa dina dina teja savAra / sakalasarIjanagrahagaNadinakara zrIrAjavijayasurIgayA re 960 tasa pArTa zrIratnavijayasurI narapatI jINe namAyA re zrIhIrarattasarI tasa pATeM manacchIta suSadAyA re 10 I0 zrIjaya jasarI tasa pArTa 'tapa' gaccha jINe dIpAyA saMprati bhAvaratnasurI vaMdo mavi jana bhAve sabAyA re 11 iM0 zrIhIraratnasurIsyarA kerA sISya prathama sohAyA paMDIta labdhIratna mahAmUnIvara sudhAsaratAja kahAyA re 12 I0 tasa anvaya avataMsa anopama zrIsIddharatna uvajhAyA tasa sISya meMgharatnagaNI gIruyA jItI jINeM kAyA re 13 iM0 tAsa vinayaguNAkarama(gaH)NIvara amararatna abhIdhAyA gaNI sIvaratna susISya prasIddhA paMDIta jINe harAyA re 14 I0

Page #86
37.] The Svetambara Narratives pUraNa rAsa caDhato paramANe te mUjha gurusapasAyA bodhabIja meM nirmala kIdhuM jItanIsAMNa jagAyA re 15 iM0 'aNahalapUra pATaNa'mAM e maiM sarasa saMbaMdha vaNAyA[:] paMcAsaraprabhu pAsasAMnIdhI agaNIta supa dhara AyA re 16 60 udayaratana kaheM aTrotaramI DhAla dhanyAsI gavAyA saMgha caturvidha car3hata dIvAjA muSa saMpatI bahu pAyA re 17 iM. iti zrIaSTaprakArIpUjArAsa saMpUrNaH sarva gAthA 29(1)94 sarva DhAla 78, sakalabhaTTArakaraMdarabhaTTArakazrIzrIzrIzrIvijayaprabhasarIsvara tasa caraNAMbuja paMzrIzrIzrI119 hemavijayagaNI tasa caraNAMjhaMga paMzrIzrI108gaMgavijayaga / tatsIsa paMzrIzrIgajavijayagaNI tattISya paM0zrIhaMsavijaya: 10 gaNI tatsISya paM / muktivijayagaNI lapItaM AtmArthe saMvat 1846nA varSe mAsottamamAse zrAvaNasudi 1 guruvAsare prathamaprahare gAMma 'magaravADA' madhye zrIkuMtha(thu)nAthajIprazAdAt zrImAMNabhadrIprasAdAt / / yAdrIsaM pUstakaM dRSTvA tAdrIsaM lakhitaM mayA muddha vA'muddhA vA mama doSo na dIyate // 15 mubhaM bhavatuM kalyANamastuM gAMma 'magaravADe' comAmu karIne laSyaM che te shii| karI jAMNajo Reference.-- For extracts and additional Mss. see Jaina Gurjara Kavio (Vol. II, pp. 389-391 and Vol. III, Pt. 2, pp. 349350 ). Sone of his stavanas ( entire or partial ), 5 sajjhayas 20 and 3 chandas are published in "zrIjaina gUrjara sAhityaratno ( pt. I, pp. 272-286 ). aSTamadanivAraNasvAdhyAya Asta madanivaranasvadhaya (AThamadanivAraNa sajjhAya) (Athamadanivarana sajjhaya) No. 37 790 (d). 1892-95. Extent.- fol. 7deg to fol. 84. Description.- Complete ; II verses in all. For other details 25 see No. 790 ( a ). 30 No. 1892-95. Author.- Saha Laddho (?). Is he same as Ladha Saha, pupil of Thobhana of 'Kadava' gaccha? If so, his additional works are as under :--

Page #87
137. Jaina Literature and Philosophy (1) covIsI v. S. 1760. (2) jaMbUkumArarAsa V. S. I764. (3) zivacaMdajIno rAsa. V. S. 1795. Subject.- A Gujarati poem pointing out desirability of refraining ___ from eight kinds of pride. Begins.- fol. 70 DhAla jo jokavarmavIraM camaNApade mada AvamhAmu nIvArIye je dUra gatinA dAtAro re 10 bhIvIra jiNesara upadise bhASe sohama gaNadhAro re 1 ma. etc. Ends.- fol. 8a mada ATha nivAra kata gharI re pAlI saMjma muSakArI re kahe sAha lAddhote pAmIyA'vicala padavI naranArI re 11 madeg itI zrIAThamanivAra sijAya saMpUrNa / 15 aSTavidhapUjAkathAnaka Astavidhapujakathanaka (aTThavihapUyAkahANaya), ( Attharihapuyakahanaya) [anantanAthacaritragata [ Anantanathacaritragata pUjASTakakathAnaka ] pujastakakathanaka ] 238 No.38 1873-74. 20 Size.- Ion in. by 4g in. Extent.- 32 folios ; 17 lines to a page ; 56 letters to a line. Description.- Country paper thin and grey ; Devanagari characters with pRSTamAtrAs; clear, bold, uniform and good hand-writing ; borders ruled in three lines in red ink ; foll. pumbered as usual ; most of the foll, have their edges more or less worn out; condition very fair ; red chalk used many times ; yellow pigment very rarely ; complete. Age.-Old. 30 Author.- Nemicandra Suri, pupil of Amradeva and the author of ___Sukhabodha ( Vol. XVII, pt. 3, No. 653 ). Subject - This work is entirely in Prakrit verses, their number being 1536. It illustrates the eight kinds of worship.

Page #88
39. The Svetambara Narratives 53 10 They are as under : ( 1 ) kusuma, ( 2 ) akSata, (3) phala, (4) jala, (5) dhUpa, (6) dIpa, (7) naivedya and (8) vAsa. These are mentioned in this work in the following 8th verse : "kusmkvyphljldhRvdiivnvjjvaasnimbhaayaa| prayA jiNesarANaM sA aTTavihA viNividA // 8 // " The eight stories form a part and parcel of Ananta nathacaritra. Begins.- fol. 10 OM namaH sarvajJAya // jayai ja(ju)gAijiNido parivilasirasamasa(ra)NacaurUtro / vAgariuM piva sahadANazI(sI)latavabhAvaNAdhamme || 1 etc. Ends.-- fol. 329 eyassa ghAsapUyA jaha jAyA siddhisokkha saMjaNaNI / taha annassa vi jAyai jaiyatvaM tA sayA tIe // 3 // (1535) vAsapujA // iya tihuyaNasAmiaNattanAhakahiyammi aTrapUyaphale / bahumANapasae kalio kaya(ya)va(ba parimalamahInAho // 36 (1536) / cha / zubhaM bhavatu / / cha // shriiH| zrIanaMtanAthacaritragatapUjASTaka kathAnakAni / / zubhaM bhavatu zrIsaMghAya / / Reference.-- Published by Rayachand Gulabchand in A. D. 1940, the title being " zrIanantanAthacaritrAdurdhataM pUjASTakam" IS 20 aSTAhikAvicAra Astahikavicara ( aTTAhiAviAra) ( Atthahiaviara ) No. 39 1258. 1884-87. Size.-- 104 in, by 41 in. Extent.-- 23 folios ; 13 lines to a page ; 44 letters to a line. Description.- Country paper thin, tough and white; Jaina Deva nagari characters with pRSThamAtrAs; big, quite legible, uniform 30 and beautiful hand-writing; borders ruled in two pairs of two lines in black ink ; space between the pairs coloured red; numbers for the verses, their dandas, a part of the initial line and some line or so in the body of the work

Page #89
54 Jaina Literature and Philosophy [39. written in red ink; yellow pigment used while making corrections ; foll. numbered in the right-hand margin; unnumbered sides have a small disc in red colour in the centre; the numbered, in each of the two margins ; condition on the whole very good ; complete ; composed in Stambhatirtha; the entire work is divided into 5 adhikaras; the extent of each of them is as under. Adhikara I foll. ja to 4 . 3 II " III " 76 , 146 IV - 146 ,, 200 20 , 23. Age.-- Samvat 1548. Author.- Mahopadhaya Anantahamsa Gani, pupil of Jinamanikya 15. Gani. He is the author of ilAprAkAracatyaparipATI (c. V. S. 1570) and dajJadRSTAntacaritra. Subject.- Prowess of an eight-day festival celebrated at Nandisvara dvipa by celestial beings. __Begins.- fol. 1 e605 // vItarAgAya namaH // namiUNa namira suravaravayaMsaruiraM jiakSama vIraM / adAhiAviAraM / suANu sAraM bhaNissAmi // 1 // jaha 'naMdIsara'dIve / viraijjai devadANavidehi / aTTAhiyANa mahimA samAsau taha nisAmeha // 2 // etc. -fol. 4" iti (zrIaSTAhikAcarite SaTpaMcAzadig(ka)kumArikAsamAgama__25 nAdivicArasAraH (prthmo')dhikaarH|| -fol. 7' iti zrIaSTAhikAcaritre catuHSaSTiharikRtazrIjinajanmAbhiSeka varNanamayo (dvitIyo(5)dhikAra // cha / -fol. 14deg iti zrIaSTAhikAcaritre 'jaMbU'dvIpamadhyastha meru'zilAvarNana prasagAMgatacaturvaMzatijinapaMcakalyANakavarNanavicArasArastRtIyo(s)dhikAraH // -fol. 20 iti zrIaSTAhikAcaritraM vijayadevavaktavyatAsahita jaMbU' dvIpavarNanasphArazcaturthoM (5)dhikAra / Ends. - fol. 234 jaM kiMci / hINamahiaM maMdamaitteNa iha mae kahiaM taM ubayAraparehi / soheara suaharehiM // 72 // 30

Page #90
55 40.] The Svetambara Narratives jAba ya diNida(caMdA jAva ya uahI mahIdharo 'meru' / buhajaNavAijuta tAva caritraM jayau loe // 73 // iti zrIaSTAhikAcaritre zrI naMdIzvara'dvIpavarNanavicAraH paMcamo(s)dhikAraH // cha | tatsamAptau ca samAptaM zrIaSTAhikAcaritra 'tapAgacchanAyakaparamaguruzrIzrIzrIsumatisAdhu // sUrimahopAdhyAyazrIjinamANikya- 5 gANaziSyamahopAdhyA(ya)zrIanaMtahasagaNikRte 'staMbhatIrthe / cha / zrIH ||chH|| cha // shrii|| cha / saMvat 1548 varSe mAgha zudi 7 zukre zrI staMbhatIrthe / josI popA lakSataM ! // // chaH // chH|| Reference.-- Only this Ms. and the next one are mentioned in Jinaratnakosa ( Vol. I, p. 19 ). ____10 aSTAhikAvicAra Astahikavicara 1257. No. 40 1884-87. Size.- Iog in. by 4% in. Extent.--- 19 folios ; 15 lines to a page; 44 letters to a line. 15 Description.- Country paper thin, tough and white; Jaina Deva nagari characters with frequent pRSThamAtrAs; sufficiently big, quite legible, uniform and beautiful hand-writing ; borders ruled in two pairs of lines in black ink ; space between the pairs coloured red ; numbers for the verses, their dandas, 20 and some lines or so etc., in the body of the work written in red ink; foll. numbered in the right-hand margin: un numbered sides have a small disc in red colour in the centre ; the numbered, in each of the two margins; each and every fol. more or less worm-eaten but mostly in the 25 margins only; condition on the whole tolerably good ; yellow pigment used while making corrections ; complete ; the entire work is divided into s adhikaras as under.Adhikara foll. to 30 II III 60 , 120 IV 30 Age.-- Not modern.

Page #91
Jaina Literature and Philosophy 56 [40. Begins.--fol. !" 56 // sarvajJAya nm(:)|| ___ namiUNa namirasuravara etc. as in No. 39. Ends.- fol. 19 sirisomaThANanahaMgaNasomasamA somvimlkittibhraa| somasamavayaNakamalA jayati sirisomasuMdarA guruNo / / 64 // muNi suMdaramuNisuMdarasUriSu(pu)ra(raM)dara (ma)NiMdajayacaMdA / tappaTTagayaNamaMDalayambhAsaNapayaDaravivadA // 65 // tappaTTarayaNA(Na)sa(se)harasUrIsararayaNAsaharA gurunno| jesi karayalasiTrI ajavi sIsema(su).dIseI // 66 // tappaTTa ghuruddharaNA nimmalavaraNA smggshkrnno| bhuvaNapuakittibharA lacchIsAyara jugappavarA // 67 / / taapvimlcchiiklchiihiyahaarsigaaraa| sirisumaisAhu / sUrIsarA virAyati kaMtidharA 68 // tesi va vijayarasirijiNamANika sugurusI(se)Na / sussAvagavaramUlAvayaNeNa aNaMtahaMseNa // 69 / / vikkamahayaveatihi 1547)pamANavarisami 'thaMbhaNapura mi / uddharia sumudA / vihi soheabdha su(ya)haroha / / 70 // jAva ya diNidavaMdA etc. up to jayau loe // 7 // as in No. 39. This is followed by the lines as under: iti zrIaSTAhikAcaritre zrI naMdIzvara'hopavarNanavicAraH // cha / zrIpramaNasaMghasya // cha / / || tatsamAptau ca samAptaM / / cha zrIH // cha // shriiprmgurugcchnaaykNshriishriishriilkssmiisaagrsuuritpttttaalNkrnnshriisumtisaadhusuuri|| mahopAdhyAyAdhirAjazrIzrIzrIjinamANikyagaNiziSyamahopAdhyAyazrIanaMtahaMsagaNikRtaM / zrIvimalaharSavAcakaziSyai munivimlbaackottNsaiH| zreyo(s)thai citkoze / muktA pratiriyamanalpaguNaH // 1 // N. B.--- For further particulars see No. 39. 25

Page #92
42.] The Svetombara Narratives AnandaprathamopAsakasandhi Anandaprathamopasakasandhi ( ANandapaDhamovAsayatandhi ). (Anandapadhamovasayasandhi ) 127 (13). No. 41 1872-73. Extent.- fol. 13s to fol. IS. Description.- Complete ; 75 verses in all. For other details see Upadesaratnamala ( Vol. XVIII, pt. I, No. 264). Author. - Not mentioned. Subject.--Narration about Ananda, one of the ten staunch devotees of Lord Mahavira in Prakrit ( Apabhramsa ) in verse. Begins.- fol. I34 | 605 // sirivIrajiNaMdaha / paNayasariMdaha / paNanavi goyamagaNanihihiM / / ANaMdussAvaya dhammapabhAvaya / bhaNisu saMdhi Agamayahi // 1 // etc. Ends.- fol. IS jaM iha hINAhiya / kiMci vi sAyahiya | taM jiNavANiya mujha khamau // iha paDhai ju gagai vaaci| muttiniya(yaM)biNi so ramaDa // 75 // ANaMdaprathamopAsakasaMdhiH // cha / Io o! AnandazrAvakacaritra Anandasravakacaritra 332. No.42 1871-72. Size.- 101 in. by 48 in. Extent.- 9 folios ; 22 lines to a page; 45 letters to a line. Description.- Country paper thick, tough and white ; Jaina Deva nagari characters with occasional ass; small, fairly legible, uniform and tolerably good hand-writing ; borders ruled in three lines and edges in two in red ink ; dandas 30 and some words pointing out metres written especially in red ink; foll. numbered in the right-hand margin ; in' the left-hand margin the title is written as ANaMdazrA ; edges of a few foll. slightly gone; condition on the whole good ; complete; composed in Samvat 1696. 35 8 [J. L.P.]

Page #93
58 Jaina Literature and Philosophy [42. 15 Age.- Samvat 1711. Author.-Rsi Kesava of 'Gujarati Lonka gaccha. Is he the author of lokAzAhano zaloko and sAdhuvandanA or his namesake? Subject.-- Biography of Ananda, a Jaina layman and a staunch follower of Jainism in Gujarati in verse. Begins.- fol. 1 // 6 // AzA rAge duuhaa|| svastizrIsaMpatikaraNa / Icchata pUraNa Asa ! pApapaDalaTAlana pragaTa / karaNa jagataparakAsa // 1 // kevalajJAni jhalahalai / valI atizaya ca uttIsa / koDi deva sevA kari / pUri manaha jagIsa // 2 // Adi Adijinavara bhalA / aMti vIra jinarAya cauvIsi jinavara catura | praNamI ehanA pAya // 3 // balI samarUM sadaguru taNo / nAma mahAsuSakaMda / ANaMdanA yuNa gAyasyuM / saMbhalayo janavaMda // 4 // etc. Ends.-- fol. 96 e adhikAra jaMbUM prati / kAMi bhASyo re sudharma gaNadhAra / ma manasuddhi je saMbhAla / sahI hovi re nitya jayajayakAra // 77 // ma ANaMdanA guNA gAvasye / kAMI ANI re mana avicala prema / jasa saubhAgya pAmi sahA | kAI hovi re valI valI nitya pema / ma // 7 // gaccha 'luki gujraatiiyaaN'| sahI moTA re huyA gaccharAya / ma zrI'rUpa jIva doya vara harI / tasa pATi re jasavaMtajI kahAya bha // 79 tassa paTTadhArI jANIi / calI vArI re jeNai viSayakaSAya / ma / zrI rUpasiMhajI sohatA / jasa nAma dUre nitya nava niddhi dhA(thA)ya / ma // 8 // tasa vineya zrIpati kahii / e racIyo re saMbaMdha rasAla / bha / naranArI bhAvi maNi / valI bhaNatA re nitya maMgalamAla / / 81 // bha saMvata rasa naMda jANAi | valI vasu re bibhaNo ( 1696 ) vANa / ma dina mala zuka sohAmaNo / e suNatA re nitya parama kalyANa // 82 // bhavika nara jaanno| 20 30 2 1 See Jaina Gurjara Kavio (Vol. III, Pt. 2, pp. 2206-2207 ). lbid., p. 2207. 3-4 Ibid., p.2209.

Page #94
43.] The Svetambaru Narratives 59 ___ iti zrIAnaMdazrAvakano carItra zrIdigapradhAnajIRSizrAddha'kezavajIkRtaM saMvat 1711 varSe Asu vadi 2 some 'dIvabaMdrAt lakSataM RSi govAla lIbajI racaI paThanArtha subhaM bhavatu kalyANamastu // ityAcAryazrIkezavajIkRta ANaMdazrAvakavIrapratibaMdanagamanadvAdazava(ta)saMgrahaNAdivarNanarAsa sNpuurnnH|| AnaMdazrAvakacaritra 624. 10 Anandasandhi Anandasandhi No.43 1892-95. Size.- 10 in. by 4. in. Extent.-- 8 folios ; 16 lines to a page ; 45 letters to a line. Description.- Country paper thin, rough ard white ; Jaina Deva. nagari characters; sufficiently big, quite legible, uniform and very good hand-writing ; borders ruled in three lines and edges in two, in black ink ; red chalk used ; foll. 15 numbered in the right-hand margin ; edges of some of the foll. gone ; a portion of the 8th fol. torn; condition on the whole tolerably good; complete ; composed in Samvat 1684 in Puhakarini ( Puskarini ). Age.-- Old. Author.- Srisara, pupil of Ratnaharsa and co-pupil of Sahajakirti and Hemakiti of the Kharatara 'gaccha. His additional works are as under :-- (1) AdinAtha-stavana (2) upadezasattarI. (3) gautamapRcchA stavana. (4) jinapratimAsthApana stavana. (5) jinarAjasUrirAsa V. S. 1681. (6) dazazrAvakagIta. (7) 'phalavadhi' pArasanAtha-chaMda (8) 'phaloghi pArzvanAtha-stavana. 20 30 1 lbid., p. 2210.

Page #95
S 10 IS 20 60 30 Subject. Begins. ( 9 ) ( 10 ) ( 11 ) Jaina Literature and Philosophy motI kapAsiyA saMbaMdha-saMvAda vAsupUjya - rohiNI - stavana sArabAvanI Ends. fol. 8b V. S. 1689. V. S. 1703. V, S. 1689.1 It remains to be ascertained as to whether the "balavabodha on Ratnasekhara Suri's Gunasthanakramaroha is the work of this Srisara or that of his namesake. Biography of Ananda in Gujarati in verse. fol. 1* // 960 // dUhA varddhamAna jinavaracaraNa / namatAM nava nidhi hoI / saMdhi karuM ANaMdanI | sAMbhalijyo sahu koi // 1 // DhAla iNi bhavasari jagi rAjIyaujI ehanI jAti // tiNi kAlai tai tithi samaijI / nayarI 'caMpA' nAmA | jaMbUsAni pUchIujI | bhASai sudharamasvAmi // 2 // etc. [43. 'pukAriNI' nayarI ati dIpatI / zrAvaka catura sujANa / AdIsara jiNavaramupasAulaTa | rAjaprajAkalyANa // 48 // 40 // saMta da (di) sa ( sa ) sidhi rasa sasi (1684) tija purI / mai kIdhI 25 Reference. For extracts and additional Mss. see Jaina Gurjara Kavio (Vol. I, pp. 534-536 & Vol. III, Pt. I, pp. 1029-1030). caumAsa / e saMbaMdha kIyau raliyAmaNau / suNatAM thAi ulAsa / / 49 / 40 // ratanaharaSa vAcaka guru mAharau / hemanaMdana sukhakAra 1 hemakIrati gurubaMdhavanai ( kahai ) pabhaNai muni zrI sAra // 50 // ANaMda zrAvaka saMbaMdha saMpUrNamiti // saMvat // 1 // This Ms. ends thus. In B. B. R. A. S. (Vols. III-IV, p. 469) there is mentioned a Ms. of Anandasravakasandhi of Srisara composed in Samvat 1684. 1 For this list see Jaina Gurjara Kavio ( Vol. I, pp. 534-541 & Vol. III, Pt. I, pp. 10:9-1032). 2 This is mentioned in Jinaratnakosa ( Vol. I, p. 106 ).

Page #96
45.7 The Svetambara Narratives Anandasandhi Anandasandhi No. 44 688. 1899-1915. Size.- to in. by 4g in. Extent.-- 10 folios ; 15 lines to a page ; 42 letters to a line. Description.- Country paper very thin and greyish ; Devanagari characters; small, clear and very fair hand-writing; borders and edges as well ruled in two lines in red ink; red chalk used ; yellow pigment, too; foll. numbered as usual; the 9th fol. slightly damaged in the body; condition tolerably 10 good; complete. Age. - Samvat 1747. Begins.-- fol. 1 // 50 // dahA // varddhamAnajinavaracaraNa ! namatAM nava nidha hoi / siM(sa)dhi karUM ANaMda taNI sAMbhalijyo sahu koi // 1 // 15 DhAla pahilI || etc. Ends.-- fol. 100 _ 'puhakariNI' etc. up to muni zrIsAra as in No. 43. Then we have: iti AnaMdasi(saMdhi saMpUrNa // saMvat 1747 varSe / magasiramAse 20 kRSNapakSe caturthItithau somavAre // zrI pArabArA'madhye / pa mahimAmANikya siSya / mahimasUMdara hIradhIra / jukta dhIrasahitena / caturmAsI kRtA / N. B.-- For further particulars see No. 43. Anandasandhi Anandasandhi No. 45 1583. 25 1891-95. Size. -- 54 in. by 48 in. Extent. -- 27. folios ; 13 lines to a page ; 20 letters to a line. Description.- Country paper somewhat thick, rough and grey; Jaina Devanagari characters; big; quite legible, uniform and 30 very good hand-writing ; borders ruled in two lines in red

Page #97
S 15 Age. Samvat 1729. 10 Begins. fol. 14 gItAni // 960 // dUhA 62 25 30 Jaina Literature and Philosophy L 45. ink; foll. numbered in the right-hand margin; originally they seem to have been numbered in the left-hand margin, too; for instance fol. 23 was there numberd as 245; but now the white pigment is applied; the numbered and the unnumbered sides as well have three discs in red colour: one in the centre and one in each of the two margins; edges of several foll. slightly gone; condition on the whole good; complete. barddhamAnajinavaracaraNa | namatAM nava nidhi do (ho) i / saMdhi karuM ANaMdanI / sAMbhalijyo sahu koi | etc.as in No. 43. Ends. fol. 27b 20 Anandasundara No. 46 'geftu' etc. up to gia as in No. 43. This is followed by the lines as under: 1240 // iti zrIAnaMdasaMdhiH samAptaH // saMvat 1729 varSe magasiravadi 7 dine / paM0mAnajI likhitaM 'kirahora ' madhye | chAjahaDajagata siMghapaThanArthe // N. B. For additional information see No. 43. Size. 10 in. by 41 in. Extent. 70 folios; 15 lines to a page; 58 letters to a line. Description. Country paper tough and white; Devanagari characters; small, legible and good hand-writing; borders ruled in four lines in black ink; red chalk used; foll. numbered as usual; fol. 1a blank; fol. 40 wrongly numbered as 39; edges of several foll. worn out; a good many foll. worm-eaten; some very badly; condition unsatisfactory; fol. 70 blank except that the title etc. written on it; composed at the request of Javada, an officer of Giasuddin Anandasundara 768. 1895-1902.

Page #98
46.] The Svetambara Narratives 63 V 70. Khilaji of Malwa ; complete ; this work is divided into 8 adhikaras as under:Adhikara I fol. . to fol. 28 II , 28a to fol. 360 III , 37s to fol. 420 IV ___42b to fol. 47. ___48a to fol. 5 VI 55b to fol. 600 VII 6ob to fol. VIII 66 to fol. 10 Age.- Not modern. Author.- Sarvavijaya Gani. Subject.-- This kavya deals with lives of ten Jaina laymen ( upa sakas ). Their Sanskrit names are as under:___ (1) Ananda, (2) kAmadeva, (3) culanIpitR, (4) surAdeva, (5) kSulla. 15 zataka, (6) kuNDakonika, (7) sahAlaputra, (8) mahAzataka, (9) nandinIpitR and (10) sAlihipitR. Begins.- fol. 1 // 60 // zrIbhAratIbhyAM namaH / / pUrva pANigRhItakaMkaNakamako saMbhavAso vadhU yugmAta pallavito'bhiSekavidhinA vRddhi parAM prApa yaH / saMjAtaH zatazASa eSa tanujaiH zrInAbhibhUrbhUruhaH / __ sacchAyaH samanomanoharatanustanyAta kalaM va phalaM // 1 // prAcatyaM ca phaNAmaNicchaladharAH paMcApi diipaaNkraaH| zobhate zivapattanokamanasAM mithyAtvarAtrAvapi / paMcAcArapathAniva prathayituM yanmUrddhadeze sthiraa()| 35 zrImAneSa jinAzvi(zci)notu paramaM pRthvIsutaH prArthitaM // 2 // nIlAmodarasodaradyutijuSA svazrImuSe zrIpate(:) / zaMkhaH pUrayituM ka(kutUhalarasAvezena yenAhitaH / dhatte nityasalIlanIlakamalakrIDanmarAlopamA nemiminarAn narAyaNanato netA(s)vatA(da) duSkRtAt // 3: 30 yannAmApi samApito(Da)khilavipadavyApAramAkAraNaM / zrINAmatra paratra maMtramayatAM nirvighnamAsnidhnute / sArvaH sarvajanInasarvagamahA mAhAtmya kelIgRhaM / yabhiMtAmaNireSa zekharavaro vizveSu pAvaH zriye // 4 20

Page #99
Jaina Literature and Philosophy [.46. janmasnAtramahe maheMdraniva hai nirmAyamANe muhH| kAleyadravapiMjarajalabharaiH kiM pItimAna gataH / / 'bheru' kAMcanasAnuritthamadhikAM prApa prasiddha purA / zrIvIraH paramezvaraH praNamatAM puSNAtu puNyAni saH / / 5 'maMDapa'deMgazRMgArAH paMcApyete jinezvarAH / zAstrAdau jAvaDeMdrasya prasannAH saMtu saMtataM / / 6 'tapAgacchAdhipAH zrImatsomasuMdarasUrayaH / munisuMdarasUrgadrA jayacaMdrAzca sUrayaH / / 7 / / zrIratnazekharAcAryAH zrIlakSmIsAgarAH pare / jayapratibhuvaH saMtu jAvaDe'mI yugottamAH // 8 // ttshv| sumatisAdhuguru'stagacchapaH / svapadapAvita mAlavamaMDalaH / kalayati sma savismayakAraNaiH / sakalasariziromaNitAM guNaiH // 9 // pUrva zreNikabhUpatijiMnapatevArasya sevAparaH / tasmAt saMpratimedinIpatirabhUcchA(cchA)ddhaH suhastiprabhoH / zrIhemasya kumArapAlanRpatirbhaTTeryathA(s)mastathA / . jIyAjjAvaDa eSa zekharatayA suzrAvakANAM guroH // 10 // khyAta zrImAlabhUpAla birudaH paavkaagrnnii| kAle'smin zAlibhadrasya sAdRzyAd dRzyate hi yaH // 11 // tasyAbhyarthanayA graMthaH shriimaanaanNdsuNdrH| kriyate'sau mayA sarvavijayena yathAzrutaM / / 12 / / etc. --fol.27" iti 'zrImAla kulazrImAlabhArimAlavezvarazrIkhalacI(ga)yAsa(sa)[surva] dInagururadragajAdhika(kA)rivyavahAriziroratnAnukAri laghuzAlibhadre'tibiruda. prasiddhasaMghapatizrIjAvaDasamarthAbhyarthanAvazavartisAMpratInavicakracakravartima. hApaMDitamuSyasavijayagaNivaravidhIyamAnazrIvarddhamAnadezanArasanidhAne zrI. madAnaMdasuMdarAbhidhAne zrIdharmazAstrapradhAne zrIAnaMdaprathamopAsakakiMcidguNa lavavyAvarNano nAma prathamo'dhikAraH // 1 // -fol. 36deg iti zrI etc. zrIkAmadevadvitIyopAsakakiMcidguNalayavyAvarNano nAma dvitIyo'dhikAraH // cha / Ends.-- fol. 700 evaM dazabhAvakasaccaritraM zRNvaMti ye puNyakathApavitraM / teSAmazeSAH sukhasaMpado'pi pade pade syuH prabhupArzvabhakteH // 66 // 25 30

Page #100
47.1 The Svetambara Narratives 'zrImAlo' dbhavavaMza mauktikamaNeH zrIjAvaDaspArthanAM / matvA 'mAlava' dezamaMDana kare zrImaMDapakSmAghare / vidvatpuMgava tuMgasarvavijayo yajJe'dhikAraH kramA dAnaMdAdima suMdarezva sukRtagraMthe'STamo jejitAt || 67 // iti 'zrImAla ' kulazrImAlamA rimAlavezvara zrI khalacI gayA sadInagurunareMdra gajAdhikArivyavahAriziroratnAnukAri 'laghuzAlibhadre' tibirudadhAriputra harajI bhrAtRsaM lAlApramukha parivAra parivRta saMghapati zrI jAvaDasamarthAbhyarthanAvazavarttisAM pratInakavicakravartti mahApaMDitapraSTazrImatsarvavijayagaNivaravidhIyamAnadezanArasanidhAne zrImadAnaMdasuMdarAbhidhAne dharmazAstrapradhAne navamadazamazrAvakakiMcidduNalavavyAvarNano nAma aSTamo(s) dhikAraH // Anandasundara No. 47 Reference. For additional Mss. see Jinaratnakosa ( Vol. I, p. 30 ). One of the Mss is dated as V. S. 1551. 65 S 10 Size.-- rog in. by 4g in. Extent. - 108 folios; 13 lines to a page ; 40 letters to a line. Description.-- Country paper thin, rough and white; Jaina Devanagari characters with frequent q8uras; big, quite legible, uniform and beautiful hand-writing; borders ruled in three lines in red ink; foll. numbered in the right-hand margin; fol. 1 blank; red chalk used; there is some space kept blank in the centre of the numbered and unnumbered sides as well; yellow pigment used while making corrections; some foll. have stuck together probably due to the 25 presence of gum in the ink used; edges of the first fol. slightly gone; some of the foll. slightly worm-eaten; condition on the whole good; complete; this work is divided into eight adhikaras; the extent of each of them is as under: 9 [ J. L. P. J Anandasundara 625. 1892-95. 15 20 30

Page #101
Jaina Literature and Philosophy Adhikara foll. 10 II III [ 47. 420 >> 420 >> 566 >> 636 IV V , 739 856 1 850 oo 102a 1086. 10 VI 935 VII >> 930 VIII , 102a Age.- Old. Begins. - fol. 10 y E O Il salarTaru AA: 11 gal) anioteta etc. as in No. 46. Ends. fol. 1086 ga 9734175 gaita etc. up to TU(S)TA afar(ara 1EUIL gia Ald's etc. up to 1577917 vofat ala 370 (serxit: Il sfitea 117 mill TH HaTil Bratia astiqai 1711 N. B.- For further particulars see No. 46. 15 20 AnandAdizrAvakacarita Anandadisravakacarita ( 3110ragalahaf31) ( Anandaisavagacaria ) No. 48 1176. 1886-92. Size.- 11 in. by 4; in. Extent.--- 13 folios ; 13 lines to a page ; 44 letters to a line. Description.- Country paper thick, rough and white ; Jaina Devanagari characters with occasional gefa ; big, quite legible, uniform and beautiful hand-writing; borders ruled in four lines in black ink; dandas written in red ink; foll. numbered in the right-hand margin; fol.1 a blank except that the title etc. written on it; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; yellow pigment used while making corrections ; condition very good ; this work ends abruptly; the last (complete ) verse numbered as 67 i.e. 367. Age.- Old

Page #102
49.] The Svelambara Narratives Author.- Not mentioned. Subject.-- Biography of ten Sravakas in Prakrit in verse. The Prakrit 'names of these Sravakas are as under :__ (1) ANanda, ( 2 ) kAmadeva, (3) culaNIpiya, (4) murAdeva, (5) cullasayaya, (6) kuNDakoliya, (7) sahAlaputta, (8) mahAsayaya,.5 (9) nandiNIpiya and ( 10 ) sAlihIpiya. Begins.- fol. 10 e60 zrIgurubhyo namaH / / vIrajiNidaM deviMdavaMdiraM vaMdiUNa ddhiamohaM / sirigoamaM gaNaharaM ajasuhamma muhamma ca / 1 / saparajaNabohaNatthaM sattamaaMgAo niagurupsaayaa| ANaMdappamuhANa cariaM saTTANa bu(bu)cchAmi / 2 / etc. Ends.- fol. I dhamma sammahasaNamUlamahiMsAi sAvayANa sau / paDivajiUNa nuhamuhakamalAsaphalemi niajanmaM / 65 / adhappamidaM devo sAminumaM ceva vIarAu ti / sugurU vi baMbhayArI dhammo jiNadesiu hoi / 66 / antapariggahiA ceiaatucchia devayAiNo paName vihiarihace iANaM paNAmamujjhi kaiA vi / / 67 / / iMa puNa dUsaNarahiaM paMca vinvasaNa ... ... vi Reference.- Only this Ms. is noted in Jinaratnakosa ( Vol. 1, 20 p. 30). 1261. Amaprabandha Amaprabandha No. 49 1884-87. Size.-- 104 in. by 4i in. Extent.- 19 folios ; 15 lines to a page ; 44 letters to a line. Description.-- Country paper thin, tough and greyish; Jaina Devanagari characters with rais; sufficiently big, quite legible, uniform and very good hand-writing ; borders ruled in four lines in black ink; space between the pairs coloured red; foll. numbered in the right-hand margin; unnmbered sides decorated with a small disc in 30 1 For Sanskrit names see p.63.

Page #103
Jaina Literature and Philosophy [.49. s red colour in the centre only; the numbered, in each of the two margins, too ; red chalk used ; fol. 19deg blank ; edges of the last fol. slightly gone ; condition on the whole very good ; complete ; extent 648 Slokas. Age. -- Old. Author.-- Not mentioncd. Subject.-- This work in Sanskrit deals with the life of king Ama and his spiritual teacher Bappabhasti. The main topics are as under :-- 1 bappabhadrisUriprabandha ___foll. 1 to 40 2 bappamaTTimUrisiMhAsanopavezaprabandha 3 bappabhATriparamanojJAnaprabandha 4 bappaTTivyomagamanavidyAptiprabandha 5 bappabhaTTisUryAmaroSatoSaprabandha 6 vappaTTipravodhitAmakIrtanaprabandha 7 bappAdRzIlaparIkSApravandha / 4 bappabhaTTisarvajJaputrabirudAdiprabandha 1 bappaTTisUryAmAkAryaniSedhaprabandha 10 bappaTTivAdivijayaprabandha IH bappabhAdRvApatiprabodhaprabandha 12 barapaTTikAritAmayAtrAprabandha praznacUDAmaNi is referred to on fol. 12'. Begins.-- fol. 1 1975 zrInAbhibhUravatu vaH karapallavoru chAyAruNaM bahulamikSurasaM dadhAnaH sapremasiddhiyuvaticchuraNAcchayA yaH / _ 'kAzmIra'nIrabhRtapANiriva sma bhAti // 1 iha hitAvadazeSAvatArANAM zekharatAmeti mAnuSA'vatArastaduktaM / / salileSu meghasalilAM(laM) godhamo(unneSu dhAtuSu suvrnn| saggoM dAruSu nRbhavo bhaveSu bho vaibhavaM labhate // 2 // ata evAgame collakAdibhirdazabhi loMke yumaNyAdibhiranekaizca dRSTAMtastasya dullamatA bhaNyate taduktaM // culaga pAsaga dhanne jUe rayaNA a sumiNa cakkaM a| camma juge paramANU dasa diTuMtA maNualaMbhe // 3 // 17 30 16 1 This is v. 160 of the nijjutti on Uttarajjhayana,

Page #104
J0 50.] The Svelambaru Narratives |maNisparzapASANadakSiNAvartazaMkhavat / kRSNavi(ci)vakavallIva durlabho nRbhavaH zubhaH // 4 // sa va(ca) samyagupalakSitazrIdharmArAdhanAdeva saphalaH saMpadyate tadupalakSaNaM punaH prAyaH sugurupadezAdeva jAyate taduktaM // sugurugirAe taha aMtaraMganayaNasma hoi ugghaaddo| jaha cittagavallIe / kukkuDakuMbhAraDiMbhANaM / / 5 / / atrArthe zrIAmasamyagupalakSitajainadharma zrIbappabhaTTigurusattamavRttavyAcyaH / 'puNyapradIpa' iti nAmadharaH prabaMdhaH / prastUyate sahRdayaMgabhagadyapadyaH // 6 // asti svastipadaM gururjanapadaH zrI gUrjara' svastira skurvannekaturaMgamaM hayadalakSuNNA'khilakSmAtalaH / ekairAvaNavAraNaM karaTinAmApUritaH peTakai rekazrIdaniketanaM gatamiti zrIdAlayA(s)laMkRtaH // 7 // etc. 15 Ends.- fol.19* sa ca durApe sarvottamazrIsaMghapatipadasaMpUrNanirvahaNADhamaMdA mudamAdadhe // uktaM ca // zrImAnurvIpatirviSNuH sArvabhaumo jinezvaraH // zrIsaMghazcakramAprauDhAstatpatirbhAgyabhAga bhavet / / 44 // tataH kiya(da)dinairAjagAma saMjAtaprauDhapravezotsavaH sUriNA 'shsrpur|ch|| 20 zrIbappaTTikAritAmayAtrAprabaMdhaH / / cha / / zrIsUrizca krameNa tathAvidhAvasaraniryAmitanijaguruzrIsiddhasenasUristatridivagamanAnaMtarazrIgoviMdazrInannAcAryadvayasamAtisamagrasvagacchabhAraH zrInR. pAdipRSTanekavidhaviSamasamasyApUraNaprAptasamasyAsatrAgArapraghoSaH / sArvadikasvAmoghadharmopadezairAmarAjena cirAya puNyaparaMparAmacIkarat // cha // // graMthAnaM 25 684 pratyakSaragaNanayA // cha / Then in a different hand we have : 'tapA'gacche paMDita zrIvarasiMghagaNiziSyagaNizubhavijaya // zrIjinAya namaH / / Reference.-Only this Ms. is mentioned in Jinaratanakosa (Vol.I, 10 p.30). There the title of this work is given as 'AmayAtrAprabandha' but that is not correct. ArAmazobhAkathA Aramasobhakatha 239. A. 1882-83. Size.- 10 in. by 4. in. Extent.- 3 folios ; 22 lines to a page ; 75 letters to a line. No. 50 35

Page #105
Zo Jaina Literature and Philosophy [ 50. lo Description.- Country paper thick, tough and white'; Jaina Deva nagari characters ; very small, fairly legible, uniform and very good hand-writing ; borders ruled in three lines in black ink ; red chalk used; foll, numbered in the righthand margin; there is some space kept blank in the centre of the numbered and the unnumbered sides as well ; yellow pigment used while making corrections ; edges of each and every fol. slightly gone ; small strips of paper pasted to some of them; condition on the whole tolerably good; complete ; 278 verses in all. Age.-- Old. Author.-- Not mentioned, Subject.-- Narration of Aramasobha su named as the garden used to accompany her ( Vidyutprabha ) wherever she went. This narration illustrates the fruit of being a devotee of a Tirikankara. There is a Prakrit work named Aramasoha. Its substance in Gujarati is given in the publication dated V. S. 1997 and issued from Surat. Begins. fol. 146 Oy 347971 ACTOITEATAT 'TIATE'gi Falnegara IT TOTISISI 'u Il ? bhagavAna sumanaH kRtvA samava[:]saraNe sthite(t):| Thai TAITA Igalore I etc. Ends.- fol. 36 na(s) gar wargalai) i avargtarnia! bhavAn katipayAna prApya / zAsva(zva)tAM siddhimeSyati // 77 evaM bhostIrthakadbhakteH phalamAkarNya suMdaraM / #TA FACETURTIGEar(:) (H)qia per II VC iti ArAmazobhAkathA jinabhakto saMpUNoM / munipadmasuMdaralaSitaM / / zubhaM (a)ad" Reference,- In Jinaratnakosa ( Vol. I, pp. 33-34 ) several Mss. are noted. Of them this Ms, and the next deal with the same work, and so is the case with the subsequent two Mss. But such a distinction is not made in this Jinaratnakosa. The Ms. No. 1293 of 1887-91 remains to be described. 25

Page #106
71 52. The Svetambara Narratives ArAmazobhAkathA Aramasobhakatha 852(b). No. 51 1892-95. Extent.- fol. Iob to fol. 160. Description-- Complete ; fol. 16b blank. For other details see Suka- 5 rajakatha No. 852 ( a ). rajakatha No. 1892-95. 10 10 Begins.- fol. 10" 550 // anyadA zrImahAvIraH svAmI 'rAjagRhe' pure| samavAsaradudyAne / bhUyo 'guNazilA'(5)bhidhe // 1 etc. Ends.- fol. 16 tatacyutvA kramAdeto naratAsaratAvarAn / bhavAn katipayAn prApya / zAstra(zva)tI siddhimeSyate // 79 evaM bhostiirthkdbhkteH| phalamAkarNya suMdaraM / kAryastatkaraNe yanno(no) yuSmAbhiH pramadAt sadA // 80 iti jinabhaktau / ArAmazobhAkathA // 7 // N. B.-- For further particulars see No. so. - - 20 ArAmazobhAkathA Aramasobhakatha 626. No. 52 1892-95. Size.--104 in. by 4; in. Extent. -- 10 folios; 11 lines to a page ; 32 letters to a line. Description.- Country paper thin, rough and white; Jaina Deva. nagari characters with occasional pRSThamAtrAs ; big, quite legible, uniform and very good hand-writing ; borders ruled in three lines in red ink; red chalk used; a portion of the second line written in red ink ; soll. numbered in the righthand margin ; fol. 1 blank; condition very good; complete. Age. - Samvat 1611. Author.- Not mentioned. Subject.- Narration of Aramasobha. For particulars see No. 50. 25 30

Page #107
72 [52. Jaina Literature and Philosophy __Begins.- fol. 10000 saddharmamUlasamyaktvanairmalyakaraNe sdaa| yatadhvaM tacca tIrthezasaMghapUjAdibhirbhavet // 1 // atha zrIvItarAgasaMghapUjAviSaye ArAmazobhAkathAnakaM // 7 // ihaiva 'bharate' kuzAyadeze 'sthAlAzrayo grAmo'sti / tatparito yojanAMta yAvat tRNAni muktvA anyo vRkSaH kadAcit nottiSThati etc. Ends.-- fol.10deg rAjJA uktaM / ahamapi yAvat putraM rAjye nivezya dIkSArtha AgacchAmi / tAvat atraiva sthAtavyaM / tato malayasuMdaraM rAjye nivezya ArAmazobhAsahito rAjA dIkSAM jgraah| niratIcAraM cAritraM pratipAlya dvAvapi svargasaMpadaM praaptuH| tatazcyutvA kramAta katipayAna bhavAna bhavAn prApya mokSaM yAmyataH // iti ArAmazobhAkathAnaka // 7 // saMvat 1611 varSe margazIrSazudi 2 dine jAnInArAyaNena liSitaM // 7 // cha is repeated a number of times. Reference. - See p. 70. to 20 ArAmazobhAkathA Aramasobhakatha 162. No.53 1872-73. Size.- 101 in. by 4g in. Extent.-18 folios ; 13 lines to a page; 38 letters to a line Description.-- Country paper somewhat thick, tough and white ; Jaina Devanagari characters with occasional yaars; big, quite legible, uniform and very good hand-writing; borders ruled in four lines in black ink ; foll. numbered in the right-hand margin ; fol. 1 blank ; there is some space kept blank in the centre of the numbered and the unnumbered sides as well: dandas written in red ink: yellow pigment used while making corrections; condition very good ; complete so far as it goes. . Age.- Sarivar 1676. Begins.- fol. 1deg 56 0 // saddharmasUlasamyaktva etc. as in No. 52.

Page #108
73 54.] The svetambara Narratives Ends.- fol. 18 anyasmin dine| mahAn vRddho jaatH| tadA gurvAdezenA'na zanArAdhanAdikaM kRtvA / zubhadhyAnena svarga gataH / krameNa 'mahAva(vi)dehe' samutpadya / kevalI bhUtvA mokSaM gamya (mi)Syati / iti zrIpuNyapAlarAjAkathA smaaptaaH| yasyAsti vittaM sa naraH kulInaH / sa eva vaktA sa ca drshniiyH| sa paMDitaH sa zrutavAn gunnjnyH| sarve guNA() kAMcanamAzrayati / 1 / kiM kAmaNi ? kiM kavvarasa ? / ki dhaanussysrenn?| loaNa mana sana lAgataiM / sIsa na dhuNyAM jeNa / 2 / raMgaha mAhi mUsaNuM / majha mani SarUM suhAya mirIca makkAMbAhirISAMDa na bAMNI jaai|3|| jiNi dini mi na appaNai / tiNi dini mitta na koi / kAdava kamala bAhirAM / dinakara virI hoi||4| saMvat 1676 varSe amade 5 zanI // zrI // 7 // zrIkalyANamastu zrI // // N. B.-- This Ms. is not noted in Jinaratnakosa (Vol. I ). For addi tional information see No. 52. 15 ArAmazobhAkathA Aramasobhakatha No. 54 1293. 1887-91. 20 Size.- 9 in, by 4} in. Extent.- 6 folios ; 17 lines to a page; 35 letters to a line. Description.- Country paper white; Devanagari characters; legible "_hand-writing ; foll. numbered as usual; condition good. Age.-- Not modern. Begins.- fol. I saddharmamUlasamyaktvaM nairmalyakaraNe sadA / yatadhva ta(ca) tIrthezasaMghapUjAdibhirbhavet // 1 // zrIvItarAgasaMghapUjAviSaye ArAmazobhAkayAnakaM // ihaiva 'bharate' kuzAyadese 'sthalAzrayo grAmo vasati / tatparito yoja. 30 nAMtaM yAvat tRNAnI(ni) muktA (ktvA) anyo vRkSaH etc. as in No. 52. Ends. - fol. 9 ahamapi yAvat putra rAjye nivezya dIkSArtha AgacchAmi / tAvat atraiva sthAtavyaM / tato malAya)suMdaraM rAjye nivezya ArAmazobhAsahito rAjA dIkSAM jagRhe / cAritraM pratipAlya nvarga gtH| krameNa mokSaM gacchati // iti ArAmazobhAkathA saMpUrNAH // zrIrastuH zubhaM bhavatu // zrI ||ch // 35 mAMDahAnagare N. B.--For further particulars see Nos. so and 52,

Page #109
74 s 10 Jaina Literature and Philosophy [. ArdrakumArarAsa Ardrakumararasa 331. 'No. 55 1871-72. Size. - 10in. by 48 in. Extent.-- 11 folios ; 18 lines to a page : 36 letters to a line. Description.-- Country paper thick, rough and white; Jaina Deva nagari characters ; big, quite legible, uniform and beautiful hand-writing; borders not ruled; red chalk profusely used; fol. numbered in both the margins; edges of a few foll. gone; condition on the whole good ; yellow pigment used while making corrections; complete ; composed in Samvat 1727 in Laghu-vatapadra. Age.- Pretty old. Author.-- Jnanasagara, pupil of Manikyasagara. His additional works in Gujarati are as under:(1) 'ASADhabhUtirAsa (2) ilAputraRSirAsa V. S. 1719 (3) RSabhastavana V. S.? (4) citra-sambhUti-copAi V.S. 1721 (5) jJAnachatrIsI v.S. 1403 (6) 'dhannA aNagAra' svAdhyAya V. S. 1721 (7) dhannAcAritra (8) dhammilarAsa (9) nandiSeNarAsa V. S. 1725 (10) nalAyaNa c. V. S. 1720 (u) 'paradezI gajA rAsaH V. S. 1724 (12) rAmacandralekha V. S. 1723 (13) zAntinAtharAsa V. S. 1720 (14) zAmba-pradyumnakumAra-rAsa V.S.? (15) zukarAjarAsa V. S. 1701 (16) zrIpAlara sa V.S. 1726 (17) 'sanadacakrI'rAsa V. S. 1730 (18) 'rathUlibhadra' navaraso V.S.? v. S. 1724 V. S. 1727 v. S. 1715 1 See No. 56. ? See No. 61..

Page #110
$60] The Svetambara Narratives 75 Subject. Biography of Ardrakumara in Gujarati. This is based upon Silanka Suri's commentary on Suyagada and Upadesacintamani. Begins. fol. 1a y&0 11 sakala sUrAsUra jehanA bhAve pUjeM pAya RSabhAdika cauvisa huM te praNamUM jinarAya // 1 // praNamUM zrutadevatA vAgezvarI vikhyAta Adra (E) kumara RSi gAtAM mUjha suSI basajo mAta 2 etc. Ends. fol. 11b ' aMcala ' gaccha garuA gacchanAyaka zrI guNaratnasariMdo re brahmacAri mAhiM cUDAmaNi abhinavo jaMbU muNiMdo re 8 ma0 zrI kSamAratanasUrI tasa pATi soheM jema do be nAmatisiu pagaraNamaI (dI) Tho nayaNI amIrasaviMda veM 9 bha0 zrIgajasAgarasUri tathA ziSya paMDita adhika pratApi reM lalitasAgara budha lAvaNyadhArI jaga sukirati vyApi re 10 prathama ziSya muni mANikyasAgara te'ha taNA matimaMta teha gurunA sU (su) pa ( pa ) sAyathI Adraka RSi guNavaMta 11 bha0 saMvata satara sattAse ( 1727) cetra sudi terasa zanIvAra be puravA phAlgu dhvaja yogaiM 'laghuvaTapadra' majhAra re 12 bha0 e ogaNasamI DhAla dhanyAsI nyAnasAgara kahi nahi dhavalavaMga guDInI sAnIdha diga (na) prati deulaniM gehiM be 13 iti Adra (I) kumArarAsa saMpUrNaH // ASADhabhUtirAsa No. 56 Size. ro in. by 4g in. Extent.- 10 folios ; 15 lines to a page ; 38 letters to a line. Description. - Country paper thick, tough and white ; Jaina Devanagari characters; sufficiently big, quite legible, uniform Reference.-- Published in Litho in V. S. 1943 along with " elAcIkumArano paDhAlIyo". For additional Mss and extracts from one of them see Jaina Gurjara Kavio ( Vol. II, pp. 76-77 25 & Vol. III, Pt. 2, PP. 1136 - 1137 ). Herein this work is named as " ArdrakumAra copAi . Asa dhabhutirasa 1584 1891-95. S 10 15 20 30

Page #111
Jaina Literature and Philosophy [56. and very good hand-writing ; borders ruled in two thick lines and edges in one, in red ink; space between the lines coloured yellow; numbers for the verscs, their dandas etc. written in red ink ; foll. numbered in the right-hand margin ; fol. 1a blank except that there is a circular design decorating it; same is the case with fol. 10deg ; small bits and strips of paper pasted to foll. 1 and 10b; condition on the whole good; complete ; composed in Samvat 1724 in Vakrapuri, 10 Age.- Samvat 1762. Author.- Jnanasagara, pupil of Manikyasagara. For details see p.74. Subject.--- A Gujarati poem about Asadhabhati. Begins.- fol. !" 550 // sakalapaMDitazrI 5RddhisAgaragANagurubhyo namaH / / dUhA // sakalariddhisamRddhikaraH / tribhuvanatilaka samAna / praNama 'pAsa'jiNesaru / nirupama jJAnanidhAna // (1 // ) goyama Adi gaNadhare / je praNamI nitameva / sAnidhikAri sAradA / te praNamuM zrutadeva / 2 / mANikyasAgara muni taNe / caraNe nAma sIsa mujha guru te mahimAnilA / praNamuM visavA visa / 3 / sadagurunA mupasAyathI / hoye sarasa saMbaMdha / vacanavilAsaviseSathI / pragaTa thAe prabaMdha / 4 // mAyApiMDa na lijike / te kahie 'nigraMtha / jinamAraga sudho dhari sAdhai sivapurapaMtha // 5 // laMpaTarasa AhAranA / je thAI aNagAra / cArita choDIne tikeM / maMDai gharavivahAra / 6 // ASADhabhUti atUDI balI vidyAno AvAsa / munivara moha(da)kalAlaci / paDio nAripAsa // 7 // etc. 30 Ends.- fol. 9 'aMcala 'gacche / giruyA gacchanAyaka / zrIguNaratna / sUriMdo re / tAsa pATa AcAra sUrIvara // zrIkSamAsAgara muNiMdo re / 6 / essH|| zrIgajasAgarasari taNI / ziSya lalitasAgara buddha sohe re / / tAsa sIsa muni mANikyasAgara / muja guru bhavimana mohe re // 7 // 35 eSaNIka Aha(hA)ra lyo suni // se guruno mupasAya lahInaiM / ASADhAte RSi mA(gA)yo re / /

Page #112
37.] The Svetambara Narratives 77 RSabhadevaneM saMgha // sAnidhi sarasa saMbaMdha sadhAyo re // 8 // eSaNIka AhAra lyo muni // zrI'vakrApurI' gAMmamA saMvata sata(ra) cauvIsa (1724) re / poSa kRSNa dvitIyA puSpAraka / siddhi yoga sujagIse re|| 9 essnnii| kIgho pratyakSara gaNi graMthAgarano mAno re / ekAbana triNa saiM / laSayo cita rASI yA(?thA)no re // 1 // eSaNIka AhAra lyo muni // solamI DhAla dhanyAsII / pUraNa caDhI paramANo re / nyAnasAgara kahi saMgharne / nita hojyo parama kalyANo re // 11 // eSaNIka AhAra lyo munI // iti zrIASADhacopaha saMpUrNam // sakalapaMDi(ta)ziroratnapaMDitabhI108zrI. RddhisAgaragaNiziSyasakalapIDatAsarova (va)ta(ta)sAyamAnapaMDitazrI5bhIgo. tamasAgaragANiziSyapaM divyasAgareNa likhitaM // saMvata 1762 varSe posamAse zuklapakSe trayodazIdine somavAsare leSayostuH zrI rUpanagaramadhye // graMthAna zlokanI saMkhyA 31(5). chai / Reference. Reference.- For For additional Mss. and extracts from one of them see Jaina Gurjara Kavio ( Vol. Il, pp. 68-69 & Vol. III, Pt. 2, pp. 113--1132). ___ro 18 ASADhabhUtirAsa Asadhabhutirasa 1585. 20 No.57 1891-95. Size.- to in. by 4 in. Extent.-6 folios ; 18 lines to a page ; so letters to a line. Description.- Country paper thin, brittle and greyish; Jaina Devanagari characters; small, quite legible, uniform and 25 very good hand-writing; borders ruled in two pairs of lines in black ink : space between the pairs coloured red : foli. numbered in both the margins ; fol. 66 blank: red chalk used; yellow piginent profusely used on fol. s'; edges of some of the foll. more or less gone; condition 30 on the whole tolerably good ; complete ; composed in Samvat 1724. Age.-1750. Begins.- fol. 1 e67 / zrIgaNesAya namaH / zrIsadgurubhyo namaH / / sakalaRddhisamRddhikara etc. as in No.56.

Page #113
S 10 78 Ends. fol.: 64 25 - 30 N. B. -- For further particulars see No. 56. AsanadAnakathA No. 58 Jaina Literature and Philosophy 'aMcala' gachi etc. up to parama kalyANo re / 10 // as in No. 56. This is followed by the lines as under: iti ASADhabhUtirAsaH samAptaH // zrIrastuH // saMvata 1750 varSe mitI AsADhasudi 13 dine caMdrajavAre 'vaNajapura 'nagarAMtare catuHppadI liSitA // kalyANa bhavatu // zrI // Extent. - fol. 5a to fol. 66. Description.-- Complete. For further particulars see vasatidAnakathA 823 (a ) .. 1892-95. No. Author. - Not mentioned. 15 Subject. -- A narration illustrating the fruit of giving asana ( seat ) to a Jaina monk. Begins. fol. 5 athAsanadAne kathA || 'maMgalapure' ra (rAjA pRthavIpAlastatrAnyadA sUrayaH prAptAH tAn vaMdanAya rAjA lokazva gatavAn etc. 20 Ends. -- fol. 60 gurubhiruktaM pUrvabhave "yatamutImAsanapAdvAdatastasya phalametata (tU) rAjJA jAtismaraNAta (tU) zrAvakatvaM pratipadya svasthAnaM gataH krameNa mukti yAsyati // 2 athAsanadAne kathA // AsanadAnakathA No. 59 [ 57. No. 13 10 ( a ).. 1886-91. Begins. fol. 5 atha AsanadAne kathA likhyate // Asanadanakatha 823 (c). 1892-95. Extent. - fol. 5a to fol. 5. Description.- Complete. For additional information see mUladevakathA Asanadanakatha 1310 (d). 1886-92. 'maMgalapure' pRthvIpAlarAjA / tatrA'nyadA sUrayaH prAptAH etc as in No. 58.

Page #114
. . 60. ] The Svetambara Narratives Ends.- fol. 50 tasya phalametat rAjA jAtismaraNAt zrAvakatvaM prapadya sthAnaM gtH| krameNa muktiM yAsyati / iti AsanadAne kathAnakaM // 7 // N. B.- For further particulars see No. 58. s ilAtIputrakathAnaka Ilatiputrakathanaka 1345 (0). No. 60 1891-95. Extent.- fol. 264 to fol. 260. Description.-- Complete. For further particulars see Susadhakatha No 1345 (a). ___No. 1891-95. Author.- Not mentioned. Subject'- A narrative of Ilatiputra ( son of Ila ) in Sanskrit in prose. He attained omniscience when he had mounted a bamboo while performing an acrobatic feat. Begins.-- fol. 264 'ilAvarddhanapure' / jitazatrurnRpaH / dhAriNI priyA / ibhya vyavahAriNaH / ilA priyA / ilAputraH / durlalitagoSThayAM kSiptaH / etc. Ends.-- fol. 26deg sanidarzanaM / kebalaM saMpUrNa saMjAtaM pUrvabhave / 'vasaMtapure' / bibhaH / brAhmaNIdIkSA / braahmnniimdH| tatprabhAvAdeSA nttii| vipro(5)ha / rAjA . rAjJI kevlN|| vaMsaggi samArUDho / gihivesadharo vibhAvaNavaseNa / jo kevalamaNupatto / ilAyaputto vi ciraM jayau // 5 // 7 // ilAtIputrakathAnakaM samAptam // 7 // saMvat 1654 varSe / Azvinasadi 2 dine| zukravAre / zrI'vRhatya(kha)rataragacche / / zrI21jinamANikyabhUrisUrIzvaraziSyapaM pravarapaM0 zrIvinayasomagANimaNavastacchiSyapaM raMgasuMdarasani. 25 ziSyapaM somasuMdareNa ziSyapaM goviMdAdisahitenAlakhi // zrI svarNagirau' / / - 20 zrIH 1 This is a matronymic name,

Page #115
10 . 15 80 Jaina Literature and Philosophy ilAputraRSirAsa Ilaputrarsirasa No. 61 1184. 1886-92. Size.- 94 in. by 49 in.' Extent.- 6 folios ; 17 lines to a page ; 44 letters to a line. 5 Description.- Country paper thick, tough and greyish; Jaina Devanagari characters; small, quite legible, uniform and very good hand-writing ; borders ruled in three lines in red ink ; foll. numbered in both the margins; red chalk used ; dandas written in red ink ;. a part of the first line and the last two lines in the same ink; condition very good ; for, only edges of some of the foll. are slightly gone; complete ; composed in Samvat I719 in Sesapura. Age.- Sativat I730. Author.- Jnanasagara, pupil of Manikyasagara. For details see No. 55. Subject.- Biography of liaputra also called Ilatiputra in Gujarati in verse. It is based upon BIhadvstti of Avassaya and Rsimandala. ___Begins.- fol. I || 605 zrIpArzvanAthAya namaH / / sakalasiddhidAI sadA / praNahaM jinavara paas| elAputra RSi gAvatAM / Api vacanavilAsa / 1 / valI brAhmInI lipi malI / paMcamAMga dhuri jeha / gaNadhara praNami jehani hu~ paNi praNa teha / 2 / etc. Ends.- fol. 66 gachapati 'vidhi' pakSa gaccha virAji / guNaratnamari divAji / be| 8 bhAva / lalitasAgara budha lAbanyadhArI / tasa ziSya prathama suSakArI be 9 bhAva0 mANikyasAgara muni svicaarii| muja guru jJAnadAtArI be||10 bhAva / teha guru taNA lahI supsaayaa| ilAputra RSi gAyA be // 11 // bhAva / sUtra AvazyakanI niradhAri / bRhavRtti aNusAri be / 12 / bhAva / 20 26 30

Page #116
81 62.] The Svetambaru Narratives palI RSimaMDala mAhithI lIghau / e adhikAra mi sIdhau che (be) // 13 // tiNathI nyUna adhika je bhASiu / te micchAmi dukaTa mi dApiu be // 14 // bhAva. graMthAna akSara guNi mi AMNiu / visi niM sata saTrijANio be // 15 // bhaa| saMvata surmuni ogaNIsA ( 1719 ) vrse| 'zeSapuri' manaharase meM / 16 / bhAva Aso mudi dvitIyA dina saarii| hasta nakSatra budhavAri be // 17 // bhAva // nyAnasAgara dIi saMgha AsIsa / hina dina hojyo sujagIsa che (be) / 18 / bhASaH / jasa sAnidhi sAdhu cArita pAli // jJAna darasaNa ajUAliM be||19|| bhAva taNI guNa ehavA jAMNI // sarvagAthA 197 // iti zrIbhAvaviSaye ilAkumararAsa saMpUrNa jAtam // saMvat 1730 varSe Aso sudi 15 pUrNimA budhe // zrI rAjanagareM lipIkataM / svabAcanAya / kalyANamastu Then in a different hand we have -- // gaNi himatavijayarI parata che jI / / mula lodhI Reference.- For additional Mss, and extracts from one of them see Jaina Gurjara Kavio (Vol. II, pp. 61-62 & Vol. III, Pt. 2, pp. 1128-1129 ). On p. 61 this work is named as " ilAcIkumAracopAi" and on p. 1128 as "elAyacIkumAracopAI". 35 ilAputraRSirAsa Ilaputrarsirasa 242. No. 62 A. 1882-83. Size.- 95 in. by 4} in. Extent.- 5 folios ; 19 lines to a page ; 40 letters to a line. Description.- Country paper thick; tough and greyish ; Jaina Devanagari characters; small, perfectly legible, uniform and beautiful hand-writing; borders ruled in three lines 30 1 This means 20+ 160 %3D180. 11 [J. L. P.]

Page #117
Jaina Literature and Philosophy [ 62. and edges in two, in red ink ; red chalk used; foll. numbered in the right-hand margin ; fol. 14 blank ; yellow pigment used while inaking corrections; the left-hand corners of three foll. gone ; condition on the whole good; complete. Age.- Pretty old. Begins.- fol. by 011 A dag sidig l S ACF FUT FA: 11 H igiene har etc. as in No. 61. Ends. - fol. 56 Tental 'lag' etc. upto 7a CRT 31 EHITET (). ?S HT. as in No. 61. Then we have : iti ilARSirAsa saMpUrNa jAtaM N. B. - For further particulars see No. 61. 10 15 uttamakumAracarita Uttamakumaracarita 1185. No. 63 1886-92. Size.-- 8} in. by 48 in. Extent.-- 36 folios ; 17 lines to a page ; 32 letters to a line. Description.- Country paper somewhat thick, rough and white; Jaina Devanagari characters; sufficiently big, quite legible, uniform and very good hand-writing ; borders ruled in two lines and edges in one, in red ink ; red chalk profusely used; foll. numbered in the right-hand margin ; fol. ra blank; condition very good ; complete; 3 adhikaras ; 42 dhalas in all; gathas 848 ; extent 1260 Slokas; composed in Samvat 1752 in Patanapura. Age.-- Old. Author.-- Vinayacandra, pupil of Jnanatilaka, a descendent of Samayasundara Gani. His additional Gujarati works are as under : (1) TITOIT Strat poni V. S. 1755 (2) straigatia V. S. ? (3) ATUTTEITIE V. S. ? ( 4 ) agatartana V. S. 1755. 30

Page #118
10 63.] The Svetambara Narratives 83 Subject.-- Biography of Uttamakumara in Gujarati in verse. It begins with the description of the prowess of 'om'. This work is based upon Carucandra's Uttamakumara. caritra as stated here, Begins.- fol. 1 // 60 // zrIsarasvatyai nmH| 'OM' akSara atula bala / cidAnaMda cidrUpa / sakala tattva saMpeSatAM / avicala akala anUpa // 1 ajara amara avikAra nita / yo(jyo )ti taNau je ThAma | sattvarUpa sA(A)rAhiye / vaMchita pUraNa kAma / / 2 jehane nAmasmaraNathI / phITe sagalA phNd| maMdamatI paMDita huvai / dUri Tale duSadaMda // 3 etc. Ends.- iol. 36. saMvata satara hai bAvane ( 1752 ) re / zrI pATaNapura' mAhi / phAguNa sudi pAMcami dine re / guruvAre ucchAhi // 14 sa / / DhAla bayAlIsa ati bhalI re / nava nava rAgapradhAna / S aThatAlIsa ne AThase ( 848) re | gAthAno cha mAna // 15 // eha carita suNatAM sadA re / vAdhai mahIyala mAma / / suSa saMpati bahu pAMmIya re / anukrami mana vizrAma / / 16 su / / DhAla cavadamI mana gamI re / sahu lI(rI? )jhyA ThAma ThAma / jJAnatilaka guru sAMnidhai re / vinayacaMdra kahai Ama / / 17 su // 20 iti zrIvinayacaMdraviracite / sarasakhacite / saJcAturyasau( zauryadhairyagAMbhIryAdiguNagaNAmaH / zrIman mahArAjakumAracaritre jina pUjAracana / preSTiprayogidApitamAlAkAriNI puSpanalikA sthalasarpadarzana / gaNikAnirmita / viSApaharaNa / krIDAmukakaraNa / bhoggartharAtrI puruSIbhavana / paTahoda. ghoSaNasya zani / sahasralocanApariNayana / nrvrmdttraajypraapnn| bhramaraketu- 25 milana | svabhAvaparAjitasakalabairamathana / mahAsenapradattarAjyAMgIkaraNa / haThAt vIrasenarAjyagrahaNA pitA(trA) dattarAjyAdi rAjyacatuSTayanirvAhaNa / samayAmRtamUrisamAgamana / sUvamevazravaNAdavAtha caaritrsuutrnn| 'nirvANapadaprAptisamApta( 2 )no' nAma cAturyavaryaturyAgrajo(5)dhikAraH // 3 sarva DAla 42 sarva gAthA 848 // graMthamAna saMkhyA 1260 / / zrIbhavatu dine dine // // anopacaMdarI chai copI // 30 1 Is Maharajakumara another name of Uttamakumara?

Page #119
84 Jaina Literature and Philosophy [ 63. Reference. For additional Mss. see Jaina Gurjara Kavio ( Vol. II, pp. 423-424 ) and for extracts see my introduction (pp. 18-19) to Anekartharatnamanjusa and Jaina Gurjara Kavio ( Vol. III, Pt. II, pp. 1371-1373' ). 10 uttamakumAracarita Uttamakumaracarita No. 64 1586. 1891-95. Size.--101 in. by 4 in. Extent.- 43 folios; 13 lines to a page; 34 letters to a line. Description. Country paper somewhat thick, tough and white; Jaipa Devanagari characters ; big, perfectly legible, uniform and beautiful hand-writing ; borders ruled in two lines and edges in one, in red ink; numbers for verses, their dandas, last four lines etc., written in red ink; foll. numbered in the right-hand margin; fol. sa blank; yellow pigment used while making corrections ; bits of white paper pasted to a few foll.; condition on the whole good ; complete ; the entire work is divided into three adhikaras ; the extent of each of them is as under :Adhikara I foll. it to fol. 166 II , 166 , ,, 292 III , 298 ,, ,, 436. Total extent 1260 slokas. Age.- Samvat 1767. Begins. fol. Id 1 s TUTETIT FA: * T 2107 ay etc. as in No. 63. Ends. fol. 436 faa hats etc, up to faagi SIA 18C01 as in No. 63. This is followed by the lines as under:-- iti zrIvinayacaMdraviracite / sarasa DhAla pavate sacAturyadhairyasau(zauryagAMbhIryAdiguNagaNAmatre shriimhaaraajkumaarcritre| 'niravANapadaptAptisama1 Additional Mus. are noted on this page. Here it is said that Maharajakumara-caritra is a misnomer. Is it so? 20

Page #120
65.] The Svetambara Narratives __ rthatoM' nAma tRtIyAdhikAra // 3 // graMyamAna 1260 // saMvat 1767 varSe Asu. padi 7 some zrI jesalamera mahAdurage liSataM paM0 harSavilAsa // shriiH|| N. B.- For additional information see No. 63. uttamacaritra UttamacaritrakumArakathA kumarakatha s 244. No. 65 A. 1882-83. Size.- 10 in. by 4t in. Extent.- 7 folios ; 17 lines to a page ; 49 letters to a line. Description.- Country paper thin, rough and white ; Jaina Deva- 10 nagari characters%3; sufficiently big, quite legible, fairly uniform and very good hand-writing ; borders ruled in three lines in red ink; numbers for verses, their dandas and the last but one line written in red ink; foll. numbered in the right-hand margin ; there is some space kept blank in the IS centre of the numbered and the unnumbered sides as well; edges of some of the foll. slightly gone ; some foll. partly worm-eaten ; condition on the whole tolerably good; complete. Age.- Samvat I533. 20 Author.- Jinakirti, pupil of Somasundara. Subject.-- A narrative of Uttamakumara showing the merit accru ing by giving vastra ( garment ) to a Jaina monk. Begins.- fol. I || 10 // bhaktyA vastrANi zuddhAni / dadAno dhrmcaarinnaaN| 25 jano'dbhutazriyAM pAtraM / syAduttamacaritravat // 1 tathAhi // 'bANArasyAM' makaradhvajo rAjA / lakSmIvatI rAjJI / putra uttamacaritraH / yathArthanAmA zaizavAdapi dayAluH / satyavAdI / nyAyavAn / tRNamAtramapyadattaM parakIyaM na gRhnA(hvA)ti sma / etc. Ends.-- fol. 7 anaMgasenayA ca pUrvabhave kAcit sakhI atya 'dbhutazRMgArA aho 30 gaNipheyaM // iti hasitA // tatkarmaNA'so gaNikA jaataa| iti zrutvA rAjAdayo vairAgyamApannAH // sutAya rAjyaM dattvA / svayaM pravrajyAM jagRhaH /

Page #121
S 10 15 20 25 30 86 Jaina Literature and Philosophy [ 65. tapastaptvA devA abhUvan / 'mahAvidehe' mukti yAsyati / / iti zrI uttamacaritra - kumArakathAH saMpUrNAH likhitAH saMvat 1533 varSe mAghavadi 7 dine paM0vijayaharSagaNinA'cirA' grAme // zrIH // uttamacaritra kumArakathA No. 66 // zrImat 'tapA' gaNeza zrI somasuMdarasaguroH / jinakIrttirinAmA ziSyazcakre kathAmimAM // 1 // cha // The last verse seems to differ in hand-writing. // cha // Age.- Samvat 1685. Author. - Not mentioned. Size.- 10++ in. by 4 in. Extent.-- to folios; 13 lines to a page ; 43 letters to a line. Description.-- Country paper somewhat thick, rough and white ; Jaina Devanagari characters; big, quite legible; uniform and beautiful hand-writing; borders ruled in three lines in red ink; foll. numbered in the right-hand margin; there is some space kept blank in the centre of the numbered and unnumbered sides as well; a portion of the first line, dandas and the last two lines written in red ink; complete; condition very good. Uttamnacaritra - kumarakatha 1318. 1891-95. Subject.- Life of Uttamacaritra. Begins. fol. 1* 960 // paMDitazrI siMdhavijayaga. gurubhyo namaH // bhaktyA vastrANi etc. as in No. 65. Ends.-- fol. 10 ana ( naM) gasenayA tyaM ca atha kevalI / iti zrutvA etc. up to sukiM yAsyati practically as in No. 65. Then we have : iti vastradAne pUrvabhavamAryA / vastrapAtradAnAnumodanayA mdaalsaayaaH| bho bhAgyarUpaguNalakSaNasaMpUrNA imAstavAtrApi priyAzvatabho (sro) jAtA // iti zrIuttamakumAra rAjAkathAnakaM saMpUrNamiti // saMvata 1685varSe zrAvaNadi 2khau || paM0 zrI siMghavijayagaNitadbhAtrA gaNizivavijayenAlekhiH // zrI 'rAnera' baMdire || svayameva paThanakRte // zrIrastuH // N. B. -- For additional Mss. see Jinaratnakosa ( Vol. I, p. 42 ).

Page #122
68. ] The Svetambara Narratives 10 37HEITS UttamacaritrakumArakathA kumarakatha 1294. No. 67 1887-91. Size.-- 104 in. by 4i in. Extent. - s folios ; 16 lines to a page ; 55 letters to a line. Description.- Country paper thin, rough and white; Jaina Deva nagari characters with occasional Traia ; sufficiently big, quite legible, uniform and very good hand-writing ; borders ruled in three lines in red ink; red chalk used; foll, numbered in the right-hand margin ; condition very good; yellow pigment used while making corrections ; complete. Age.-- Pretty old. Author.-- Is he Carucandra, pupil of Bhaktilabha as stated in Jinaratnakosa ( Vol. I, p. 42 )? Subject. - Life of Uttamacaritra. Begins.-- fol. I* | 6011 HEFFETT TETTON etc. as in No. 65. Ends.-- fol. 56 3(31)EU = etc. up to gli orari This is followed by the line as under:-- gia aachs 137AEITET I ........" Reference. - Uttamakumaracaritra by Carucandra is published by Hiralal Hamsaraj in A. D. 1908. For its additional Mss. see Jinaratnakosa ( Vol. I, p. 42 ). 15 25 uttamacaritra UttamacaritrakumArakathA kumarakatha 243. No. 68 A. 1882-83. Size.- 104 in. by 44 in. Extent. -- 6 folios ; 17 lines to a page ; 48 letters to a line. 30 1 Letters are made illegible by applying yellow pigment,

Page #123
5 15 10 Age.- Samvat 1556. Begins. fol. 1 888 20 Jaina Literature and Philosophy [ 68. Description. Country paper thin, rough and white; Jaina Devanagari characters with rare ; small, quite legible, uniform and very good hand-writing; borders ruled in three lines in red ink; red chalk used; foll. numbered in the right-hand margin; yellow pigment used while making corrections; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; edges of a few foll. partly gone; condition on the whole good; complete. 25 you a ete, as in No. 67. anaMgasenAyA etc. up to 'mahAvidehe' muktiH (kti) yAsyati // as in No. 67. This is followed by the lines as under :iti vastradAne uttamacaritrarAjakathA // cha // saM0 1556 varSe A0 zu0 6 ravivAre || ... N. B. For additional information see No. 67. Ends. -- fol. 6 udAinRpacaritra No. 69 Size. 9 in. by 41 in. Extent. 3 folios; 18 to 19 lines to a page; 36 letters to a line. Description. Country paper thin and greyish; Devanagari characters; small, clear and fair hand-writing; borders ruled in two lines and edges in one, in red ink; foll. numbered in both the margins as usual; strips of paper pasted to foll. 1 and 1; edges of all the three foll. slightly damaged; condition very fair; white paste used; complete. Author. Rsi Jayamala. Is he pupil of Saktiranga? If so, he has composed samyaktvakaumudIcatuSpadI in V. S. 1652. 30 Age. Samvat 1823. [ Subject.-Life of king Udai in Gujarati in verse based upon Vivahapannatti popularly known as Bhagavatisutra', a Jaina agama. The entire work is composed in verse in Gujarati. 1 Letters are made illegible by applying yellow pigment, Udainrpacaritra 1549. 1891-95.

Page #124
70.] The Svetambara Narratives 89 89 Begins.-- fol. 10 dUhAM / 'caMpA nagara padhArIyA / bhagavaMta zrImahAvIra / moTA jiNasAsaNadhaNI / suravIra ne dhIra 1 // udAI rAjA bhaNI / kiNa vidha dIdhI dIpa / ekamanA thai sAMbhalo / citta rASI jyoM ThIka / 2 // etc. Ends.-- fol. 30 e caritta kIyo udAIno / sUtra bhagavatI joyo re / ucha Dadhakai RSa jaimala khai| 'micchA me dukkaDu' moyo re| dhana dhana vIra jiNadajI // 12 / / iti zrIudAIcarita saMpurNa / / saMmata 1823 varSe likhitaM ratana ArajyA mAhUkai / 10 20 upadhAnasandhi Upadhanasandhi (uvahANasandhi) ( Uvahanasundhi) 127 (9). No 70 1872-73. Extent.- fol. 7h to fol. 80. Description.- Complete ; 25 verses in all. For other details see Upadesaratnamala ( Vol. XVIII, pt. 1, No. 264 ). Author.-- Pupil of Jayasekhara Suri. Subject.- A Prakrit poem dealing with upadhana a Jaina ritual. Begins.-- fol. 7" // 50 'phalavidhi 'mahaNaduriyavihaMDaNa pAsajiNaMdaha namAva kro| jiNadhammapahANaha tabauvahANaha / saMdhi saNu jaNa! kanna dharo // 1 // etc. Ends.--- fol. 8 itha taba uvahANaha saMdhipahANaha jayaseharamarisasakiyA / je paDai paDhAvada ani mANi bhAvai / te pAvai suha paramapayA // 25 iti upadhAnasaMdhi // cha / - 12 [J. L.P.

Page #125
90 Jaina Literature and Philosophy [ 71. 644. upamitibhavaprapaJcAkathA Upanitibhavaprapancakatha No. 71 1892-95. Size. - 10 in. by 4 in. Extent.- 326+1=327 sclios; 6 lines to a page; 43. letters to a line. Description.- Country paper tough and white; Jaina Deva nagari characters; small, legible and good hand-writing ; borders ruled in two lines and edges in one, in red ink; numbers for foll. entered tw ce as usual ; foll. 19 and 3260 IO blank; edges of some foll. eg. those of the 6th slightly worn out; condition on the whole good; some lacunae on foll. 2868 and 286"; yellow pigment used; fol. 164 repeated; complete; composed in Samvat 962 in Bhinna. mala ; the entire work is divided into 8 prastavas as under :Prastava I fol. 10 to fol. 42a II 428. , 550 III , Sib >> >> 1244 IV * 12;? ,, ,, 1962 V 1964 , VI 2295 >> >> 254 VII 254 2860 VIII 2866., ,, 326*. The total extent is 16,000 slokas. 25 Age.- Samvat 1475. Author.- Siddha Rsi, pupil of Durgasvamin, pupil of Della Mahattara. Garga Rsi was the diksa-guru of Siddha Rsi and that of Durgasvamin. Siddha Rsi is said to be the author of fariTaa (V. S. 974 ) and a com. mentator of FICHAJI of Dharmadasa Gani. Subject.-- A monumental allegcrical work written in mixed prose and verse in 8 prasteras or chapters, giving a vivid description of the human life from the Jaina view-point. >> 2290 30

Page #126
71. ] I lie Sretambura Narratives ____ Begins.-- fol. 1 10 // namo nirnAzitAzeSamahAmohahimAtaye / lokAlokAmalA(lA)lokabhAsvate paramAtmane // 1 // namo vizuddhaghAya svarUpaparipUrtaye / namo vikAravistAragocarAtItamUnaye // 2 // etc. - fol. 42* ityupamitibhavaprapaMcAyAM kathAyAM 'pIThabaMdho'nAma prathamaH prastAvaH // 1 // cha / - fol. 550 ityupa saMsArijIvacarite 'tiryaggativaktavyatAvarNano' nAma dvitIyo(yaH) prastAvaH // 2 // cha / - fol. 124* ityupa krodhahiMsAsparzanedriyavipAkavarNanastRtIyaH prastAvaH / .0 - fol. 1964 ityupa mAnamRSAvAdarasanedriyavipAkavarNanazcaturthaH prastAvaH / - lol. 229deg ityupa mAyAsteya ghrANeMdriyavipAkavarNano nAma paMcamaH prastAvaH / - fol. 254' ityupa. lobhamaithunacakSuriMdriyavipAkavarNanaH SaSThaH prastAvaH smaaptH| - fol. 286deg ityupa. mahAmohaparigrahazravaNeMdriyavipAkavarNano nAma saptamaH ths prstaavH| Ends. - fol. 324deg sulIlatAyAH prAMta bodhakAraNaM saMpannaH / tathA bhavAdbhirapi tathaiva sa vidheyo yena saMpadyate bhavatAmapi viziSTastattvAvabodha iti / iha ca / zra(zre)yAMsabrahmadattAdijAtismaraNatulyakaH / jJeyo'nusuMdarAdInAM tadutpAdaH mayuktikaH // yatazcAgame mtivaasnaayaaH|| asaMkhya kAlo'nujJAto vaco nAsti - ca vaark| subharibhavabhAve (5)pi tasmAnnAsti virodhitA / AditaH punarArabhya prastAvabhAvArtho'yaMkuzala karmavipAkavazAdaho jagati kicidihAsti na durlabhaM / sakalabhogasukhAdhikamuca ke(:) zamasukhaM pratibhAti ca dhImatAM / / 1 / / paramakoTigato'pi punarnira prabalatAmupagamya nipaasyte| khalamaleratibhImabhavodadhI yadi na vetti satAM tadarAtitAM // 2 // narakayogyakRtAzubhakarmakaH punarupaiti zivaM gtklaapH| yadi sadAgamabodhaparAyaNaH kSaNamapi prakaroti zubhaM nrH||3||

Page #127
92 Jaina Literature and Philosophy idamavetya manomalavarjana laghu vidhAya sadAgamasevanaM / kuruta tena hi yAtha zivaM yathA gamazAdanusuMdarapArthivaH // 4 / anyacca // idamanaMtabhavabhramasUcakaM malavazAdanusuMdaraceSTitaM / yadiha jAtamataH parakIrtita mativikAzanakAri sudehinAM // 5 na ca niyogata eva bhavediyaM gaditapaddhatiratra nare nare / sakRdavApya jineMdramataM yataH zivamitaH pragatAH bahavo nraaH| 6 fol. 325 tricatureSu bhaveSu tathA pare bahutamAH punrnyvidhaantH| vividhamanyatayA bhavadAraNaM nijanijakramato dadhire narAH / / 7 / tadidamatra suguhyamaho janA! hRdi vidhatta paraM paramAkSaraM / malavizodhanameva sumedhasA laghu vidheyamihApya jinAgamaM // 8 // etAnniHzeSamatra prakaTitamakhileyuktigabhaicobhiH / prastAve bhAvasAraM tadakhilamadhunA zuddhabuddhyA vicitya / bho bhavyA! bhAti citte yadi hitamanaghaM cedmuccstraaNv| tat tUrNa me'nurodhAd viditaphalamalaM svArthasiddhyai kurudhvaM // 9 // utsUtrameva racitaM matimAMdyabhAjA kiMcid dyadIdRzi mayA(s)va kathAnibaMdhe / saMsArasAgaramanena tarItukAmai___ statsAdhubhiH kRtakRpemayi zodhanIyaM // 10 // ityupamitibhavaprapaMcAyAM kathAyAM pUrvasUcitamIlakavarNano nAmASTamaH prastAvaH samAptaH / cha / / samApteyamupamitibhavaprapaMcAkatheti // 3 // yotitAkhilabhAvArthaH sdbhvyaanjprbodhkH| sUrAcAryo(5)bhavad dIpa(ptaH) sAkSAdiva divAkaraH / 1 // 38 * indicates that thia 1 In the Ms. we have 'gardiyata'. The dot on ya' is to be dropped.

Page #128
7t.] The Svetambara Narratives sa 'nivRtti kulodbhato 'lATa 'dezavibhUSaNaH / AcArapaMcakoyuktaH prasiddho jagatItale // 2 // abhUd bhUtahito dhIrastato dellmhttrH| jyotinimittazAstrajJaH prsiddhaadeshvistrH||3|| tato'bhUdullasatkIrti' brahma 'gotravibhUSaNaH / durgasvAmI mahAbhAgaH prakhyAtaH pRthivItale // 4 // pravrajyAM gRhnatA yena gRhaM saddhanapUritaM / hitvA saddharmamAhAtmyaM kriyayaiva prakAzitaM // 5 // yasya taccaritaM vIkSya shshaakkrnirmlN'| buddhAstatpratyayAdeva bhUyAMso jaMtavastadA // 6 // sahIkSAdAyakaM tasya svasya cAhaM gurUttamaM / namasyAmi mahAbhAgaM gargarSimunipugavaM // 7 // kliSTe'pi 'duHSamA'kAle yaH puurvmunicryyaa| vijahAreha niHsaMgo durgasvAmI dharAtale // 8 // saddezanAMzubhiloMke dyotitvA bhAskaropamaH / zrI bhillamAle' yo dhIro gato'staM sadvidhAnataH // 9 // tasmAdatulopazamaH siddharSirabhUdanAvilamanaskaH / parahitaniratakamatiH siddhAMtanidhirmahAbhAgaH / / 10 // viSamabhavagartanipatitajaMtuzatAlaMcadAnadulitaH / dalitAkhiladoSakulo(5)pi satatakaruNAparItamanAH // 11 // yassaMgrahakaraNarataH sadupagrahaniratabuddhiranavarataM / AtmanyatulaguNagaNairgaNadharabuddhi vidhApayati / / 12 / / bahuSidhamapi yasya mano nirIkSya kuNdeduvishdmdytnaaH| manyate vimala dhiyaH susAdhugaNavarmakaM satyaM / / 13 / / upamitibhavaprapaMcAkatheti tacaraNareNu kalpena / gIrdevatayA vihitA(5)bhihitA siddhAbhidhAnena // 14 // athvaa| AcAryaharibhadro me dhammabodhakaro guruH|| prastAve bhAvato haMta sa evAye niveditaH // 15 // viSaM vinirdhaya kuzAsanAmayaM vyacIcarada yakRpayA madAzaye / aciMtyavIryeNa suvAsanAsudhAM / namo'stu tasmai haribhadrasUraye // 16 // mmam 1 Verses 10-13 seem to be interpolated unless they refer to Sadda Rai instead of Siddha Rsi, the author.

Page #129
Jaina Literature and Philosophy [71. anAgataM parijJAya caityavaMdanasaMzrayA / madartheva kRtA yena vRttilalitavistarA / / 17 / yatrAtularathayAtrAdhikamidamiti landhavarajayapAtakaM / nikhila surabhavanamadhye satataM pramadaM jineMdragRham // 18 yatrArthaSTaMkazAlAyAM 'devaH saddharmadhAmasu / kAmo lIlAvatIloke sadA(55)ste triguNo mudA // 19 // tatreyaM tena kathA kavinA niHzeSaguNagaNAdhAre / zrI bhillamAla'nagare gaditA(7)nimamaMDapasthena / / 20 // prathamAdarza likhatA sAdhyA shrutdevtaanukaarinnyaa| durgasvAmigurUNAM zidhikayeyaM gaNAbhidhayA // 21 // saMvatsarazatanavake dviSaSTi (962)sahite'tilaMdhite caasyaaH| jyeSTha(Te) sitapaMcamyAM punarvasau gurudine samAptirabhUt // 22 graMthAgramasyA vijJAya kIrtayati manISiNaH / anuSTubhAM sahasrANi prAyasa (zaH) sati(nti) poDhaza // 23 sarvagrathAgraMtha SoDaza sahasrANi // 16000 zrIrastu kalyANamastu // chaH zrIsiddhArthakulAMbujAruNasamaH zrIvallidhArAdharo yo jJAnAmRtacaMdramA suranarAlaMkAracUDAmaNiH / saMsArArNavasAraseturaniza saumyazriyAmAlayaM / so(s)yaM vIrajinezvaro ... ratAta siddhayaSTakaM vA mudA // 1 / zrI zrImAla vizAlavaMzagaganapradyotanastejasA / __ maMtrIzo haripAla Rddhinicayo dAnena kalpadrumaH / dhairyotpAna(ta)payodharaH kSititale yaH zuddhabuddhyaMbudhe / sIsAsomasamaH sadaiva sutarAM so(s)yaM vibhAti sphuTaM // 2 // zrImadvikramatoddhi (?'bdhi bANajaladhIMdu(1454)nAmni saMvatsare / saMprApyAdbhutasAMga(? gha)patyapadavIM zrI 'puMDarIkA'cale / samye 'vaitake' ca yena nijakaM cittaM kRtArthIkRtaM / vikhyAto haripAlasaMghanRpatiH so'bhUt sadaudAryavAn // 3 // tasyA nUnasvazIlalolakalitA dAnAtikalpopamA / ___ hImAdevyabhidhAnA(na)to(5)jani janI saubhAgyabhAgyakabhUH / tatputro(5)styadhunA kalatratanayairyuko(5)nizaM kovidai W: 'saMdhapatI'tilabdhabirudaH sahevadatto mudA // 4 // sUlhI'... makUcAkU putryastisrastayozca saMjAtAH / laghnI bhaginI camakUH saMghAdhipadevadattasya / 5 / 1 In Peterson' and Jacobi's edition we have 'dharmaH saddevadhAmasa'. ? Letters are missing in this Ms. 3 A letter or so is missing in this Ms. 35

Page #130
71.] The Svetambara Narratives audAryadhairyagAMbhIrya satyazIlasamanvitA / rarAja camakU pItvA (gurUNAM vacanAmRtaM // 6 // upamitibhavaprapaMcAgraMthaM bhavabhayatamodinAdhIzaM / iSuta (tu) raMgavArdhicaMdre (1475 ) varSe harSeNa leSayAmAsa // 7 // tat pustakaM zamarasAmRtasatra yeha | Reference. zrIjainadharmaparibha (1) vitazuddhacittA / suzrAtrikA hi camakUrnijapuNyapuSTayai / yAva' meru' sthirosa raMge khalu khelate / tAvannikhilati graMthaivacyamAno'stu pustakaH // 9 // iti zrIupamiti bhavaprapaMcAgraMthasya prazastiH // cha // zrI etc. zrIdharmazekharaguroH pradadau prato (? mo ) dAt // 8 // 95 Edited in A. D. 1899-A. D. 1914 by P. Peterson & H. Jacobi in "The Bibliotheca Indica Series with a preface, an alphabetical list of words, contents of all the eight chapters in English, index of proper names, allegorical 15 persons etc., and translation of Siddharsiprabandha (Prabhavaka-carita, 14th canto) added as an appendix; also published in "D. L. J. P. F. Series" in two parts in A. D. 1918 and A. D. 1920 respectively. S 10 There is an article on Siddharsi written by Dr. N. 20 Mironow and published in "Bulletin de l'Academie Imperiale des Sciences de St. Petersburg ", 1911. For quotations see Peterson Report III (p. 167). The German translation (Bks. I-III) by W. Kirfel is published in "Indische Erzahler " (Vol. X) in A. D. 25 1924 from Leipzig. The Gujarati translation of this splendid work by Motichand G. Kapadia is published by the Jaina Dharma Frasaraka Sabha, Bhavanagar in three parts in A. D. 192', 1924 and 1926 respectively. This Sabha has 30 published a Gujarati work named as Siddharsi and prepared by Motichand G. Kapadiain in A. D. 1933. It is important for studying and appreciating this Upamitibha zaprapancakatha. 1 In their edition (p. 1238) here is a slip for the third foot (line 11) is 35 wanting in one syllable which is wrongly attached to the 4th.

Page #131
S 10 20 96 25 Jaina Literature and Philosophy [ 71. Some of the words etc. occurring in this work are met with in Naisadhacarita. They may be indicated as under : Upamitibhavaprapancakatha Naisadhacarita XVII, 50 P. SI P. 547 XVII, 39 P. 374 XX, 145 P. 196 IV, p. 887 VI, 75 sambhAlayati ( hears ) For additional Mss. see Nos. 72-74, B. B. R. A. S. (Vols. III-IV, p. 433) and Jinaratnakosa (Vol. I, p. 54). upamitibhavaprapaJcAkathA No. 72 Size.9 in. by 41 in. 15 Extent. 495-1=494 folios; 13 lines to a page; 42 letters to a line. airfas tridaNDa gresant murmura Begins. - fol 1 namo bhAgavatyai vAce // Description. Country paper tough and white; Jaina Devanagari characters with gas; big, bold, clear and good hand-writing; borders ruled in four lines in black ink; red chalk and yellow pigment used; foll. numbered as usual; fol. 1 blank except that the table of contents to some extent written on it; edges of the first fol. slightly worn out; fol. 47 also numbered as 48; so the following numbered as 49, 50 etc.; condition very fair; this Ms. does not contain the colophon; 7 prastivas complete; the 8th partly incomplete. Age. Not modern. 105 Upamitibhavapra pancakatha 68. 1898-99. at faaitars etc. as in No. 71. 30 Ends. - 495 sulalitAyAH pratibodhakAraNaM saMpannaH etc. up to sahadavApya jineMdramataM yataH zivamitaH pragatA bahavo narA: ( 6 ) tricatureSu only as in No. 71. N. B. For further particulars see No. 71,

Page #132
73.1 The Svetambara Narratives 97 upamitibhavaprapaJcAkathA Upamitibhavaprapancakatha 7(a). No. 73 1880-81. Size - 309 in. by 23 in. Extent.-- 178 leaves; 5 to 7 lines to a leaf ; 122 10 137 letterss to a line. Description. - Palm-leaf ; Jaina Devanagari characters with CTATTIS ; bold, big, legible and elegant hand-writing; leaves band 28 written in five columns but the line begun in one goes to the 2nd, 3rd, etc. till it gets 10 complete ; i. e. to say the columns are not independent; leaves 26 etc. divided into 3 columns only; every column has its borders ruled in few lines in black ink ; space between the first and the second is equal in extent to that between the fourth and the fifth ; each of these is more 15 than double that between the 2nd and the 3rd or that between the 3rd and the 4th, which is equal to the former ; in every leaf there are two holes for stringing up the difterent leaves ; edges of many leaves slightly worn out; several leaves worm-eaten ; numbers for leaves 20 entered twice: in the right-hand margin as 1, 2 etc. and in the leit-hand margin as ta, fa, , ut mostly as in the Ms. of 319rFTIO ( Vol. XVII, pt. 1, No. 9 ); red chalk used ; leaves 416, 42deg, 836 and 84' more or less blotted out; leaves 42-47 & 95-101 more or less torn; 25 edges of leaves 59, 89 & 90 badly damaged ; a strip of paper pasted to leaf 64; half of the 119th leaf work out; a quarter of the 169th leaf gone ; condition tolerably fair; incomplete; the next Ms. (No. 74 ) forms its counterpart. Age. -- Fairly old. Begins.- leaf 16 ll & Oll AA: TT II A: PRAIAN 11 8 FA: shrutdevtaaye| FAT CATALIETTAIETTAETHEIATTu etc. as in No. 71. Ends.- leaf 1786 tato(5)so vAMtisaMmizraM tatpura sthitabhojanaM / nirlajja bhoktamArabdhaH sarveSAmapi pazyatAM // 13 [J.L.P.) 30

Page #133
98 Jaina Literature and Philosophy [ 73. taM dRSTA samayajJena proktaM mUkurvatA bhRzaM / deva! deva! na yuktaM te kartuM kAkasya ceSTitaM / / mA ca rAjyaM zarIraM ca yazazva zazinirmalaM / deva! hAraya bhaktena tvAmekadinabhAvanA // anyacceda satAM niMdyamamedhyaM zaucadUSaNaM / GENET (? ) ; for continuation see the next Ms. N. B.- For additional information see No. 71. 10 IS upamitibhavaprapaJcAkathA Upamitibhavaprapancakatha No. 74 7(b). 1880-81. Size. - 30 in. by 21 in. Extent. -- leaf 1792 to leaf 3596 i. e. 181 leaves + 1 - 1 = 181 leaves ; 4 to 7 lines 10 a leaf; 1 20 to 330 letters to a line. Description.- Palm-lcaf; Jaina Devanagari characters; big, bold, legible and elegant hand-writing; this Ms. written in three interdependent columns; thc first line of the first column continues in the 2nd and the 3rd as well ; so the columns are only for show; each column has its borders ruled in four lines in black ink; red chalk used; this work commences with leaf 1998 and is thus a counterpart of the preceding Ms. No. 73 ; numbers for leaves entered twice as in its former part; the third column of leaves 180-186, 215-217 & 226-227 more or less worn out; a part of the first column of leaf 198 gone; in every leaf there are two holes on the whole, once between each of the two columns; leaf 272 repeated; the repeated leaf 272 written on a piece of white paper : its edges worn out; some of the leaves worm-eaten ; half of the 3rd column of leaves 289 & 291-293 gone ; a strip of paper pasted to leaves 290, 294, 2976 & 3286; leaves 296 & 298 torn in several places; the first column of leaves 317-318 badly damaged ; leaves 319 & 320 have their first column dislodged from others ; leaves 336 & 348 damaged throughout; the first half of leaves 342 & 343 worn out; the last column of leaves 319 & 350 practically

Page #134
74.] The Svetambaru Narratives 99 5 10 gone; only a very small part of leaf 352 preserved ; four leaves following leaf 353 have their numbered portion worn out on both the sides ; leaf 358 seems to be lacking unless it is somewhere between leaves 353 and 359; the work ends abruptly: the last leaf in that case is 359. There is one more leaf with its number practically gone. It is therefore difficult to know whether it belongs to this work or not. There are three foll. written on white paper 83 (new), 118 repeated & 160 repeated, almost in a worn out condition ; some portions of leaves 66, 169 (?), 289, 291, 292, 293, 345 & 349 are preserved by wrapping them in a thick paper; it is difficult to identify them. Age. - Fairly old. Begins. - leaf 179* 'devaH khAditumarhati // deva ! duHkhAtmakaM cedaM sarvavyAdhiprakopanaM / gADhamulvaNadoSANAM vizeSeNa bhavAdRzAM / / kA cAsyopari te mUrchA yad bAhya mu(pu)dalAtmake etc. Ends.- leaf 3596 te te'kuzalamAlAyAH putrA nAsyatra saMzayaH / te bAlasadRzereva vijJeyA duSTaceSTiteH / ete(s)kuzalamAlAyAH sUnavaH supariraphuTAH / / rAjarSiruvAca // yadyevaM tarhi tasyAH ........ cinmanISicaritAzca ye| etebhyo ye pare sattyAH sarve te(5)muSya sodraaH|| ye kecicchavalAcArA sa mAmadhamanudvija // sutAH sAmAnyarupAyAste jIvA bhuvanodare / / sakAzAditarAbhyAM te ...... tye tadA pannayaduta // bhAryAtrayeNa janitaM jaghanyottamamadhyamaM / tasya karmabilAsasya jagadetat kuTuMbakaM / / sUriruvAca Arya ! naivAtra saMdehaH samyagAryeNa lakSitaM / mArgAnusAriNI tu dvi ... ... N. B.---. For additional information see No. 71. - -- 1 See the last line of " Ends " of Ms. No. 73.

Page #135
100 Jaina Literature and Philosophy [75. Is upamitibhavaprapaJcA UpamitibhavaprapancakathAsAroddhAra kathasaroddhara No. 75 554 1895-98. Size.- Iod in. by 41 in. Extent.- fol. Sid to fol. 850i.e. 35 folios ; 19 lines to a page ; 64 letters to a line. Description.- Country paper thin and greyish ; Devanagari chara cters with pRSThamAtrAs; small, clear and fair hand-writing; borders ruled in three lines in red ink; foll. numbered as usual ; since this Ms, begins with fol. 514, it must be a part of some other Ms.; red chalk used ; complete ; 8 prastavas in all; extent 5730 slokas ; composed in Samvat 1298 ; condition very good. Age.- Old. Author.- Devendra Suri, pupil of Sricandra Suri, pupil of Yasodeva Suri. Subject.-- A short summary of Upamitibhavaprapancakatha. Begins.- fol. 51 // 6 // itazcAsti prasiddhaM tad vardhamAna(nA) bhidhaM puraM / rAjahaMsakRtAvAsaM padmAsana ca padmavat / / 1 yantra praasaadshNgsthairjiibhtibhiijjotirukkle| dIpotsava ivAjalaM zarvarISu vIdhiyate // 2 etc. Ends.- fol. 85 zrutvainAmanusuMdarasya ca mahImartuH kathAmadbhutAM / mo bhavyAH ! zaraNaM jinAgamAmimaM yUyaM zraya dUdhvaM sadA / yo noccairgurukarmakA api javAdasya prasAdaM dayaM(?) nidbhyAkhilamapyanazvarasukhaM zreya zriyaM prApnutaH / / 615 / iti zrIzrIcaMdrasUriziSyazrIdeveMdrasUriviracite upamitibhavaprapaMcakathAsAroddhAre pUrvasUcitamIlava(na ekavarNano nAma aSTamaH prastAvaH samAptaH // cha / samAzrito yaH zaraNaM kSamAbhRd gaNena kAzanipAtabhItyA / avArapArazriyamAdadhAnaH sa 'caMdra'gaccho(s)sti bhuvi prasiddhaH // 1 2 .

Page #136
75.1 The Svetambara Narratives iot bhavyAraviMdapratibodhahetu rakhaMDhachatraH prtissiddhdossH| zrayannapU.dutulAmiha zrI bhadrezvaro nAma babhUva suuriH||2|| tatpadRpUrvAna(ca)lacaMDaroci rajAyata zrIharibhadrasUriH / mudaM na kasmai rahitaM vikRtyA tapazva vittaM ca tanoti yasya // 3 zrImAnathAjAyati(ta) zAntimUri(:) yataH samudrAdiva ziSya meghaaH| jJAnAmRtaM prApya zubhopadeza dRSTyA vyathuH kasya mano na zaspaM? // 4 // tato(5)tha bhRvAdayadevamari yadIyavANI guNaratnahRyA / medhAbhareMdUllasitA vibhAti veleva madhyasthAjanAgamAkhyaH / / 5 / / prasannacaMdro(7)tha babhUva mUri vaktuM guNAn yasya na hi kSamo(5)bhUt / sahasravaktro(s)pi bhujaMgarAja stato hiyaiveSa rasAtale gAt // 6 // athAjani zrImuniratnasUriH svabuddhinirdhata sureNdrsuuriH| ratna(?)ti zAstrANyakhilAni yasya sthironnate mAnasarohaNAdrau // 7 // zrIcaMdrasUriH sugurustato(5)bhUt prasannatAlaMkRtamastadoSa / vittaM ca vAkyaM ca vapuzca yasya ___kaM na pramodAt pulakaM karoti ? // 8 sUriyazodeva iti prasiddha stato'bhavad yatpadapaM (ka)jasya [kasya rajobhirAliMgitamaulayo(5)pi citraM pavitrAH praNatA bhavati / / 9 tatpANipadmollasitapratiSThaH zrIcaMdrasAraprabhuziSyalezaH / deveMdrasUriH kimapIti sAro ddhAraM cakAropamiteH kathAyAH // 10 //

Page #137
102 Jaina Literaiure and Philosophy [75. itazca ziSyo gaNadhArideva naMdasya ratnaprabhasUripaTTe / babhUva sUriH kanaka(ka)prabhAkhyo nidhirguNAnAmiha 'caMdragacche // 11 tadIyaziSyaH kila bAlacaMdra sUriH kviiNdraaduditprtisstthH| Atzo(?)tha(dha)yad bodhivizuddhaye'muM pradyumnamarivinapyA(1)paruddhaH // 12 / / yaccAnyadapyatra nivezitaM syA danyAdRzaM kiMcana buddhimAMdyAt / / ayaM nibaddhoM(5)jalirasti sarva 1." tat sAdhu nivezanIyaM // 13 zrIvikramAdityanareMdrakAlA daSTAnavatyaryama( 1298 )saMkhyavarSe / puSpArkabhakkArtika kRSNaSaSThayAM saMpUrNatAmeSa samAsasAda // 14 // yAvannauriva bhavyatAraNavidhAvAste bhavAMmonidhI zrIsiddhena kRtA kathA(s)tha mama mAhadvAkyakASTocayaiH / tAvat tadvatasatpadAnicayasyodaM bane saukSamA ___ sAroddhAra kRtiH sadA tadanugA naikaiva saMsarpatu // 15 pratyakSaraM nirUpyAraya graMthAnaM vinizcitaM / zatAni saptapaMcAzat nizatsamadhikAnyaho / 16 aMkato(5)pi zloka 5730 / / upmitibhvprpNcaakthaa| Reference.-- For additional Mss. see Jinaratnakosa ( Vol. I, p. 54 ). 26 upamitibhavaprapazcA UpamitibhavaprapancakathoddhAra kathoddhara 1107. No. 76 1887-91. Size.- 10 in. by 4: in. Extent.- 42 folios ; 15 lines to a page ; 40 letters to a line. 30 Description. --- Country paper rough and white ; Devanagari chara cters; big, clear and elegant hand-writing; borders ruled in 1 Some letters seem to be missing in the Ms.

Page #138
77.] Tlje Svetombara Narra!ives 103 two lines and edges in one, in red ink ; numbers for fell. entered twice as usual; fol. 1a blank; red chalk used; marginal notes wriiten occasionally; comple!e so far as the two adhikaras are concerned; condition tolerably good. Age.- Pretty old. Author.- Not known. Subject.-- An abridged exposition of Upamitibhavaprapa ncakatha of Siddha Rsi in prose. Begins.-- fol. 16 ||e| // zrIgauDIpArzvanAthAya nmH|| svastizrIguNarAgiNIdha yadanudhyAnAd vRNIte svayaM / prodbhatAmRtasAdhanasA iva jabAda dUraM vajanya(tyA)padaH / yasya jJAnamanantavastuviSayaM zakraizca saMstRyate / zrImAn pAvajinaH sa vaH prabhavatAd manyAbhavAtichi(cchi)de bAgAsArabhareNa yasya satataM mayAdisadbhAvanA ballayaH pallavitA bhavaMti bhavinAM svAMtAlavAlAvanau / etc. - fol. 26deg iti zrIupamita(ti)bhavaprapaMcAkathoddhAre sparzanahiMsAvaizvA. naraphalapradarzanAkhyaH prthmo(5)dhikaarH|| Ends.- fol. 42 he Aryaputra ! tvayA bahUni duHkhAnyanubhUtAni tadenaM puNyodayaM sakhAyaM sakhAyaM gRhItvedAnI yAhi mAnavAvAsapuramiti tadvacaH pratipannaM mayA hati mAnAnRtarasanAmadacaurya durodarAdisaMgotthaM zrutvA phalaM na zaktisteSu vidheyA kadApi budhaiH 1 ityupamitikathoddhAre zailarAjamRpAvAdamadyapAnAmathyAbhimAnadhanagarvagaNikAgamanayUtakrIDAkheTakavikathAsaktyAdivipAkadarzano dvitIyo ( 5 )nnikaarH||2|| zrI: etc. 15 25 RSabhajinacaritra No. 77 Rss bhajinacaritra 605 (b). 1892-95. Extent.-- fol. I4. Description.- This work is incomplete. For other details see __No. 605 (a). 30 1892-95. Author.- Not known. Subject. - Life of Lord Rsabha in verse in Gujarati.

Page #139
104 Jaina Literature and Philosophy [77. Begins.- fol. 14 e 6 0 gaga kedArau / ekatAlI. Adi dharamanI karivA e / bhIma bhabodadhi taravA e bharavA e sukRta bhaMDAra bhalI paraI e|| bhavIyaNa bhagata UparavA e| karma kaThina nirjaravA e| paravA e zivasuMdarI sayaMvaraha e bUTaka 1 sayaMvaraI za(zivarAmA varavA / karavA uttama kAja marudevI mAtAnI kUSaiM avatarIyA jinarAja etc. Ends.- fo. 140 so bhagavaMta saMta sukhakAraka Adi dharama jeNai dAyu / dAna sIla tapa bhAvana saMyama viratAvirati bhASiu / maMtra anAdi Adi ko na lahai soi pNcprmettrii| zrIyugAdidevaI va parakAsiu / jasa dhyAnaha hui tUThI / 6 / zrInavakAramatra jo mahimA Agami kahiu jiNadaI / koDi varasa sau koDi jihvAiM nAva. IS RSabhadevadhavalabandha Rsabhadevadhavalabandha (RSabhavivAhala u) ( Rsabhavivahalau ) 695. No. 78 1899-1915. Size.- 9k in. by 4g in. Extent. - 10 folios ; 13 lines to a page ; 46 letters to a line. 20 Description.- Country paper very thin and white; Devanagari characters with ANTIS ; smail, clear and good hand-writing ; borders ruled in four lines in black ink, yellow pig. ment used; red chalk too; foll. numbered as usual; fol. 10deg blank ; complete. 25 Age.- Not modern. Subject.- A Gujarati poem furnishing us with some details about Lord Rsabha. Author.- Sevaka, pupil of Gunanidhana Suri. His additional works are as under: - (1) AdinAthadevarAsa-dhavala V. S. 590. (2) ArdrakumArAvidhAhala u. (3) neminAthanA candrAulA. (4) sImandharasvAmIzobhAtaraMga.

Page #140
79.] Begins. fol. ra // 60 // The Svetambara Narratives zAsanadevIya pAya praNamevIya majha mani yaha kta ( u ) mAhalau e / Ends. fol. roa mAta sarasati taNai sahIya supasAulai / gAisiuM RSabhavIvAhalau e / etc. RSikathAnaka ( isikahANIya ) No. 79 i (ma zrI ) mA (nA) bhina (naM )dana duritapa (paM) DaNa jagatramaMDaNa jina(a) ro | maha guru taNo susAi pAmI gAIA jagahitakaro yaha dhavala gAi jina ArAhai jeha naranArI sadA te sugati jAi sukhI thAi bolai sevaka ima mudA / 12/245 / iti zrIriSabhadeva dhavalabaMdha | Reference. For extracts and additional Mss. see Jaina Gurjara Kavio ( Vol. III, Pt. I, pp. 582-584 ) - Age.- Pretty old. Author.-- Not mentioned. 14 [J. L. P. 105 S Size-- 9++ in. by 4g in. Extent. - 3 folios ; 15 lines to a page ; 50 letters to a line. Description.-- Country paper thin, tough and white; Jaina Deva - 20 nagari characters with occasional garars; small, quite legible, uniform and beautiful hand - writing; borders ruled in two pairs of lines in black ink ; red chalk used; foll. numbered in the right-hand margin; in the centre of the numbered and unnumbered sides as well, there is some 25 space kept blank so that it forms a design; a strip of white paper pasted to fol. 2a and one to fol. 3b; edges of each and every fol. more or less gone; condition on the whole tolerably good; complete ; this work ends on fol. 24 ; this Ms. contains an additional work viz. vidyAdharAcAryadRSTAnta 30 commencing on fol 2a and ending on fol. 3. Io Rsikathanaka ( Isikahanaya ) 15 1663 1891-95.

Page #141
106 Jaina Literature and Philosophy [79. Subject.- Narrative of Damasara. Begins.- fol. ! e60|| koheNa ya hAraviyaM / uppajjataM ca kevalaM nANaM / damasAreNa ya risaNA ubasamajutteNa puNa laddhaM / / 1 ko bhayacaM ! du(da)masAro ? keNa heUNA kevalaM nANaM / uppajjataM hAriviyaM / vIro bhaNeha(i) nisuNaha goyamA ! kahANayaM // 2 // etc. Ends.-- fol. 24 devehiM kayA mahimA mahIale bhanyajIvANaM paMbohei / sArasavAsAi kevalapariyAyaM pAuNittA saMlehaNaM karittA khiddhiM go|| iti krodhopari damasAraRSikathAnakaM samAptaM / cha / / 8. RSidattakathA Rsidatta katha (isidattakahA) ( Isidatta kaha ) No. 80 1880-81. Size.- 13} in. by in in. 15 Extent.- 154 leaves ; 3 to 4 lines to a leaf; 4; to so letters to a line. Description.- Palm-leaf somewhat thick and durable; Jaina Devanagari characters with a flats; big, quite legible, uniform and beautiful hand-writing ; this Ms. presents an appearance of the work as written in two separate columns but really it is not so since the line of the ist column is continued in the 2nd column; borders of each of the columns ruled in three lines in black ink; leaves numbered in both the margins: in the right-hand margin as 1,2,3 etc. and in the left-hand mostly as in the case of other palm-leaf ( Jaina ) Mss.; red chalk used ; there is a hole in the space between the two columns; leaf 1 blank; it is preceded by an extra blank leaf ; the last leaf is followed by an extra blank leaf ; incomplete ; this work seems to be divided into 6 parvans at least. Age.- Fairly old. Author.- Virabhadra (?) Subject. -- Biography of Rsidatta.

Page #142
81.] Begins. -- leaf 1 60 // Ends. - leat 154 The Svetambara Narratives namiUNa calaNajuyalaM paDhamajiNiMdassa bhuvaNanAhassa avasappiNI dhammo payAsio jeNa iha paDhamaM // bAlattaNami jeNaM 'sumeru 'sihare (7) bhiseyakAlaMmi / vAmacalaNaMgulIe / lIlAe / DoliyA puhai || taM varakamaladalacchaM jiNacaMdaM mattapIlugaigamaNaM / namiUNa mahAvIraM suragaNasayasaMdhuyaM vIraM // sese vigha vA (bA) bIse namiUNaM bhaTTarAgamayamohe | suramayAsuramahie jIvAipayacchaubbAse // etc. jaha se paTTe guruNA sAhiyaM ti vIreNa / taha kiMpi samAseNaM mae vi kila sAhiyaM evaM // soUna tume eyaM pAlaha jiNavIrabhAsiyaM vayaNaM / RSidattAkhyAna No. 81 pAveha jeNa airA kaMDahiUNa mokkhaM ti // iya kuNamANeNa tumaM pattaM jaM kiMci ettha me (pu) NaM / puNeNa teNa pAvaha tumhe ayarAmaraM ThANaM // i vIrabhasUrI 'nAi saM. The Ms. ends here abruptly. 107 Rsidattakhyana 697. 1899-1915. S 10 IS Size.-- 107 in. by 4g in. Extent.- 24 folios; 13 lines to a page ; 43 letters to a line. Description. Country paper tough and grey; Jaina Devanagari characters; big, clear and good hand-writing; borders ruled in three lines in red ink; red chalk and yellow 25 pigment used; numbers of most of the foll. entered twice as usual ; fol. 1 blank ; edges of the first fol. slightly damaged; corners of some foll. worn out; complete ; composed in Samvat 1643. Age.-- Samvat 1692. Author. Jayavanta Suri alias Gunasaubhagya, pupil, of Upadhyaya Vinayamandana, pupil of Dharmaratna Suri. His additional Gujarati works are as under :-- 20 30

Page #143
5 Io 15 20 25 30 108 Jaina Literature and Philosophy (4) nemi - rAjula vAra mAsa vela prabaMdha (2) 'locana - kAjala ' saMvAda (3) zRMgAra maMjarI = zIlavatIcaritra V. S. 1614. (4) sImaMdharanA candrAulA (5) ( 6 ) (7) sthUlabhadramohanaveli. He has written a commentary on Kavyaprakasa. Subject. A narrative about Rsidatta, a chaste woman in Gujarati in verse. Begins. fol. 1 || 60 // 1 sImaMdhara - stavana - sImaMdharasvAmIlekha. ' 'sthUlibhadra - kozA- premavilAsa' phAga Ends. fol. 24* udaya adhika dina dina hui / jehaniM lIdhai nAmi // te paMca parameSTiniM / huM nita karu praNAma / / 1 / / etc. RSidattA niramala thaI / te nija satcca pramANeM // tasu AkhyAna varSANatAM / dai mujha niramala vANi || kavitA mahimA vistarai / phalai vaktA Asa // zrotA atiraMgaI jiNai / sohai vacanavilAsa // 5 // etc. [ 81. Rkhi (Si) dattA nai rAya kanakaratha / mukti bihuM jaNa sAdhI // sakala kalaMka thakI kANI / kIrati nirmala bAdhI / / 59 / / etc. 'tapa' gaccha sohAkarA ho / zrI (vi)nayamaMDaNa guNarAya re // ratnatraya ArAdhakA ho / je jagi dharmasahAye re // 61 // troTaka / je jagi dharma sohAya guNAkara / suvihitanaI dhuri ki This poem is published in prAcIna phAgu saMgraha ( pp. 125-132 ) . 2 For its colphon see Jaina Gurjara Kavio ( Vol. III, Pt, I, p.672 ). tasa sIsa ga ( guNa (Na) sobhAga sunaamii| jayavaMtasUri prasiddha ||62|| tei rasikajanAgraha jANI / viracyo satIsucarita // uttama jana guNa suNatAM bhaNatAM / janama hoi pavitra // 63 // saMvat sola sohAmaNo ho / tretAla [la] ( 1643 ) udAra re / / mAgasira sudi cavadasi dini ho / dIpaMtI ravivAra re / / 64 / / troTaka | dIpato ravivAra surohaNa / zizi vartaiM vRSa rAsiM // Rkhi (Si) dattAcarita vaSANai / jayavaMtasUrI ulhAsI // 65 //

Page #144
82.] The Svetambara Narratives 109 nyUna adhika je hoi AgamathI / 'micchA dukkaDa' tAma || kavitAvaktA zrotA jananI / phalayo dina dina Asa // 66 // iti zrIRkhi(Si)dattAsatyAkhyAnaM sammattaM / saMvat 1692 varSe kArtikamAse zuklapakSe 14 tithA(tho) zrI girarI'grAme paMDitazrIratnaharSagaNitacchiSyapaM zAMtiharSagaNinA likhitaM / paropakArAya amit 'tapAgacche zrI- 5 vijayadevasUrIzvarAcAryazrIvijayasiMhasUriyuvarAjye / / zubhaM bhavatu[:] / yAdrizaM pustake dRSTaM tAdriza likhitaM mayA / yadi zuddhamazuddhaM vA mama doSo na dIyate / zubhaM bhUyAt lekhakazca (sya) || Reference.- For extracts and additional Mss. see Jaina Gurjara 10 Kavio ( Vol. I, pp. J94-197 & Vol. III, Pt. I, pp. 669-70). S RSidattAkhyAna Rsidattakhyana 1207. No. 82 1886-92. Size.--10g in. by 4, in. Extent. -- 32 folios; 11 lines to a page; 40 letters to a line. Description).- Country paper thin, rough, tough and white; Jaina Devanagari characters with occasional pRSThamAtrAs; big, quite legible, uniform and very good hand-writing; borders ruled in three lines in red ink; dandas written in red ink ; foll. numbered in the right-hand margin ; fol. ! blank ; so is the fol. 320; unnumbered sides decorated with a small disc in red colour in the centre; the numbered, in each of the two margins, too; yellow pigment used for making corrections; edges of the first and the last foll. gone ; condition on the whole good; complete. Age.--- Pretty old. Begins.-- fol. 1 epN0|| zrIvItarAgAya namaH // 20 25 30 udaya adhika dini dini havai etc. as in No. 81. Ends.- fol. 320 RSidattA naI rAya etc. up to Asa 40 practically as in No. 81.

Page #145
Ito [82. Jaina Literature and Philosophy This is followed by the lines as under : iti RSidattArAsa saMpUrNa | samAptaH // zubhaM bhavatu[:] kalyANaAxa[:] ll ll ll ll 3!! Then perhaps in a different hand we have : bAi zrImAnabAI vayajabAIpaThanArtham / zrIgaMdhArA // N. B. - For further particulars see No. 81. RSidattAkhyAna Rsidattakhyana No, 83 28. 1877-78. Size.-- 104 in. by 43 in. Extent.-- 22 folios ; 13 lines to a page; 45 letters to a line. Description.-- Country paper thin, tough and white; Jaina Devanagari characters with rare geaaS; big, quite legible, uniform and very good hand-writing ; borders ruled in three lines in red ink ; numbers for verses, their dandas, names of ragas etc, written in red ink ; all foll, except the ist numbered in both the margins; the first in the right-hand margin only; there is some space kept blank in the centre of the numbered and unnumbered sides as well ; in the case of foll. 35, 5", 56 and 7 thrice such space is kept : once, of course in the centre and once in each side of it, thus forming nice designs; fol. 18 blank ; in the left-hand margins the title is mostly written as RSidattA and at times as RSidattArAsa and RSidattArA; edges of the first fol. slightly gone; complete ; extent 543 guthus. Age.- Samvat 1686 i. e. 43 years after composition. Begins.- fol, jb 011 Jau sta leia iela Eag etc. as in No. 81. 30 Ends.-- fol. 226 RSidattA naI rAya etc. up to Asa || as in No. 81. This is followed by the lines as under :

Page #146
84.] The Svetambara Narratives 111 12 // iti zrIRSidattArAsa saMpUrNa // gAthA pAMcasaI 543 // saMvat 1686 varSe mAghasitetara 5 zanau // paMDitazrIsiMghavijayagaNinA(s)lekhi [:] // gaNizivavijayapaThanArtham / zrIneminAthaprasAdAt : zrIrAnera' bNdire|| N. B.- For other details see No. 81. RSidattAkhyAna Rsidattakhyana 1589. No. 84 1891-95. Size.- 10 in. by 41 in. Extent.-- 29 folios; 11 lines to a page ; 43 letters to a line. 10 Description.- Country paper somewhat thick, tough and white ; Jaina Devanagari characters; big, quite legible, uniform and beautiful hand-writing; borders ruled in two pairs of lines in black ink; space between these pairs coloured red; dandas written in red ink ; foll. numbered in the right-hand IS margin ; fol. 1a blank ; there is some space kept blank in the centre of the numbered and unnumbered sides as well so as to form a design; in the left-hand margins the title is mostly writien as waar; edges of the first and last lew foll. slightly gone ; condition on the whole good; 20 complete. Age. - Not later than Samvat 1685. Begins.-- fol. ! 160 / OM namaH / / 25 udaya adhika dina dina habaI etc. as in No. 81. Ends.-- fol. 220 RSidattA naI saya / etc. up to Asa || as in No. 81. This is followed by the lines as under : iti RSidattArAsa sNpuurnnH|| Then in a different band we have : saMvat 1685 varSe mAghasudi 1 dine sAdhvIdevAni zrA0amarAdeiM parati vahirAvI / / N. B.- For additional information see No. 81.

Page #147
10 20 kathAkoza ( 2 ) No. 85 Size.- 10++ in. by 44 in. Extent.-- 36 folios; 17 lines to a page ; 64 letters to a line. 5 Description. Country paper very thin and greyish; Devanagari characters with occasional Is; small, legible and good hand-writing ; foll. numbered as usual; borders ruled in three lines in red ink; red chalk and white paste used; corners and edges of some foll. worn out; condition tolera. bly good ; complete so far as it goes. Age.-- Fairly old. Author.- Unknown. Subject. Narratives pertaining to various topics such as donation etc. 15 Begins. fol. 1a 25 30 II2 35 Jaina Literature and Philosophy [ 85. Kathakosa (?) 582. 1884-86. // 67 // dAnaM priyavAgasahitaM jJAnamagarne kSamAnvitaM zaurya // tyAgasahitaM ca vittaM durlabhametaccaturbhadraM // 1 // bharatezvaranRpAnvaye'STamo daMDavIryanRpo jAtaH / sa ca sarvadA dinaM dinaM prati koTizrAddhAnAM madhuragirA bhojanaM dApayati // etc. Ends. -- fol. 362 prabhAvake zrIhemAcAryakAlikAcAryazrIjIva devasUrizrIjinaprabhasUrivibhukumArayazodevasUriAryakhapaTabappabhaTTipAdalipta zrIdharmaghoSasUrizrImAnatuMgasUribohAdInAM dRSTAMtA vAcyAH / kiM bahunA ? | dharmaH sarvaprakAreNa kRto mahAlAbhAya bhavati / yataH // dharmaH zruto (S) pi dRSTo ( s) pi kRto ( ( ) pi kArito ( 1 ) pi ca // anumodito (s) pi rAjeMdra ! punAtyAsaptamaM kulaM // 19 // iti dharmopadezaH / ( s) TAdaza lakSapaNNavatikA 'zatruMjaye' sthApitA / koTyo dvAdaza ' revate' ''rbuda' vara lakSaistripaMcAzatA // prAsAdAstrizatI trayodazazatI zaivAzva jainAstathA / zAlAnAM navazatyasI (zI ) ticaturaH pUjAzrvatastrastathA // 1 // bibAnIha sapAdalakSagaNitAnyApAdayAmAsivAna / jIrNoddhArasahasrayugmamadhikaM cakre zatAnAM trikaiH // satrAgAraka saptazatyanumitAthAtriMzatA durgakaiH / ko vA varNayituM kSameta sukRtaM zrIvastupAlaprabhoH? // iti zrIvastupAladharmakRtya kAvyadvayaM // cha // zrI //

Page #148
13 87.] The Svetambaru Narratives kathAkoza Kathakosa 1323. No. 86 1891-95. Size.- Io in. by 41 in. Extent.- 67 folios; 18 lines to a page; 40 letters to a line. Description.- Country paper rough and greyish; Devanagari characters; small, legible and fair hand-writing ; borders ruled in two lines in red ink; foll. numbered as usual ; fol. 1a blank; red chalk used ; complete ; condition tolerably good. I0 Age. - Old. Author.- Unknown. Subject.-- Various narratives pertaining to worship of God, anger, pride, gambling etc. Begins.-- fol. 1 ||shriijinaay nmH|| jina pUjanaM janAnAM janayatyekama( koDa)pi saMpadaH sklaa|| jalamiva jaladavimuktaM kAlezasya zriyo vipulaaH||1 atraiva bharate 'basaMtapura'nAma pattanaM / tatra jinadAsanAma zreSThI / tadgRhe devapAlanAmA karmakaraH / etc. Ends.--fol. 67* tato gurubhistyAH / niSadhadevena Agatya pratiyodhitaH vrataM paripAla- 20 yituM azakto nalo anasa(za)naM karoti / davadaMtyA(5)pi gRhIta(ta) anazanaM / nalo mRtvA kubero jAtaH / davadaMtI mRtvA tasya bhAryA babhUva / kiMcita virAdhanAt nIcadevatvaM prAptaM / dvAvapi karma kSayitvA krameNa mokSaM yAsthataH // iti dyUtaviSaye nalakathA // iti kathAkozaH // Reference.- Some anonymous works named as 'Kathakosa' are 25 noted in Jinaratnakosa ( Vol. I, p. 65 ). 15 kathAkoza Kathakosa ( kahAkosa) ( Kahakosa ) 1268. No. 87 1884-87. Size.-- 103 in. by 44 in. Extent.- 18-1%DIT folios ; 18 lines to a page : 56 letters to a line. 15 [J. L. P.] 30

Page #149
114 Jaina Literature and Philosophy [87. Description.- Country paper tough and greyish; Devanagari characters; small, clear and fair hand-writing ; borders ruled in four lines in black ink ; red chalk and yellow pigment used ; foll. numbered as usual; fol. II slightly torn; fol. i lacking ; otherwise complete so far as it goes ; the first 8 stories written in Prakrit whereas the 9th in Sanskrit ; condition tolerably good. Age.-- Not modern. Author.- Not mentioned. 10 Subject. - Narratives pertaining to 'eight sorts of worship and one story about Savadyacarya. These are followed by an enumeration of 21 virtues of the Jaina laily. Begins.-- fol. 29 teNa // 6 // mayaNAvalI vi saJcaM soUNa tassa bhaasieaN| saMbharai pubajAI / nidai apANayaM tatto / 61 / citai maNami to sA | samyaM cia majjha sAhiaM criaN| eeNa varasueNaM / ihiM jaM kahai taM suNimo / 62 / - fol. 2 gaMdhapUjAviSaye zubhamatijayasUranRpayoH kathAnakaM / / 1 // ___ -- fol. 5' iti dhUpotkSepaviSaye vinayaMdharakumarajJAnaM likhitaM harSasiMgha gaNinA // 2 // -- fol. 9" iti a(kSa)tapUjAkathAnakaM // 3 // likhitaM harSasiMdhagaNibhiH // fol. !!* iti zrIpuSpapUjAviSaye vinayazrIkathA caturthA // 4 // -- fol. 12' iti pUjASTake viSaye dIpapUjA jinamatidhanazrIkathAnakaM paMcamaM // 5 // -- fol. 14deg iti pUjASTaka(ke) naivedyapUjAyAM halinareMdrakathAnakaM SaSThaM // 6 // -- fol. 16deg iti phalapUjAviSaye durgatikIramithunAnyajanmani phalasArarAjJaH kathA saptamI // 7 // Ends.-- fol. 170 ugAya nArI vi visuddhamANasA sAhuNI hiMsanizvaM / / paMcamahanvayakaliA / viharai jiNasaMkulaM puhavi // 62 // 15 30 1 They deal with (1) gandha, (2) dhUpa, (3) akSata, (4) puSpa, (5) dIpa, (6) naivedya, (7) phala & (8) jala respectively. For comparison see p. 45.

Page #150
87.] The Svetambara Narratives IIS 10 muNinAho vi mahappA paDiboheUNa pANiNo bahave // biharai appaDibaddho | gAmAgaramaMDiaM vasahaM / / 63 // kuMbhAsarI vi a AuM / paripAliUNa suddhapariNAmA / / mariUNa samuppannA / 'IsAraNe suravimANami // 64 // bhuttUNa tattha sukkhaM suranarasukkha ca aNuhe (ha)veUNaM / / jiNavarajalapUjAe sijjhissai pacame jamne / / 65 // jalapUjAviSaye kuMbhazrIkahAnakamaSTamaM / zubhaM bhavau / likhitaM harSasiMgha gaNinA 'sAraMgapura'nagare / / Begins.- fol. 17 // 6 // gautamAnyathAprarUpaNe sAvadhAcAryoM dRSTAMtaH / ___ asyA ku(RSabhAdicaturviMzatikAyAH prAga anaMtakAlena yA'tItA caturviMzatikA tasyAM mtsdRshaaH| saptahastatanuH dharbhazrIrnAma caramatIrthakaro babhUva || tattIrthe saptAzcaryANi babhUva(vuH) asaMyata pUjAyAM pravRttamAne ke / etc. Ends.- fol. 18a bhagavan ! tena tIrthakaranAmakarmArjitaM / ekabhavAvazeSIkRt AsIda bhavodadhiH / tat katha(ma)naMtasaMsAraH ? / gautama! nijapramAdadoSAt tasmAt 15 gachAdhipatinA sarvadA sarvArthaSvapramattena bhAvyamiti // iti zrImahAnizItha paMcamAdhyayanAllikhitaM harSasiMdhagaNinA // cha / --fol. 280 budhairvidhIyatAmeko dharmaH paramabAMdhavaH // dadira madirAvatyA yena vAMchitasiddhayaH // 1 // 'kSitipratiSThita'nagare jitazatrurAjA rAjyaM karoti / etc. paMrAmaMdhaM ca RddhaM ca kuSTAMga vyaadhipiidditaa(sN)| Apatsa (ca) gataM nAthaM na tyajet sA mahAsatI // 1 // tasyA vRddhatvaM jJAtvA pratolIdhahi / gRhaM kRtvA dvAvapi sthitau / zaimaNicUDavidyAdhararUpaM prakaTIkRtaM / saptabhUmika AvAse sthitaM / prAtaH tatsvarUpaM jJAtvA 25 samAgataH / tadA tena dharmaprasAdo dRSTaH / iti dharmaprabhAve kathA // akSukSu(bdha? ) 1 rUpavaMta 2 prakRtisaumya 3 lokapria(ya) 4 akrara 5 pApabhIrU 6 nimodya 7 dAkSiNyavaMta 8 lajjAvata 9 dayAvaMta 10 madhyasta 11 saumadRSTi 12 guNAnurAgI 13 dharmakathAkathaka 14 dhArmikaparivAramahita 15 dIrghadarzI 16 vizeSajANu 16 (?) dharmavRddhajanasevaka 17 vinIta 18 20 kRtajJa 19 parahitakara 20 dharmakRtyaviSayalabdhalakSa 21 ekavIsa guNa zrAvaka dharmayogi // ch|| Reference.-- See p. 113.

Page #151
116 Jaina Literature and Philosophy [ 88. 10 kathAkoza Kathakosa 1322. No. 88 1891-95. Size.-- 9 in. by 44 in. Extent.- 68 folios ; 16 lines to a page; 48 letters to a line. s Description.- Country paper rough and white; Devanagari chara cters; small, clear and very fair hand-writing ; borders ruled in three lines in black ink ; numbers of most of the foll. entered twice as usual; red chalk used; yellow pigment, too; fol. 28 wrongly numbered as 29 in the righthand margin ; about half the portions of foll. 356 and 36a blank but the continuity seems to be undisturbed ; com plete; condition tolerably good. Age. --- Samvat 1726. Author.- Not mentioned. 15 Subject.- Narratives. One of them is about Bahubali. Begins.--- fol. !" // 60 / zrImahopAdhyAyagurubhyo namo(3)stu / / natvA jinapatimA puMDarIkaM gaNAdhipaM / / zIlA'laMkArasaMyuktaM AzcaryatatkathAM bu(ba)ve // 1 // ___ athAnyadA varSAkAlaH samAyAtaH / gajjati ghaNA nacaMti sihigaNA / etc. 20 Ends.--fol. 68' dIkSA gRhItA / dhyAnasthaM bAhubaliM dRSTvA / bharatastaM abhivaMdati / evaM badati ca paThaDajetA bharato(5)pyahaM yairakSetrilokIjayibhirjito(5)haM / tAnyapya ho yena jitAni anujaM vaMde / sunaMdAtanayaM bhaTaM taM / iti zrutvA putraM rAjye (5)bhiSicya svasthAnaM gataH cakrI / bAhubalI varSe yAvat tatraiva kAyosigarge tasthau / yadahaM tAtapAdAMte laghubAMdhavAnAM kathaM namaskaromi / ityabhimAnatastatraiva tasthau // iti kathAkozaH saMpUrNaH / saMvat 1726 varSe likhitaM. ... ... paThanArthe / kArtikazudi 3 dine / Reference. - See p. 113. 1 Letters are illegible as the corresponding portion has been blotted out.

Page #152
89.1 The Svetombara Narratives 117 kathAkoza Kathakosa 1269. No. 89 1884-87. Size.-- 9 in. by 44 in. Extent.- 65-9-1355 folios ; 17 lines 10 a page ; 38 letters to 5 a line. Description..- Country paper rough and white; Devanagari chara cters with occasional parais; big, clear but poor handwriting: borders ruled singly in thick saffron colour ; red chalk used ; foll. numbered as usual; foll. I-9 and 22 10 lacking ; this work begins and ends abruptly; incomplete ; condition tolerably good. Age.- Not modern. Author.-- Not mentioned. Subject.- Narratives about Laksmivati etc. Begins,-- fol. 10a jyAIsviti bhAjana // 5 // lakSmIvatI yazodattavyavahArisutA(5)bhavat / / tatra dharmaratA zIle viziSya nu(su ?)kRtAdarA // 6 // nijazIlaparIkSA nirvAya prhstyaa| svahastasparzamAtreNa sa kumAraH paTukRtaH / 7 // etc. Ends.-- fol. 650 kolikA prAha / satya muktaM bhavAyA tat kathaya ki prArthayAmi ? | sA(s)bravIta tvAmaka paTaM nityamevaM saMpAda(ya)si / tena sarvA Ayavyaya zuddhiH saMpadyate / sa ca mAtmano( ) vaha yugalaM dvitIyaM ziraH prArthaya mUlyena nizeSachanyAni RyaMte se khyena jJAtimadhye zlAdhamAlasya kAlo gacchati / lokadvayasyupArjanA bhavati / so(5)pi tazru cha) vA prahRSTaH prAha ! sAdhu pativrate ! sAdhu yuktamukaM bhavatyA / tadeva kariSyAmi eSa me nizcayaH eSa gatvA / This work ends abruptly. Reference. - See p. 113, Roman

Page #153
118 Jaina Literature and Philosophy [10. kathAkoza Kathakosa No.90 1266. 1884-87. Size.- 10.2 in. by 4 in. Extent.-- 47 folios; 13 io 15 lines to a page ; 42 to 58 letters to a line. Description.--- Country paper rough and greyish; Devanagari characters with gardis; big, legible and good hand-writing: borders ruled in four lines in black ink ; foll. numbered as usual; fol. 1 a blank ; red chalk used ; incomplete as it ends abrup:iy; foll. 35-47 written in a smaller hand-writing; the last katha which is completely dealt with, in this dis., is that of Jimutavahana; condition very good. Age.-- Fairly old. Author.- Unknown. Subject.--- Narratives, one of them being that of Jimutavahana. Begins.-- fol. 10 e0 // OM // namaH zrIcadraprabhasvAmine // dRSTo(5)pi huTajanalocanacaMdrakAMta mazrItabhItarajalAvilamAdadhAnaH / caMdraprabho jayati caMdra ivezamitra / citra puraH zubhAtAya yadaSTamo(5)pi // 1 // kSetra(s)khile 'bharata'nAmani bodhibIja vApAya yaH kila purA(55)didhurAbAha / aMsasthalA svitirato kiNakAlimeva kezAvalivijayatAM vRSabhastha tasya / / 2etc. Ends.-- fol. 47b pitRbhyAM prapitA hAta svarAjyasyovidhIrSayA / / sa prApa 'kAMcanapura vyomneva dayitA skh| / / 15 / / jImUtavAhanakathA samAptA / / cha || j0 114 iti bauddha vacaH zrutvA rAjA shriimaanjaasutH| jaharSa yat prahRSyati sAttvikA sattvadarzanAt // 1 // subuddhisacibenAtha vIkSite prAha tApasaH / maMtrin ! zrImada (ends abruptly) Reference. - See p. 113. . Dom

Page #154
119 91.] The Svetambara Narratives kathAmahodadhi Kathamahodadhi ( karpUraprakarakathA) ( Kerrurprakarakatha ) 775. No. 91 1895-1902. Size.-- 108 in. by 4u in. Extent.-- 30 folios ; 17 lines to a page ; 56 letters to a line. Description.- Country paper thin and white; Devanagari chara cters with pRSTamAtra!s; small, clear and good hand-writing; borders ruled in four lines in black ink; red chalk used; foll. numbered as usual ; almost all the foll. more or less 10 worm-eaten; some very badly; strips of paper pasted to the edges of fol. 1a; condition poor ; complete ; extent 1800 slokas; composed in Samvat 1504. Age.- Old. Author.-- Fandit Somacindra, pupii of Ratnascklara Suri. Subject.-- This work contains 159 stories suggested in Karpura prakara of Harisena. These stories are at times com. posed in verse and at times in prose. A list of these stories is given by P. Petcrson in his Report III. A p. 316ff. ). Begins.-- fol. 1 // 6 // zrIvardhamAnamAnasya nirddhatavRjinaM jinaM // karpUraprakara[]]granthe kathAH srakSyAmi sprthaaH|1|| ko'pi syAlaghukarmakaH munatadhIrdeza(5)pya 'nArye yata stasyApyAIkumAravat guNaJcayaH kiMzcAryadezAzramAt / / kSArAbdhau zazino'va kaustubhamaNeH sA zrIH kuto yA bhvt| 25 'gaMgA'zAlini zaMbhumUbhi(5)kamalAgAre harezvorasi // 2 // atra ArdrakumArakathA // etc. Ends.-- fol. 30 iti citayatU pannavairAgyaH kapila AlocanasthAne locameva kRtavAn / gRhItaM pravrajyaH 1 500 caurAna pratibodhayati sma ||ch // 60 samAlo'yaM zrImAn kathAmahodadhinAmagraMthaH // cha / 30

Page #155
120 Jaina Literature and Philosophy varSe vAyabarazaramudhArasmi(dima)(1504)saMkha bRbha / zrImAn graMthaH sakalamumanazcittaharSapraNeyI / yAvat krIDAM gaganakamanva rAjahaMso vizAle / tanvAnaustastimirabhidurau tAvado(de)pA(5)pi jIyAt // 1 // vaivedyopnissdilaasbste| zrIsUrIzvararatnazeSaraguroH praamaannikjnyprbhoH|| ziSyaH sa(paM)DitasAmacaMdra nuradho mAdhuyadhuryA vyadhAt / karpUraprakarAvikAkathitA etAH kathA sapravAH // 2 // saptapaMcAzadadhikA zatasaMkhyAnvita kathAmahodAdhagrantho hadyagathai vinitama // 3 // nirava dyagadyAkSarasarvAgrasaMkhyayA / aSTAdaza(za)ImAnamasmina graMthe hi vidyate // 4 // graMthAnaM 1800 // cha / etc. Reference.-- Karpuraprakara together with the commentary of Jinasagara and the kathas of Somacandra is published by Hiralal Haimsaraj, Jamnagar in A.D. 1916. For quotations see Weber ( II, p. 110: ff.) and Peterson, Report III. A. p jieff. For additional Mss. see Jinara nakosa ( Vol. I, p. 66 ). I0 20 kathAratnAkara Katharatnakara 776. No. 92 1895-1902 Size.- 101 in, by 43 in. Extent.- 71+1=72 folios ; 15 lines to a page; 56 letters to a line. Description.- Country puper thin and white ; Devanagari cha. racters; small, clear and fair hand-writing ; borders not ruled; foll. numbered as usual; fol. ta blank: red chalk used ; several fell. worm-eaten; condition very fair; lacunae on iol. 54"; fol. 65 repeared; out of 10 tarangas 5 are complcte and the 6th goes up to a narrative of the wife of Priyangu, a Brahmin; it is numbered as 129; composed in Samvat 165, Age.-- Not modern. 30

Page #156
10 92.] The Svetambaru Narratives 121 Author.-- Hemavijaya Gani, pupil of Kamalavijaya Gani. His additional Sanskrit works are as under : ( 1 ) anyoktimuktAvalI = anyoktimatAmahodadhi (2) RSabhazataka V.S. 1656 (3) kastUrIprakara (4) kIrtikallolinI (5) jinastavanacaturviMzatikA = caturviMzatijinastuti (6) jinastuti (7) pArzvanAthacarita V. S. 1632 (8) vijayaprazasti V.S. 1681 (9) sadabhAvazataka (10) mUtaratnAvalI V. S. 1650 (11) stutitridazataraGgiNI. This Gani has composed in Gujarati kapalavijayagasa in V.S. 1661. Subject.-- 129 narratives out of 258 pertaining to various topics. The entire work written in an elaborate prose is divided into to tarangas. Of them only 5 tarangas are here com pletely given. Begins.-- fol. i || 60 // zrIvItarAgAya namaH // jayati rajanirattasthAnaratnAratna dyutiparaparabhAgyaM jyotiru(da)dyotitAzaM / krtlnihitevaashessvishvvyvsthaa| samajani samavRttayoginAM yatprasatteH / / 1 // tridazaya(pa)tri(ti)puraMdhrIdhoraNIgItakIrti __ bhavatu subhagamUrtistrazalevaH(zaH) zriye vaH / vividharasarahasyA prAdurAsIt kthaanaaN| tatiratha(gha)hRtirabdhevIcivIthIva yasmAt / / 2 // etc. - fol. 17" iti zrIpaM zrIkamalavijayagaNiziSyapaMDitahemavijayagANaviracite kathAratnAkare prthmstrNgH||1|| - fol. 32' iti dvitIyastaraMgaH / / - fol. 48b iti tRtIyastaraMgaH / / - fol. 61deg iti0 caturthastaraMgaH // - fol. 69b iti paMcamastaraMgaH // 16 [ J. L. P.] 20 30

Page #157
5 IO IS 20 25 30 Jaina Literature and Philosophy [ 92. Ends. fol. 71 tadA ca sa dhUrtoM vaTazAkhayottIrya karabhaM cAdhiruhya drutamacalata karamArUDhaM taM gacchaMtaM vilokyA (kyo) bhayabhraSTo goviMdo ba (bA) huyugamudrI (va)kRtya he bhadra! karabho'pi yamunAyai deya ityabhidhAya bale / dhUrto'pi tat sarve gRhItvA gRhaM gataH / iti mohakaraNe ( ( ) na (thaM ) ityarthe priyaMguviprapriyAkathA / / 129 / / 122 Reference.-- Published by Hiralal Hamsaraj in A. D. 1911. This work is translated into German by Johannes Hertel in A. D. 1920. For additional Mss. see Nos. 93-95 and Jinaratnakosa ( Vol. I, p. 66. ). kathAratnAkara No. 93 Size.- 93 in. by 43 in. Extent.-- 167 folios; 15 lines to a page ; 40 letters to a line. Description.-- Country paper thin and white; Devanagari characters; small, legible and good hand - writing; borders ruled in three lines and edges in two, in red ink; yellow pigment used; red chalk, too; numbers for foll. entered twice as usual ; incomplete. Out of 258 narratives 231 are complete ; condition very good. Age.- Not quite modern. Begins.-- fol. 1b jayati rajaniratnasthAnaratna ratna etc. as in No. 92. Ends.-- fol. 167b Katharatnakara 653. 1892-95. iti mativiSaye ravicaMdranAmakavikathA || 231 cha / maNimaMtrayaMtrauSadhAdInAM mAhAtmyamacityaM / yataH amaMtramakSaraM nAsti nAsti mUlamanauSadham // nirdhanA pRthivI nAsti AmnAyAH khalu durlabhAH // 1 // kiMbahunA mRtAnAmapi maMtrazaktiH sphurtimati bhavati / ytH| etc. tathAhi mAlava 'dezamadhyadezavartini 'pIcIvAdrA(TeTA) khyaviSaye 'guMjAlagrAma vIracaMdro nAma rAjA // tatra ca grAme bahunAmA parikSaka baNi vasati tatra 1 This edition is practically lacking in the colophon given in No. 94. "

Page #158
94. ] The Svetambara Narratives zAkinInAma padravaM bhUyAMsaM vilokayAnyadA maMtra yaMtrataMtrau / ( incomplete ). N. B. For further particulars sce No. 92. kathAratnAkara No. 94 Size.- 10 in. by 44 in. Extent.--- 219-5-30 = 184 folios; 13 lines to a page; 38 letters to a line. Katharatnakara 1270. 1884-87. Ends. -- 123 Description.- Country paper thin, tough and white; Jaina Deva- To nagari characters with rare gras; big, perfectly legible, uniform and very good hand-writing; borders ruled in three lines in red ink; foll. numbered in the right-hand margin; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; the 15 first five foll. missing; so are foll. 123 to 152; thus this work begins abruptly; it goes up to the end but there, too, a portion of the colophon is incomplete; in all there are 258 katbas; the last is about Sita; left-hand corners of the the first few foll. gone; edges of the last fol. worn 20 out; condition on the whole good. Age. -- Pretty old. Begins. ( abruptly ) fol. 6a bhAgyaM te tu sarve(s) pi 'gaMgA pravAhA itra puNyasvarUpA iti taM nirbhasya purIM pravizan zreNiko yA karasaraMjitacaraNAM yathaucityaM kaTAvayeSu vinivezitAbharaNAM kajjalakalitanetrAM tAMbu (ca) lapUri- 25 sUtrAM parihitavivadhavarNavasanAM prapaMcitapaMceSUsmayakA rihasanAM puSpa pUritamaga zramaNIveSadhAriNImekAM ramaNImadrAkSIt etc. fol. 218a niasIla mahAmaMtre (te)Na pabalaM jalaNaM jalaM kuNaMtIe / soho anna vi raNajhaNai sIAe ||7|| S 30 iti devaiveditA pUjitA saMstutA sItA rAmabha (caM) dramamaNata ke svAmina ! yadi niHkalaMkA (s) lokApavAdabhIruNA tvayA sarpeNa nimmaka iva tyaktyA(ktA) tadA dUraMta kamakAtarayA mayA(s) pi devapAdA mure iti prANapatimabhidhAya janakAtmajA satvarameva prAvrAjIt /

Page #159
124 Jaina Literature and Philosophy [947 iti zIlaviSaye sItAsatIkathA // 257(? 8) // iti samastamu(su)vihitAvataMsapaMDitakoTIraharipaM0 zrIkamalavijayagaNiziSyabhujiSyapaM hemavijayagaNiviracite kathAratnAkare dazamastaraMgaH saMpUrNaH zrIkathAratnAkaraH cha shriiH| AsIda vIro jitAna(naM)gavIro jinezvaraH / surasArthe pupuSoccaiH svargavIyapadIgIH // 1 // tatpadapadminIpadmabaMdhuH siMdhuH zubhAMbhasA / zrIsudhA (s) bhavad dharmAdhikArI gaNabhRdvaraH // 2 // tatkrameNAbhavad vajjinato vjrrssisriraatt| janako 'vajra'zAkhAyAH padmAyA vIcamAni vaH // 3 // tatpaTTAMbaradinamaNiruditaH zre(zrI)vajrasenana]gururAsIt / nAgeMdracaMdranivRtividyAdharasaMjJakAzca taziSyAH // 4 // svasvanAmasamAnAni tebhyazcatvAri jajJire / kulAni kAmameteSu kulaM 'cAMdraM tu didyUta // 5 // bhAskara iva timiraM haraMtaH khApAtibhAjanaM / bhUrayaH sUrayastatra jajJire jagatAM matAH // 6 // babhUvuH kramatastatra zrIjagaccaMdrasUrayaH / yaistapA birudaM lebhe bANasiya(ya);1285vatsare / / 7 / / krameNAsmin gaNe hemavimalAH sUrayo(s)bhavat (n)| tatpaTTe sUrayo(s)bhUvannAnaMdavimalAbhidhAH // 8 // sAdhvAcAravidhiH pathaH zithilataH samyak zriyAM ghAma yai___ rune stanasiddhisAyakasudhAroci1582mmite vatsare / jImUtariva yerjagat punaridaM tApa hrdbhibhRshN| sa zrIkaM vidaghe gavAM zucitamaiH stomarasollAsibhiH // 9 // tatpaTTakaraTikaraTasthalaikasiMdUrasadRza saubhaagyaaH| zrIvijayadAnasUrIzvarA abhUvana mahAvibhavA() // 10 // saubhAgyaM harisarcagarvaharaNaM rUpaM ca raMbhApati zrIjaitraM zatapatramitramahasAM cauraM pratApaM punH| yeSAM vIkSya sanAtana madhuripusbaH(?)svAmidharmAzavo jAtAH kAmamapaH pA bharabhRto gopanvamAptAtrayaH // 11 // tatpaTTapUrvaparvatapayojinIprANavallabhapratimAH / zrIhIravijayasUriprabhavaH zrIdhAmasaMjAtAH / / 12 // ye zrI phatepure' prAptAH zrIakabbarazAhinA / AhatA vatsare naMdAnala(ta)zazabhR1639nmite // 13 / /

Page #160
94.] 125 The Svetambara Narratives nijAdezeSu dezeSu zAhinA tena ghoSitaH / pANmAsiyo yadUktyAccairamAripaTahaH padaH // 13 // ma zrIzAhiH svakIyeSu maMDaleSu khileSvapi / mRtasvaM 'jIjiAkhyaM ca karaM yadvacanai hau // 14 // vastyajaM tatkaraM hitvA tIrtha 'sh()jyaa'miyaaN(dh)| jainasAd yadUgirA cakre mAzakreNAmunA punaH // 4 // RSizrImeghajImukhyA 'laMpAkA mtmaatmnH| hitvA yaccaraNadvaMdva bhejurbha( )gA ivAMbujaM // 16 // tatpadRzaMkarazirastilakopamAnA: satkAMtayo vijysenmuniiNdrcNdraaH| da didavadanAMbujamudraNotka vidyA jayaMtya na ghasaMghaya(?)yoghiyAH / / 17 // mUMdarAdaramAhRtAH zrIakabarazAhinA / drAra yairalaMkRta bhapuraM padmamivAlibhiH // 18 // zrIakabbarabhUpasya sabhAsImaMtinIhRdi / yatkAttimauktikIbhUtA vAdicaMdajayAdhijAH // 19 / / jitvA viprAna puraH zAhe: 'kailAsa' iva mUrtimAn / yairudIcyA yazAstaMbhaH svonicaratre sudhojjvalaH // 20 // zrIvijayadevA yatipativAcakamuSyArSisaMghasaukhyapuSAM / teSAM rAjya vijayini jaladhAvica bahalatamakamale // 21 // ajani janitapuNyaprItipIna(na)prabhAvA nmrvijdhidvaanosvNshaavtNsH| taraNiriva tamAMsi dhvaMsamAno(5)japANiH zriyamanizamadhAd yaH ka(klU)ptapadmAvabodhaH // 22 // tatpaTTakamalakamalapraNayI zrIkamalavijayavaraviduraH / / rAjati kamalezvara iva kamalAkSyaH kamaladaladRSTiH // 23 // mUrti guroH zamamayIM samudIkSya yasya medhAvino dadhati cetasi vitrameva / ekSyate pratipadaM samitipravRttA yallokalocana cayasya mudAM nidAnaM // 24 // teSAM bhuvinpai(yo)ghsevitaaNhisroruhaaN| vidyate bhUrayaH ziSyA vApateriva nAkinaH // 25 // pArzvanAthacaritrAdibahU(hu)zAstrakRtizramaH / teSu ziSyeSvaNuhemavijayaH paMDitaH kaviH // 26 // (gu)maM 1 The numbering of verses is henceforth faulty.

Page #161
IO IS 20 126 30 kathAratnAkara No. 95 Jaina Literature and Philosophy tatpAda paMkaja iMdviridaM vyadhatta zAstraM sU(su) dhItana vitAna manovinodaM / harSeNa hemavijayaH kaviddhisiddha nAnAkathAnakamayaM smRtaye nijasya || 27 // 'ahimanagara gaMge varSe (S) zvepura sAvano (nau) 1657 mUlamArttaDasaMyogye caturdazyAM zucau zuceH // 28 // graMtho (S) yaM pariSavittavRttivArijinI raviH / vAsarasyAdime yAme samAptiM samupeyivAn // 29 // (dhu)gmaM sASTapaMcAzadadhikazatadvaya (258) kathAMta / satsUktizuktijaH pUrNaH kathAratnAkaro'bhavat // 30 // nAnAkathAmaNI pUrNaH kavirAjatibhAlanAt / kathAratnAkarAvho (hvos) yaM graMthaH saubhAgyamazrutaM // 31 // asmAt kathAjaladhitaH sukathAjalaughaM ( incomplete ) N. B. - For additional information see No. 92. saMgRhya sArataravyamaNiprapUrNAt / aMbodharA iva sabhAjanabarhituSTaye / vyAkhyA sRjaH kSititalaM sukhayaMtu saMtaH // 32 // yadi sabhyamanamuktA AdAtuM vittamasti vaH paricIyatAM / Size.-- 9 in by 4g in. Extent. -- 130 folios; 16 lines to a page : 4o letters to a line. 25 Description. - Country paper thin, tough and white ; Jaina Devanagari characters ; small, quite legible, uniform and very good hand-writing; borders ruled in two lines and edges in one, in red ink; red chalk used; foil. numbered in the right-hand margin; fol. 1 blank; so is the fol 130": yellow pigment used while making corrections; white pigment, too; edges of the last fol slightly gone; condition on the whole very good; complete; 209 katbas in all out of 258. [ 94. Katharatnakara 1216. 1886-92.

Page #162
96.] The Svetambasa Narratives 127 Age.--- Not modern. Begins.--- fol. 10 e6|| zrIjinAya namaH // pArzvanAthaM jinaM natvA sadguraM(5) ca vizeSitaH !! kathAratnAkaraM nAma kriyate zarmahetave // 1 // tAvajagati samayakAryakaraNottamavinaya eva yataH viNayAo nANaM nANAo dasaNaM dsnnaao| caraNa caraNehito mokhaM (kamva mo(ka)khe so(ka)kha aNAbAI // 1 // viNau (o) jiNamAmaNe mUlaM viNa u(o) nivaannsaahgo|| viNayAu vippamaka(ka)sma kao dhammo? kao tabo? // 2 // etc. Fn.ls. -- fol. 130deg sA kaSTena varddhitAH krameNedA tatrasthaM kAyo(ta)sargasthaM mAdhu saMvIkSya 10 dayAtaH dazostAhanaM kRtaM pratijJAte sA pratibodhatA nirmala kAyA mA paMcapaMcAzata(5:5)palpAyuSA dedhI bhUya tata[:]zutvA rUkmiNyamRt // iti sAdhuniMdAyAM rukmiNIpUrvabhavakathA 209 / / zrI // N. B. - For additional information see No. 92. kathAsaGgraha kathasaligrala 15 1326. No.96 1891-95. Size. -- 10 in. by 43 in. Extent. --- 13 folios ; : 9 lines to a page 15 letters to a line Description -- Country paper somewhat thick, rough and white: 20 Jaina Devanagari characters ; small, perfectly legible, uniform and beautiful land-writing ; borders ruled in two lines mostly in red ink ; red chalk used; foll. numbered in the right-hand margin ; condition very good ; complete ; it contains the following kathinakas:-- 25 (1) ArAmazobhAkayA iol. 1 to 3 ( 2 ) vItarAgapUjAyAM dhanadattakathA fol. 30 ( 3 ) devapujAviSaye depAlakakathAnakama foll. b to 40 (1) tapoviSaye nAgadattakathA (5) bhAvanAviSaye amaracandra kathAnakama (6) akSatapUjAviSaye zukathAnakam (7) gandhapUjAviSaye madanAvalIrAjJIkathAnakam ,, (8) naivedyapUjAviSaye hAlikarAjakathAnakam ,, (9) taponiSaye dhanyAkayA 20 ___

Page #163
128 Jaina Literature and Philosophy [96. 5 Age.--- Samvat 1748. Author.- Not mentioned. Subject.--- A collection of 9 narratives. This work contains quota tions in Prakrit. Begins.--- fol. 19 // e60 / / sulaho vimANavAso egacchattA ya meyaNI sulahA / dulaho puNa jIvANaM jiNaMdavarasAsaNe bohI // 1 // jaha girivarANa 'merU sUrANa iMdo gahANa jaha cNdo|| devANa vi jiNavareMdo taheva dhammANa sammattaM // 2 // sadharmamUlasamyakta(kvaM) narmalyakaraNe sadA // yatadhvaM tanvatIrtha sa saMghapUjAdibhirbhavet // 3 // zrIvItarAgasaMghapujAviSaye ArAmazobhAkathA prArabhyate etc. Ends.-- fol. 13- iti kathayitvA zAlibhadragrahe gatvA taM pratibodhya mahAmahotsava(va). pUrvakaM zAlibhadraghanyAkumarA subhadrAyA saha saptakSetreSu ghanamarjitvA zrIbhagavanmAhAvIrapAdyaM gatvA pravrajitaH(tA.) sthi(stha)va(vi)rANAMmItake grahaNAsava. nAdizikSA samarpayitvA gItArthA jAtAH krameNa dvAdazavarSa niratIcAra cAritra pratipAlpa mAsabhaktena pa(pA)dopagamara(na)ma(na)zanaM vidhAya 'rAja ' 'vaibhAragiriparvatopari sarvArthasiddhe devatve su(sa)mutpanna vayaMtri(tri)saM(za)tsAgarAyuH prapAlya 'mahAvidehe' manuSyabhavaM prati(..)pya krameNa mokSyaM gamiSyatiti tapoviSaye dhanyAkathA saMpUrNA 9 zrIkalyANamastu // subhaM bhavatuH / zrIrastu: paMDitazrI5zrIrUpavijayagaNita ziSyagaNizrIharSavijayalapItaM // saMvat 1748 varSe kAti sudi 13 dine zukravAre zrIrAnera'madhye laSIta // kathAsaGgraha Kathasaugraha [antarakathAsaGgraha ] [. Antarakathasangraha ] 25 [vinodakathAsaGgraha ] [ Vinodakathasangraha ] 1298. No.97 1887-91. Size.- 91 in. by 4g in. Extent.- 61 folios ; I3 lines to a page ; 46 letters to a line. Description.- Country paper somewhat thick, tough and white; Jaina Devanagari characters with rare earS; sufficiently big, quite legible, uniform and very good hand-writing ; 30

Page #164
97.1 The Svetambara Narratives borders ruled in three lines in red ink; red chalk used; foll. numbered in the right-hand margin; fol. 1a blank; so is the fol. 6rb ; yellow pigment used while making corre ctions; condition very good except that the last fol. is partly worn out in margins ; complete ; extent 2400 flokas ; there 5 is some space kept blank in the centre of the numbered and the unnumbered sides as well. Age.-- Samvat 1549. Author.-- Rajasekhara Suri, pupil of Sritilaka Suri of ' Maladharin ' gaccha. His additional Sanskrit works are as under :( 1 ) caturviMzatiprabandha prabandhakoza V. S. 1405. ( 2 ) dAnapAtraMzikA = ( 3 ) nyAya kandalI paJjikA. ( 4 ) ratnAkarAvatArikApaJjikA. (5) SaDdarzanasamuccaya. ( 6 ) syAdvAdakalikA = syAdvAda dIpikA. He has composed Neminatha-phagu in Gujarati. For other details see my Gujarati introduction to Caturvimsatiprabandha. Begins.-- fol. 1deg // 60 // OM namaH zrIsarvajJAyaH // zrIsarasvatyai namaH // aarat kAmina pariNayasyasyarthamAnoppa (ya) laM tataM gRhabhArakAtaratayA muktodyamo devara ! | mAzaMkara haripiMDa vijayI bhrAtA (S) sti te sarvado bhAmAyAbhiritIritasmitamukho nemirvazI pAtu vaH // 1 // Subject.--A collection of 84 small stories styled as 'antarakathas', 20 Names of some of them are noted by me while describing the Ms. No. 99. This work is named as Kathasara, Vinodakatha and Vinodakathasangraha, too. jayaMti guruvo'smAkaM vidyAvallimahIruhAH / 'maladhAri 'gaNAdhIzAH zrIzrItilakasUrayaH // 2 // 129 manovinoda tUnAM samAhaNAM yayA (thA) zrutaM / mayA kathAnAM hrasvAnAM kriyate saMgraho budhAH ! // 3 // etc. 1 This is published in grAcIna phAgu-saMgraha ( pp. 8-11 ). 2 Read ratnaprabhasUri for ' ratnazekharasUri ' on p. 10 ( fn. 4 ). 3 This verse supplies us with the name of this work as vinoda kathA saGgraha. 17 [J. L. P. J TO 15 25 30 35

Page #165
5 IO IS 20 25 30 [97. Jaina Literature and Philosophy Ends.fol. 61(c) kanakapuSyaiH pUjayitvA kRtAMjaligo (6) te lakSmai (kSmI) stavaitA ai fornmRtaM bhave yadicchayA bhavatyevetyani (bha) dhAya mahI (ha) tIM vibhUtimadadAt tato harItakIvaidyo jAto lIlAvilAsaH tyAgakaNNoM bhogapuradaraH / prAka (ka) puNyaprauDhI va (ca) pathyAvaidyakathA // cha // 84 // pariSada ( ) rasAvatArArtha maMtarakathAyAM (ghAM) / 'maladhAri' gacchanAthaH sUriH zrIrAjazekhara (:) kRtavAn // 1 // dviH pUrvArddhagItiH SaSTirmAtrA iti guNagI 130 vyAkhyAsamunIMdrANAM vAturvidyAvatArasArAsu pUjA suvarNaputraja iva phalinI bhavatvetAH // 2 // sugamaM navaraM kevalaM etA iti aMtarakathA prakramAyAtatvAt / aMtarakathAsaMgraho'yaM nAma graMthaH graMthAgraM zata 24 cha kalyANamastu || zubhaM bhavatu // cha || lekha (ka) pAThakayoH // cha // saMvat 1549 varSe zrIpattana nagare zrI 'vRhad gacchazrIdhaNadeva bhUrizrIdharmadevasUrIdhammaM siMhasUrazrIdharmmapadrabhUrizrI malayacaMdrasUritapaTTe zrImaNicaMha ( ? dra ) sUribhi: leSi // cha // Reference. Published by Kakalbhai Bhudhardas Vakil in A.D. 1918. The Gujarati translation of this work named as vinodAtmaka kathAsaMgraha is published by Jaina dharma prasaraka sabha in V. S. 1978. For additional Mss. see Jinaratnakosa ( Vol. I, pp. 11 & 357 ) . kathAsaGgraha No. 95 yAdRzaM purate (sta) ke dRSTaM tAdRzaM likhitaM mayA / yadi zuddhamazuddhaM vA mama doSo na dIyate // cha // cha // zrI // Size. 103 in. by 43 in. Extent - 38 folios; 16 lines to a page ; 5 4 letters to a line. Kathasangraha 21. 1873-74. Description. - Country paper thin, tough and greyish; Jaina Devanagari characters with occasional gears; small, quite legible, uniform and very good hand-writing; borders indifferently ruled in four lines in black ink; red chalk used; foll. numbered in the right-hand margin in a corner; red chalk used; there is some space kept blank

Page #166
99.] The Svetambaru Narratives 131 in the centre of the numbered and the unnumbered sides as well ; fol. 386 blank ; this fol. is torn; condition on the whole good; complete ; extent 2400 slokas. Age. -- Pretty old. Begins -- fol. 1a il nu il A DiaTija 11 OFTA Fraai etc, as in No. 97. Ends. - fol. 38a Egea: gaitear etc. up to siatutETA AIA 19:11 84 as in No. 97. This is followed by the lines as under : 900 280011 pt: 11 : Fortata di sf: 11 sat M. B.- For further particulars see No. 97. 1273. 15 20 kathAsaGgraha Kathasangraha No. 99 1884-87. Size.-- 105 in. by 4 in. Extent.- 34 folios ; 19 lines to a page ; 55 letters to a line. Description. Country paper somewhat thick, tough and greyish ; Jaina Devanagari characters with frequent TAS; small, quite legible, uniform and very good hard-writing ; borders ruled in two pairs of lines in black ink; red chalk used; foll. numbered in the right-hand margin ; fol. [a blank; so is the fol. 346; edges of some of the foll. slightly gone ; condition on the whole good; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; complete; there are in all 84 antar akathas ; some of them are as under : (1) FAJF4 f oll. 16 to 38 ( 2 ) TETHEU fol. 38 ( 3 ) [TUT foll. 38 : jb ( 4 ) farma YT (gtasan Eurat ) , 36 ( 5 ) JET-77891 fol. ( 6 ) TIEF#971 soll. 4a 6 , 30

Page #167
132 Jaina Literature and Philosophy [99. , 8-12) " " kathAnaka , 8 (7) kSullakakathA foll. 6' to 7(2) (8 ) gajatolanakathA fol. 7. (1) sapatnIkathA (10) nirvipatikathA (II) parivrAjakakathA (12 ) naimittikakathA (13) amAtyakathA ( 14 ) parasamayakathAnaka (15) kuntalAkhyazreSTiputra , dhuddhisauSThavakathA fol. " (16) zvazrUvadhukathA ____foll. ,, ,, (17) jaTAdharakathA , 1deg , 10'. Age.- Samvat 1497. Begins.- fol. 1deg 56 // yannekAmapi kAminI etc. as in No. 97. Ends.- fol. 34deg kanakapuSpaiH pUjayitvA etc. up to suvarNapuSpasraja iva phalinI bhavatvetAH // 2 // as in No.97. This is followed by the _lines as under : ityetA aMtarakathA samAptAH // prakramAyAtatvAt // 7 // zubhaM bhvtuH|| leSakapAThaka)yoH ||shriiH|| saM01497varSe poSasudi 3 'varddhanapure' zrI kharataraM gacche zrIjinavarddhana ripaTTe zrIjinacaMdapaTa(TTa)pUrvAcalasahasrakarAvatAra ... ... ... // paMDitakanakalaSitaM / / 7 / / zubhaM bhUyAt / / leSakapAThakayoH // zubhaM bhavatu : chaH // zrIH // 7 // N. B.--- For further particulars see No. 97. IS 20 25 kathAsaGgraha Kathasangraha No. 100 335. 1871-72. Size.- 10.1 in. by 48 in. Extent.-- 87 folios ; 16 lines to a page ; so letters to a line. Description.- Country paper somewhat thick, tough and white ; __ Jaina Devanagari characters with frequent pRSThamAtrA; sufficiently big, quite legible, uniform and very good handwriting ; borders ruled in two pairs of lines in black ink; in some cases space between these pairs is coloured red; 30

Page #168
Iot.] The Svetambara Narratives 133 10 red chalk used ; foll. numbered in the right-hand margin; unnumbered sides are decorated with a small disc in red colour in the centre only, whereas the numbered, in each of the two margins, too; some of the foll. badly worm - eaten ( vide foll. 19-28); condition on the whole tolerably good ; complete so far as the 1500 is concern. ed; the subsequent kai ha ends abruptly. Age.- Pretty old. Author.- Not known. Subject.- This work starts with a narrative of Vikramaditya. . Sometimes a narrative is in Prakrit. Vide fol. 36deg ff. Begins.- fol. I' 560 // namaH sarvajJAya / samastasa(?)tavistomasvacchamAnasahavikAM / kAmadhenumatISTAtau praNipatya srsvtiiN| 1 vidagdhAnAM pramodAya | stkthaanksNgrh| bahuzrutebhyo vijJAya vidhAsye(s)haM yathAmatiH / 2 siddhihetuH kadApyatra bhavet svapno(5)pi kasyacit // devAnukalyavaza to vikramAdityabhUpavat // 3 etc. Ends.--fo.1 87deg tato maarjaarH| tataH prathamanarake gtH| anaMtasaMsAre bhramaNaM krissyti| zreSTI dhane pAlya anazanaM gRhya 'saudharme' iMdrasAmya(mA)niko devH| krameNa 20 mokSaM ca // iti tRtIyANavate caturthAticAre varuNakathA // 5 // tappaDirUvaM davaM pi viyaM jo bhabvadavyamajjhami / vikiNai kiNai dukhaM / sAgaracaMdu va so ihiN||1 'naMdipure' nagare samaramakAre (ends abruptly ) Reference.- Over and above this work and the next two there are several anonymous works named as Kathasangraha. For their Mss. see Jinaratnakosa ( Vol. I, p.67). IS 25 30 kathAsaGgraha Kathasangraha 1272. No. 101 1884-87. Size.- 101 in. by 4g in. Extent.- 3 folios ; 28 lines to a page ; 70 letters to a line.

Page #169
134 Jaina Literature and Philosophy [101. 10 Description.- Country paper thin, tough and greyish ; Jaina Deva nagari characters with rare qelqis ; very small, fairly legible, uniform and good hand-writing ; borders ruled in two lines in red ink ; red chalk used ; edges of each and every fol. gone; condition on the whole tolerably good ; it appears that foll. must have been numbered in the right-haud margin ; of course, now none of these numbers is to be seen; it may be that each fol. which is complete by itself may be forming a separate work by itself and even then all the 3 foll. are put together ; complete. Age.- Samvat I524. Author. Not mentioned. Subject. - Narratives mostly in Sanskrit and at times in Prakrit ___ and Vernacular. The first is about cheapness of flesh. IS Begins.-- fol. 1* (50 // zrIratnazekharamarigurubhyo namaH / / ekadA zreNikasabhAyAmabhayakumArAdibahusamudAyayutAyAmeSA vArtA: bhUta // yada'ghunA kiM vastu sulabhaM etc. Ends.- fol. 36 roha javAsA gAdaha dANI / cyArai mUkai pAlAra pANI // jUnA kApaDa bUDhA Dhora / tehanA dAma leI giA cora // 1 jo suMbaDadaMbadvAmaNI nadA uutrnnlNc| DAhA hui ja paMDi A pahilaM te je paMca / / 2 / 7 zrI'tapAgacchanAyakazrIratnazekharamariziSyaziromaNipaMjinamANikya gaNicaraNasarasIruheNa bhramareNa sumatisAreNa likhitaM 'prahalAdanapure' saM(0). 1524 dvi. bhA. kathAsaGgraha Kathasaigrala 1325. No. 102 1891-95. Size.- Iot in. by 41 in. Extent.- 6 folios; 17 lines to a page ; 56 letters to a line. Description.- Country paper thin, rough and white; Jaina Deva nagari characters with rare pRSThamAtrA ; small, quite cgible, uniform and very good hand-writing; borders ruled in four lines in black ink; red chalk used%3; foll. numbered in 30

Page #170
102.] The Svetambara Narratives 135 the right-hand margin ; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; yellow pigment used while making corrections ; edges of all the foll. more or less gone ; condition on the whole good; complete ; this work contains the follow* 5 ing eight kathas : ( 1 ) vasatidAnaviSaye kurucandramantrikathA foll. 1 to 21 ( 2 ) zayanadAne padmAkarakathA fol. 24 (3) AsanadAne kArarAjakathA foll. 20 ( 4 ) AhAradAnaviSaye kanakarAjakathA ,, 32 (5) pAnAhAradAnaviSaye kathA fol. 4. ( 6 ) bheSanadAnavipaye revatIzrAvikAkathA foll. ,, (7) bastradAne dhvajabhujaGgakumArakathA (8) pAtradAnaviSaye dhanapatikathA Age.- Nor modern. Author.-- Not mentioned. Subject.-- Narratives pertaining to (1) residence ; ( 2 ) bed, (3) seat, (4) food, (5) drink, (6) medicine, (7) cloth and (8) a worthy person. Begins.-- fol. 12 e60 vasahI 1 sayaNA 2 saNa 3 bhatta 4 pANa 5 / bhesajja 6 vattha 7 pttaaii| jai vi na pajattadhaNo / thotrA vi hu thobayaM deI / / 1 / / ____ tatra vasativiSaye kurucaMdramaMtrikathA yathA // 'kuNAla' deze 'zrAvastyAM' AdivarAho nAma rAjA etc. Ends.-fol. 6deg sapAtraM sAdhubhyo dAtavyamityabhigraho gRhItaH / zrAddhadharmazca pratipannaH 25 krameNa devo jAtastRtIye bhave mone yAsyatIti // zrIsAdhupAtradAnaviSaye dhanapatikathA | chaH // iti zrImadupadezamAlAprokta vasahIsayA(ya)Na(NA). saNe'tyAdigAthAyAM zrImAdhudAnAviSaye'STau dharmadRSTAMtAH kathArUpA likhitaaH|| vAcyamAnA zrUyamANAzvAmI kalyANakArakA bhavaMtu // dAnaM supAtre vizadaM ca zIlaM / tapo vicitraM zubhabhAvanA ca . 30 bhavArNavottAraNasanaraMDa dharma caturdhA munayo vadaMti // 1 devapUjA gurUpAstiH svAdhyAyaH saMyamastapaH / dAnaM ceti gRhasthAnAM Sada karmANi dine dine // 2 // zubhaM bhavatu 20 1 This is v. 240 of Uvaesamialis. 35

Page #171
10 136 kathoddhAra No. 103 Size.- rog in. by 43 in. Extent.-- 18 folios; 17 lines to a page ; 65 letters to a line. 5 Description. - Country paper thin, tough and white; Jaina Devanagari characters with frequent gears; small, quite legible, uniform and beautiful hand-writing; borders ruled in three lines in red ink; red chalk used; foll. numbered in the right-hand margin ; edges of some of the foll. gone ; condition on the whole good; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; complete; a number of kathas given here: extent 1163 lokas. 15 20 25 Jaina Literature and Philosophy 30 Age.- Not modern. Author.-- Dharmasekhara Gani. He or his namesake is the author of caturviMzatijinastavana ( yamakramaya ) ( vide Vol. XIX, Sec. I, pt. I, No. 145 ) The same thing may be said about Mahopadhyaya Dharmasekhara who has commented upon Usabhapancasiya in Sanskrit and Gujarati as well. Vide Vol. XIX, Sec. I, pt. 1, No. 53. [103. Kathoddhara 1299. 1887-91. Subject. Narratives dealing with various topics. One of them is about the origin of the Digambara ( Botika) sect. Begins. fol.1 660 // zrI Avazyakasya kathA // kuto ( s)pi nagarAloko vityakSAta kazaMkayA / araNyaM zaraNIca kiMcidvairidurAsadaM // 1 apareyuH punastatrApyavaskaMdabhayAturaH / AttaprANaH palAyiSTha vimucya zakaTAdikaM // 2 etc. Ends. fol. 18b mA bhUloko virakto nastato ( 5 ) dya zATakaM dadau spA (sA) naicchad bAMdhavenokA (ktA ) brAhmo (S) yaM devatAkarAt || 15 koTavarazva dvau ziSya tena dIkSitau tataH ziSyapraziSyAdyaiH visRtoste (5)pi boTikAH // 16 iti boTikAnI saMbhavA likhita ||6| paMDitarAjapaM 0 dharma zekharagaNibhiH kRtaH kathAuddhAraH // graMthAgraM 1963 // 6 // zrIH // 6 // 35 Reference. -- Only this Ms. is noted in Jinaratnakosa ( Vol. I, p. 67 ).

Page #172
10. The Svetambara Narratives 137 kanakarathakathA Kanakarathakathia 823 (d) 1892-95. No. 104 Extent.- fol. 66 to fol. 9a. Description. -- Complete so far as it goes. wa 823 (al. For other details sees kurucandrakathA NO. 1892-25. 10 Author.- Not mentioned. Subject.- A narrative about Kanakaratha regarding donation of food etc. Begins.- fol. 60 AhAravirahiyANaM sisijAsaNamAipa(e)hiM vazUhi / hoina sAhAreto maNINa deyaM hitadANa // 1 // athAhAradAnaviSaye kanakarathasya kathA / / / atraiva 'bharate' 'vaitAnye' 'kanakapure' kanakaratho nAma rAjA sa 15 guNI vidyaasidyH(ddhH)| kadAcita vIracaryayAM nirgataH / etc. Ends. - fol. 8b krameNa dvayo dIkSA gRhItvA prAMte'zanaM gRhItyA svargagatiH saMjAtAH katipayabhavAMtare mokSaprApti // 4 // iti athapAlahAradAnAviSayakathA - kanakarathakathAnaka Kanakarathakathanaka 20 1310 (5) No. 105 1886-92. Extent.- fol. 5 to fol. 60. Description.- Complete. For other details see No. - No 1310 (1). - 1886 92. 25 Author.- Not mentioned. Subject.- A narrative about king Kanakaratha. Begins.- fo!.b AhAravirahiyANaM majjhAsaNamA'ehiM vacca(thU)hiM ho'nasuhAhAro to muNINa deyaM hi muNidANaM // 1 athAhAradAnaviSaye kanakarathasya kathA / / etc. Ends. - fol. 6b dvAbhyAmapi dIkSAM gRhItvA prAMte anazanaM ArAdhya svrggtirjaataa| katipayabhavAMtare mokSaprAptirbhavikSa(Syati / / iti kanakarathakathAnakaM // 4 // 18 [J. L. P.]

Page #173
138 Jaina Literature and Philosophy [106. lo kayavanAcatuSpadI Kayavannacatuspadi (kayavannAcopAi) ( Kayavannacopai) [kRtapuNyarAsa] [ Krtapupyarasa ] No. 106 654. 1892-95. 5 Size.- 91 in. by 4t in. Extent. - 25 folios; 14 lines to a page ; 32 letters to a line. Description. - Country paper thick, rough and white ; Jaina Deva nagari characters; big, quite legible, uniform and very good band-writing ; borders ruled in two lines and edges in one, in red ink ; red chak used ; foll. numbered in both the margins; fol. !' blank ; in the left-hand margin there is the title kayavannArAsa ; condition very good except that the last fol. is partly torn ; complete ; composed in Samvat 1721 in Vikaner. IS Age.- Sarivat 1815. Author.-- Jayaraiga, pupil of Punyakalasa, pupil of Dharma mandira. He is also named as Jetasi. His additional works are as under :(1) amarasena-bayarasena-copai V. S. 1700 (2) dazavakAlika( a. 1-10)gIta (3) dazavakAlikacUlikAgIta (4) dasazrAvakagIto. Subject. - A narrative of Kayavanna ( Krtapunya ) pointing out the importance of donation. 25 Begins.-- fol. 1 // 16 // zrIgaNesA(zA)ya namaH // duuhaa|| svasti zrIsuSasaMpadAdAyaka arihaMta deva zeva karoM sudhaiM maneM nAma japo nitameva 1 samarUM sarasati sAmINI praNamoM sadagurupAya kayavanA(nA)copaI ka dAnadharma dIpAya 2 etc. 20 30

Page #174
139 107.] The Svetambara Narratives Ends.--- fol. 350 kaviyaNavacane racanA kIdhI sarasa copaI e lIdhI jI micchAdukaDa adhika ucha meM do(dI)dho zubha soMce jI 940 saMbata sattaraseM ikavIseM (1721) 'bIkAnera' sujagIse jI AdIsara mUlanAyaka sohe bhavikalokamana moheM jI 10 gha. e saMbaMdha racyo mAnahita kAneM zrIjinacaMdasarIrAje jI bhaNatAM gaNatAM bahu suSa thAI saMNayo cita lagAI jI 11 dha0 zrIjinabhadrasarI suSadAI suratarUsASikadAI jI vAcaka zrInayaraMga viSyAtA vaDavaDA jasa avadAtA jI 12 dha0 vimalavinaya tasa zIsa virAje vAbi(ca)ka adhika divAjeM jI 10 zrIdharamamaMdira vayarAgI tAsu zIsa bahabhAgI jI 13 dhana mahopAdhyAya padavI soheM saMgha taNAM mana moheM jI muguru 'paNisakala subha nAmeM jAMNItA lasavANe jI 14 dha0 tAsa zIsa zrIjayaraMga boleM nahI koi dAna toleM jI dAna taNAM phala dIse cAvAM dina dina adhika divAje jI 15 dha0 15 sarasa DhAla na koI paDatI tIsa upari eka caDatI jI pUrI saMNatAM hIyaDo vikaspeM dharama karama mana UlaseM jI 16 dha. iti kayavanAnI copaIH // saMpUrNaH / / saMvata 1815 varSe jeSTasUdi6dineH vArasomeH // // kapUravijayagaNiH zrIH tatsISyalAlavijaya lapIkRtaM pAlaNapUragrAmaH // Reference. - For a list of additional Mss. and extracts from one of the Mss. see Jaina Gurjara Kavio ( Vol. II, pp. 165-168 ). On p. 165 this work is named as "kayavannA zAhano rAsa". 20 kayavanAcatuSpadI Kayavannacatuspadi 340. No. 107 1871-72. Size. - 91 in. by 4g in. Extent. - 24 folios; 15 lines to a page : 34 letters to a line. Description.- Country paper somewhat thick, tough and white; Jaina Devanagari characters ; big, quite legible, uniform 30 1 This ought to be puNyakalaza.

Page #175
140 Jaina Literature and Philo:ophy [107 and very good hand-writing ; borders ruled in two lines and edges in one, in red ink ; red chalk profusely used ; foll, numbered in both the margins ; fol. ja blank; in the left-hand margin the title is mentioned as kevanAgasa; condition very good; complete ; composed in 31 dhalas; 567 gathas. Age.- Samvat 1796. Begins - fol. 1 // 160 // zrIjinAya namaH // paMDitazrI5 zrInItyavimalagurubhyo namaH paMDitazrI5zrIratnavimalagurubhyo namaH 15 svasta(sti) zrIsuSasaMpadA etc. as in No. 106. Ends.- fol. 240 kavIyavacanaracanA etc. up to dharama karo manaulAmeM ce 1850 as in No. 106. This is followed by the lines as under: iti zrIkayavanAcopaI dAnaviSaye saMpUrNa // sarvagAthA 567 DhAla 31 saMpUrNa sakalapaMDitazrI5zrIvivekavimalagaNI taziSyasakalapaMDIta zrI zrI. nItyavimalagaNI tAMzaSyasakalapaMDitazrI5zrIratanavimala taziSyagaNI gajeMdrANagaNI rAjavimala taziSyagaNI yotyavimalalipIkRtaM AtmArtha bAcanArtha 'lADola grAme comAsu rahyA tAreM laSItaM // saMvata 1796 varSe Aso yadi 4 maMgalabAsare laSIta 'lADola'mA rupaiA 2 Ayapada thayA va je bAceke pAseM baMcAve laSe lagAve tasa ArogyaM kalyANaM subhaM bhavatu kalyANamastu N. B.-- For further particulars see No. 106. 29. 25 kayavanAcatuSpadI Kayavannacutuspadi No. 108 1877-78. Size.- 98 in. by 4g in. Extent.- 17 folios; 16 lines to a page ; 32 letters to a line. Description.- Country paper thin, rough and white , Jaina Deva ___nagari characters : sufficiently big, quite legible, uniform and very good hard-writing ; borders ruled in two lines 30

Page #176
109.] The Svetambara Narratives 141 and edges in one, in red ink; red chalk used; foll. numbered in the right-hand margin; fol. ryte blank; condition very good; complete. Age.- Old. Begins.- fol. 1 // 60 // zrIpArzvanAthAya namaH // // dRhaa|| __ svasti zrI suSasaMpadA etc. as in No. 106. Ends. - fol. 17 kaviyaNavacana etc. up to dharama karo mana ulaseM beH 34 dha0 practically as in No. 106. This is followed by the line as 10 under: iti zrIkaivannAcopaI dAna upari kathA saMpUrNaH (60)vivekavIjaya lipItaH N. B. - For additional information see No. 106. 20 karakaNDucaritra Karakanducaritra 1407. No. 109 1886-92. Size.-- 13 in. by 6 in. Extent. - 5+ folios ; 19 lines to a page; 30 letters to a line. Description.- Country paper ; Devanagari characters with occa. sional pRSThamAtrAs; fairly good hand-writing; foll. numbered as usual; fol. 1a blank; incomplete as this Ms, ends abruptly. Age.- Not modern. Author.-Not mentioned. According.to Jinaratnakosa (Vol. I, p. 67) the author is Jinendrabhusana, a Digambara, and this work is a part of his Jinendrapurana. Subject. -- Biography of king Karakandu. Begins. - fol. 10 // zratha karakuMDamahArAjacaritra liSyate // pArzvanAthajina vaMde vizvavighnIghanAzanaM kamaTho(s) pa sargadetyArinAzanaM sauSyakAraNa 1 athAnyatsatkathAM bachace zravaNAt kaluSApahAM zrotavyAM ca prayatnena bhavya(vya)jIvairhi sAdaraM 2 etc. 25 30

Page #177
[ 169. 142 Jdina Literature and Philosophy Ends.--- fol. 530 karakaMDurnRpo bhUtvA bhUpAlagaNavaMditaH tapastaptvA tataH kalpaM 'sahazrAra'mabApa ha 7 yaH pUjAM prativAzaraM bhagavataH zrImajineMdrave / __ cASTadravyalasatkarAMbujavaraH kuryAt svabhAvAnvitaH tatpuNyaM ( ends abruptly) 10 kalAvatIkathA Kalavatikatha No. 110 1310 (36) 1886-92. Extent.- fol. 360 to fol. 38'. Description.- Complete. For other details see .No. :D te For other details ces N 1310 (1) Author:- Not mentioned. Subject.-- A story of Kalavati depicting importance of chastity ( sila ). Begins.--- fol. 360 asti 'maMgala'dezevyo mahAzaMkhanidhAnavat / puraM 'zaMkha 'puraM nAmnA / khaMkhyalakSmIniketanaM // 1 etc. Ends.- fol. 38 rAjye (5)smin vinivezya pUrNakalazaM bhUmaMDalasyoccakai bhara maMtri.. prayojya paritaH paurAnaghA pRcchamatra padAMte mitatejaso vratamupAdAyAyuSAM te divaM yAtI to kramayogataH zivapadaM siddhAspadaM yASyataH // 12 iti zIlaviSaye kalAvatIkathA / cha / samAptA / miti // cha / Reference - Is this work same as the anonymous one which is designated as "kalAvatIkathA or kalAvatIcaritra" and of which some Mss, are noted in Jinaratnakosa ( Vol. I, p. 74 )? 20 - - kAlakAcAryakathA Kalakacaryakatha (kAlayAyariyakahA) ( Kalayayariyakaha ) ____1248 (b). No. 111 1891-95. Extent.- leaf 84* to leaf 95*. Description.- Complete ; 132 verses ; extent 164 slokar. For other details see Kalpasutra ( Vol. XVII, Part 2, No. sor). 30

Page #178
S 112.] The Sretambara Narratives 143 Author. - Not mentioned. Subject. - A story of Kalaka Suri ( son of Vajrasimha & Sura. sundari ) in Prakrit in verse. ___This story is mentioned by Prof. N. W. Brown in his "The Story of Kalaka" (p. 28) published from Washington ___ in A.D. 1933. Begins.-- leaf 84 || 0| aNusari AgamavayaNaM sirikAlayabhUrijagapahANehiM / pajjosavaNacautthI jaha AyariyA taha saNeha // 1 nAmeNa 'dharAvAsaM' asthi puraM jattha savabhaya mukko| vesamaNeNaM nAsIkaya va dIsaMti dhaNanivahA // 2 sIho va vayara sIho verimahAkarighaDANa duppeccho / taM pAlai naranAho devI surasuMdarI tassa // 3 kAlo nAmeNa suo tesiM vAlattao vi sa guNehiM / siyapakkhasasaharo iva kalAvise sehiM vitthario // 4 etc. Ends.-leaf 940 bhayavaM ! 'bharahe 'ahaNA kiM sakai [va] vannitu imeM koi / jANai bakkhANeuM kAlayamUri tti iya ( la )hai / sako gaMtuM pucchai 'kAlai(ya)sUri nigoyajIve u / kahiyA teNaM sakko pucchaha me kittiya(yaM) A( uN)|| uvautteNaM do sAgarAiM nAUNamAuyaM butaM / iMdo bhavati sakko pasaMsio jAi niyaThANe / / (sU)rI vi ya kAleNaM jANittA niyayaAuparimANaM / saMlehaNaM vihe aNasaNavihiNA divaM patto / / zrIkAlikAcAryakathA // gAthA 132 // zloka 164 // / Reference.- For additional Mss. see Jinaratnakosa ( Vol. I, p. 87). 25 30 kAlakAcAryakathA Kalakacaryakatha (kAlayAyariyakahA) ( Kala yayariyakaha ) No. 112 __14 (b) 1880-81. Extent.-- leaf 998 to leaf 131'. Description.- Complete. For other details see Kalpasutra ( Vol. XVII, Part II, No. 499 ). 1 His date and those of his namesakes are mentioned in "vIra nivArNa saMvata aura jaina kAlagaNanA" (pp. 64-66). 35

Page #179
144 Jaina Literature and Philosophy 112. I0 1 Author. - Not mentioned. Subject.- A story of Kalaka Suri in Prakrit. At the end a portion is written in Sanskrit. It, too, sheds light on the life of this very Suri. He is said to have transterred the date of the Paryusana' festival from the sth of the bright half of Bhadrapada to the 4th, a day earlier. Begins.- leaf 99* namo jinAgamAya // eyaM ca cautthIe jehiM kayaM sAmaNunnAyakarahiM / te uNa kAlayasUrI tesiM cariyaM nisAmeha / / cha / / 'asthi iheva 'jabu'dIve / dIve 'bhArahe' vAse / 'dharAvAsaM nAma nayaraM / tattha ya varivArasuMdarIvehacadikkhAgurU // vairisIho nAma raayaa| tassa ya sayalateuppahANA surasuMdarI nAma devI / tose ya sayalakalAkalAvapArago kAlayakumAro nAma putto etc. - leaf 1304 je guNaI tae pavayaNassa saM...' Ends.-- leaf 130deg nami ..... thoUNa sUriMdo ... sumaraMto sUri nimmalaguNo ...... 'sohamma'kappami // sUrI viya kAleNaM jaann......aauprimaannN| salehaNaM vihe aNasaNavihiNA patte / / cha / / iti zlokArthaH // cha // cha etc. zlokasaMkhyA 376(1) cha // cha / zubhaM bhavatu // cha.........lekhakapAThakayoH // cha / etc. , - leaf 131* vAptakevalAlokasaMpattiratizayasukhasaMpaccAnupamA / dharmaH puna ranAzravo mahAyogAtmako nirjarAphalo (la) iti zreyAn / aizvarya tu bhaktimarAbananatridazapativihitamaga...raNapratihAdirUpaM // cha / Then in smaller hand-writing we have :AropitaH pravaraparvasu parvazAkhI yeneSa bhaadrpdturydinaalvaale| zrIjainazAsanavane zubhasaMpade(5)stu ___ saMghasya kAlikaguruH sa girAmagAraM // 1 / / puNyarddhirvarAjaH prathayatu bhavatAmeSa kalpaprakAzo sAhaHpreSatkaSAyasthitiripunagarIbhaMgavistAriraMgaH // zrImansaM...pavAsatriziSaramukuTAlaMkRtaH kAlakAkhyA cArya(:) prAptapratiSThaH smitikRtmtistiikssnnsaanyaikshnH||2||ch|| 20 1 This passage occurs in "The story of Kalaka" (p.37) and in zrIkAlikAcAryakathAsaMgraha (p.6) edited by A. P. Shah and published as No. 3 of "zrI jaina kalA-sAhitya saMzodhaka kAryAlaya sirijha" in A. D. 1949. 2 Letters are not legible,

Page #180
113.] The Svetambara Narratives 145 kAlakAcAryakathA Kalakacaryakatha 1592. No. 113 1891-95. Size.- 10 in. by 44 in. Extent.- 14 folios ; 13 lines to a page ; 40 letters to a line. Description.- Country paper thin, rough and greyish; Jaina Devanagari characters ; sufficiently big, quite legible, uniform and beautiful hand-writing ; borders ruled in two pairs of lines in black ink ; yellow pigment used while making corrections; foll. numbered in both the margins; 10 fol. 1a blank except that six verses eulogizing some monks of the 'Kharatara' gaccha are written on it; there is some space kept blank in the centre of the numbered and the upnumbered sides as well; the title is written in the left-hand margin as kAlakAcAryakathA ; complete : condition IS very good. Age.- Samvat 1682. Author.- No! mentioned. Subject.~ A story of Kalaka Suri in Gujarati. Begins. --- fol. 10 ___ arhata bhagata utpannadivyavimalakevalajJAnabhAskara tadupadiSTa viziSTa e zrI paryuSaNA'parva tehanai samAgamana huyai hutai etc. Ends.-fol. 14deg zrIkAlakAcAryai ghaNao kAlasIma mahAvIrarA tIrtharI prabhAvanA karI AtmArtha sAdhI devaloka rai viSai devatA huA evaMvidha parva pramANa caDai teke harao prasAdavidhi caityAlaya pUjyamAna zrIzAsanAdhIzvara mahAvIra 25 guruparaMparAI zrIjinacaMdrasUrirI AjJA vahamAna zrIsaMgha AcaMdrArka jayavaMta pravatao zrIH iti zrIkAlikAcAryakathA samAptA chaH saMvat 1682 varSe zrI kharataraM gacche paM0mAnavijayamuninA(5)lekhi bhii| On fol. It we have : 30 namaH zrIvarddhamAnAya zrImate ca sudhamrmaNe / sarvAnuyogaddhebhyo / vANyai sarvavide tathA // 1 // ajJAnatimirAMdhAnAM / jJAnAMjA(ja)nazi(za)lAkayA / netramunmIlitaM yena / tasmai zrIgurave namaH // 2 // 19 [J.L.P.

Page #181
146 Jaina Literature and Philosophy [113. sArimu(d)dyotanaM vaMde / varddhamAnaM jineshvrN| jinacaMdraprabhu bhakrayA ()bhayadevamahaM stuve // 3 // zrIjinavallabhajinadattamarijinacaMdrajinapatiyatIMdrAH / lakSmI jinezvaraguruH / kurvatu sukhAni saMghasya // 4 // caMde jinaprabodhaM jinacaMdrayatIzvaraM ca jinakuzalaM / jinapadmasUrijinalabdhiAMjanacaMdrajinodayA jigyuH // 5 // bhviklokvibodhvibhaakraa| vimalayA kalayA(s)nvitAH // jnmnomtdaansurdrumaa| dadatu zaM jinarAjayatIzvarAH // 6 // -- kAlakAcAryakathA Kalakacaryakatha No. 114 423. 1882-83. Size.- 98 in. by 41 in. Extent.- IS folios ; I3 lines to a page ; 32 letters to a line. 15 Description. - Country paper thin, rough and white ; Jaina Deva nagari characters with occasional pRSThamAtrAs; very big, perfectly legible, uniform and beautiful hand-writing ; borders ruled in two lines in red ink; red chalk used; foll. numbered in the right-hand margin; fol. / ' blank ; 20 condition very good ; complete; composed in V. S. 1666. Age. - Pretty old. Author.- Samayasundara Gani. For details see Vol. XVII, pt. 2, No. 520 & pt. 4, No. 1356 and Vol. XIX, See I, pt. 2, Nos. 465 & 490. 25 Subject.- A story of Kalaka Suri in Sanskrit. It is partly in prose ___and parily in verse. . Begins.-- fol. b e zrIgurubhyo nmH|| praNamya zrIguru gadyapadyavArtAbhiraddhRtaM / / kAlikAcAryasaMbaMdhaM vakSe(kSye')haM ziSyahetave // 1 // 30 1 In Jinaratnakosa ( Vol. I, p. 88) No. XXIII (i.e. No. 114 ) is said to be composed by a pupil of Vardhamina Suri,

Page #182
15.] The Svetambaru Narratives 147 atra pUrva 'sthavirAvalI vyAkhyAtA tatra zrIkAlikAcAryo(s)pi mahAprabhA vakaH svaviro babhUva tena tasyApi saMbaMdha kathyate etc. Ends.-fol.15 tataH zrIkAlikAcAryAzciraM nirmala cAritraM pratipAlya prAMte anazanaM vidhAya samAdhinA devaloka prApuH evaMvidhA ete(5)pi zrIkAlikAcAryA mahAprabhAvakA sthivarA babhUvuH teSAM sabaMdha uktaH atha prabhAte 'sAdhusAmAcArI' / vyAkhyAsyate sA vartamAnayogena gurupaTTAnukrameNa vartamAnaguruzrIjinavarddhamAna sUrINAM prasAdena zrIsaMghena pravarttatAm / zrIrastu kalyANamastu / Reference.- Published along with the Kalpasutra and Kalpalata in the "Jinadatta Suri Pustakoddhara Fund Series" in A.D. 1939. For additional MSS. see Jinaratnakosa ( Vol. I, 10 p. 88, No. XVIII ). kAlakAcAryakathA Kalakacaryakatha 1228. No. 115 1886-92. Size.--98 in. by 4g in. ___ IS Extent.- 15 folios; 13 lines to a page ; 32 letters to a line. Description.- Country paper thick, tough and white; Jaina Devanagari characters ; sufficiently big, quite legible, uniform and good hand-writing ; borders ruled in two pairs of lines and all the four edges in one pair, in red ink; 20 at times the space between the lines forming a pair is coloured yellow; red chalk used ; foll. numbered in both the margins; the title is written in the left-hand margin in various ways such as kAlakA0, kA kAcArya and kAlakAcArya#91; fol, a blank; so is the fol. 156; condition very 25 good ; complete. Age.- Samvat 1934. Begins.- fol. 1 // 6 // il zrIsarasvata (tye) namaH // atha kAlikAcAryakathA liSyate // praNamya zrIguruM natvA ya(pa)dyatrAtAbhiradvataM kAlakAcAryasaMbaMdha vakSye('haM ziSyahetave 1 etc. as in No. 114. ___30

Page #183
148 Jaina Literature and Philosophy 10 -- fol. I3 yaduktaM tIrthodvAliprakIrNake / teNao (93) ya navasaehi (900) samaikvatehi vaddhamANAo / / pajjovasavaNa cautthIe / kAlagasUrihaMto (Tha)viyA // 1 vIseha diNehi kayyo paMcagahANIya kappachavayAe / navasaye teNue (993) haM bucchinnA taccha (tha) saMghaANAe // 2 // sIlohaNeNa ratnA(nA) saMghAeseNa kAriyo bhayavaM / pajosavaNa caucchi(sthi) caummAsaM caudisae // 3 // caumAsayapaDakapaNaM pa(ka)khiyAdavasaMmi caubiho / saMgho navasaiteNuhi (993) AyAraNaM paNAmaMti // 4 // Ends.- fol. 14 tataH kAlakAcAryAzciraM etc, up to teSAM saMbaMdhiH ukta as in No. 114. This is followed by the lines as under :-- atha prabhAte sAdhusamAcArI vakSyate sa vartamAnayogaH sAsvanAdhIzvara zrI. varddhamAnasvAmI zrIgotamasvAmI zrIsudharmAsvAmI gurukrame yAvajinadatta sUri zrIjinakuzalasUri zrIjinacaMdra sUri zrIjinasukhyamAraH zrIjinabhaktisUri zrIjinalAbhamUri Sa(ta) paTTAlaMkArabhaTTArakazrIjinacaMdrasUri tatpaTTe varttamAMnabhazrIjinaharSasurijI taNI AjJAyai saMgha pravatta 1 saMvat 1934 barve Amoja vadI 9 tIthau somabAsare lipIkRtaM zrIrastu kalyANamastu zrI nAgapura'nagare madhya lipIkRtaM zrIRSabhadevaprasAdAt zrIarihaMta devajI zrIvItarAga devajI // iti zrIkAlakAcAryakathA saMpUrNa lIpIkRtaH ka vAlacaMdajI tata(ta)siSya rAmacaMdra lIpIkRtaM // 'nAgapura'madhyeH // N. B.- For other details see No. 114. 25 kAlakAcAryakathA Kalakacaryakatha No. 116 251 (b). A. 1882-83. Extent.- fol. 61 to fol. 670. Description.- Complete ; 106 verses in all. For other details see ___Kalpasatra with tippanaka ( Vol. XVII, pt. 2, No. 538). Author.-- Not mentioned. 1 These four verses occur on p. 293a of the Kalpa-lata edition noted on 30 p. 147..

Page #184
117] The Svetambara Narratives Subject. A versified story of Kalaka Suri in Sanskrit. Begins. fol. 61a // zrIpravacanAya namaH // prabhAvanAM bhAvitAtmA / bhAvayAmAsa zAsane / yastasmai jJAnAneghaye / namaH kAlikasUraye // 1 // buddhivizudhyarthe / kAlikAcArya satkathAM / kiM na syAdagnisaMgena gAMgeyaM malanirgatAM ? // 2 / 'jaMbUdvIpe'sti 'bharate' 'dhArAvAsA 'midhaM puraM / nAnAmaNimayAvAsa mayUrvedradhanuH zritaM // 3 // tatrAbhavad vairisiMho nRpatiryasya vikramaH / stanebhakubhe'strINAM guMjAhAramiSAt sthitaH // 4 // guNaratnakhanirbhAryA (s) svAbhUt surasuMdarI / yA sUta kAlikaM putraM dInaM ratnamitraujasA // 5 // etc. Ends. fol. 67a kAlakAcAryakathA [ sacitra ] No. 117 iti stutiM cAru vidhAya vAsavo jagAma 'saudharma' divaM mudonmudA / nigraMthanAtho'nazanaM prapedivAna nijAyuSamadhAdhigatya saH / / 15 / / atha sa jagati kIrtticaMdra senAttamUrttiH / nikhilanihitavAmAsaMnivezyAbhirAgAM // amaraparivRDhasya prauDhaharSoddharasya / sadasi vinaya prApahAryaH saparyo / 6 (106) / / zrIkAlikAcArya kathAnakaM samAptamiti // cha // zrI // 50 // zubhaM bhavatu kalyANa'stu // 149 Kalakaciryakatha [ Illustrated ] 337. 1871-72. 5 To 137 20 Size. 11 in. by 48 in. Extent.--- 9 folios 7 lines to a page; 26 letters to a line. Description.- Country paper thin, tough and greyish; Jaina 10 Devanagari characters with garars throughout; very big, perfectly legible, uniform and beautiful hand-writing; borders ruled in two pairs of lines in black ink; the space 25

Page #185
150 laina Literature and Philosophy [117. 10 between these pairs coloured red; dandas written in red ink ; foll numbered in the right-hand margin ; unnumber. ed sides are decorated with a big disc in red colour in the centre only, whereas the numbered, in each of the two margins, too; the last verse is numbered as 64 ; fol. 1deg blank ; strips of paper pasted to foll. 1deg and 9deg ; edges of some of the foll. slightly gone; condition on the whole tolerably good; this Ms. contains six illustrations: the corresponding foll. are as under : 1, 3, 4, 5, 6a & ". ___Age.-Old ( early sixteenth century according to W. Norman Brown ).' Author.- Not mentioned. Subject.-- A story of Kalaka Suri. Is Begins- fol. 1" 5 6 75 1 zrIvIravAkyAnumataM suparva / kRtaM yathA 'paryukha(pa)NA'khyametat / / zrIkAlikAcAryavareNa saMghe / tathA caturthI zru(7)Nu paMcamItaH // 1 // samagradezAgatavastusAraM / puraM dharAvAsa mihAsti tAraM // ttraaribhuupaalkriiNdrsiNho| _ bhUballabho'bhUd bhuvi vajrasiMhaH // 2 // etc. Ends.- fol. 9 kRtyA svarUpaM praNipatya suuri| nivedya sImagharasanprazaMsAM // upAzrayadvAraviparyayaM ca / zako nijaM dhAma jagAma dRssttH|| 63 // zrImatkAlakasUrayazcirataraM cAritramAyujjvalaM / saMpAlya pratipadya cAMtasamaye bhaktapratijJA mudA // zuddhadhyAnavidhAnalInamanasaH svagAlayaM ye gatA ste kalpA(lyANaparaMparAM zrudharA yacchatu saMdhe (5)naghe // 64 // iti zrIkAlikAcAryakathA // 1 See The Story of Kalaka" (p. 98 ). This work "The Story of Kalaka" has been reviewed in " Acta Orientalia (Vol. XII, pts. III-IV, pp. 321-322 ), 35

Page #186
118. ] The Svetambara Narratives ISI Reference. Published at the end of the Kalpasutra in the D. L. J. P. Fund Series No. 18 in A.D. 1914. For an edition of this text and its English translation see "The Story of Kalaka" (ch. VII, pp. 98-101 ). In the preparation of this edition this Ms. and so more are utilized. For additional Mss, see Jinaratoakosa ( Vol. I, p. 8R). S *). 10 15 kAlakAcAryakathA Kalakacaryakatha (51HGITTEKET) ( Kalagayariyakaha ) [1 ] [ Illustrated ] 373. No. 118 1880-81. Size.- 104 in. by 41 in. Extent.- 13 folios; 7 lines to a page ; 28 letters to a line. Description.- Country paper somewhat thick, tough and white; Jaina Devanagari characters with frequent FEATS; very big, quite legible, uniform and beautiful hand-writing ; borders ruled in two pairs of lines in black ink; the space between these pairs coloured red; numberes for verses and their dandas written in red ink ; foll. numbered in the right-hand margin ; unnumbered sides are decorated with a big disc in red colour in the centre; the numbered, in each of the two margins; though the foliation starts with 8. Petc., this work begins abruptly; the numbering for the verses seems to be wrong: the last verse is numbered as 120; edges of the last fol. slightly gone; condition on the whole good ; this Ms. contains five 'illustrations ; the corresponding foll. are as under : 1b, sa, 76, 86 and 126. Age.- Pretty old ; perhaps early sixteenth century, Author.- Not mentioned. Subject.- A story of Kalaka Suri in Prakrit in verse. 20 2; 30 FT are respectively written i f. Tra, gir, TT, TETZT and by the side of illustrations 2. 4 respectively. 2 See " The Story of Kalaka" (p. 71 ).

Page #187
152 Jaina Literature and Philosophy [118. Begins.- fol. 1b // 50 // hayapaDiNIyapayAvo / titthunahakArau klaanilo| jayao jayANadayaro jugapavaro kAlagAyario // 9 // 'magahe' sudharA'vAse / pure purAsI nivo vayarasIho / surasuMdara tti bhajjA guNajutto kAlo putto // 10 // etc. Ends.- fol. 13 annatto vasahimuhaM kAu sakko gao saThANaMmi / taMbutaMtaM muNiNo vi susaMjamA jAyA // 19 // ia bohiaM bahuarA / divaM gayA gurugurUNa jugapparA / sirikAlagamUrivarA havaMtu bhavANa bhadda karA // 120 // iti zrIkAlikAcAryakathA // cha / Reference.- For an edition of this text and its English translation see " The Story of Kalaka" (ch. V, pp. 7:-86 ). In the preparation of this edition W. Norman Brown has used this Ms. and the next and 7 other Mss. For additional Mss. see Jinaratnakosa (Vol. I, p. 88). 10 - 20 kAlakAcAryakathA Kalakacaryakatha 1229. No. 119 1886-92. Size.- 104 in. by 44 in. Extent.-- 3 folios; 15 lines to a page; 55 letters to a line. Description.- Country paper thin, rough and white; Jaina Deva nagari characters with rare gris; small, quite legible, uniform and very good hand-writing ; borders ruled in two pairs of lines in black ink; red chalk used; foll. numbered in the right-hand margin ; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; a marginal portion of each and every fol. more or less gone; condition on the whole good; complete ; the last verse is numbered as 121. Age. - Pretty old ( seventeenth or eighteenth century according to W. Norman Brown)'. 1 See << The Story of Kalaka" (p. 71 ). 30

Page #188
120. The Svetambara Narratives 153 Begins.- fol. I. (50 // hayapaDiNIapayAvo etc. as in No. 118. Ends.- fol. 30 aMnatto vasahimuhaM etc. up to bhavANa bhahakarA as in No. 118. This is followed by the line as under : // 121 / / iti zrIkAlikasUrikathA samAptA // cha / shriiH|| N. B.- For other details see No. 118. 10 kAlakAcAryakathAvacUri Kala kacaryakathavacuri No. 120 287 (b). A. 1883-84. Extent.- fol. 43b to fol. 47. Description.-- This Ms. contains the tales of a Kalakacaryakatha composed in Prakrit; complete ; the extent of the entire Ms. 2085 Slokas. For other details see Kalpasutra (Vol. XVII, pt. 2, No. 546). IS Author.- Not mentioned. Subject. - A small Sanskrit commentary elucidating a Prakrit story of Kalaka Suri. Begins.- fol. 436 ____nayaraMmi 'dhArAvAse.' 'dharAvAsa nAmni nagare vairisiMharAjaH kAlika- 20 kumAraH AsIt / devIsurasuMdarIjAtaH etc. Ends. - fol. 47* tinni sae paNatIse (335) nigoyavakhAya kAligAyariuH 335 varSe[:] zrIvIranirvANadinAta kAlikAcAryo'bhUt tasmin bArake caturdaza pUrvANi abhUvana anena zrIkAlikAcAryeNa zrIparyuSaNAparva na parAvattitaM etatkRtaM pramANaM syAt nAnyayoH iti zrIkAlikAcAryakathAvacUriH cha ra anuSTubhAM sahasre dve paMcAzItyAdhike ( 2085) tathA / sarvagraMthAyametasmina(na) pratyakSaranirIkSaNAt 1 asmin zrIkalpasUtravRttigraMthe sarvagraMthAnaM 2085 zlokaH cha zubhaM bhavatu kalyANamastu // cha // cha / zrIH // cha // zrI / / : / chaH // // This is followed by some letters which are made 30 illegible by applying red pigment. 20 [J. L.P.

Page #189
154 Jaina Literature and Philosophy [121. 10 15 'kArtikasaubhAgyapaJcamI KartikasaubhagyapancamimAhAtmya mahatmya [jJAnapaJcamImAhAtmya ] [ Jnanapancamimahatmya ] [saubhAgyapaJcamIkathA ] [ Saubhagya pancamikatha ] [varadatta-guNamaJjarI [Varadatta-GunamanjarikathAnaka ] kathanaka ] 710. No, 121 [110a] 1899-1915 Size.- Ut in. by 4g in. Extent.- s folios ; 17 lines to a page ; 38 letters to a line. Description.-- Country paper tough and white ; Jaina Devanagari characters; big, clear and good hand-writing ; borders ruled in four lines and edges in one in red ink ; foll. numbered as usual ; complete ; the right-hand margins are variously decorated, e. g. fol. 156 with an illustration of an elephant; condition very good; composed in Samvat 1655. Age.-- Samvat 1858. Author.- Kanakakusale Gani, pupil of Somakusala. For a list of his works etc. see Vol. XIX, Sec. I, pt I, pp. 51-52. Subject. The importance of the fisth day of the bright half of Kartika month is pointed out in this work by narrating the story of Varadatta and Gunamanjari. Begins.- fol. 16 // 6 // zrImatapArzvajinAdhIzaM 'phalavadhi'purasthitaM / praNamya parayA bhaktyA sarvAbhISTArthasAdhakaM / / 1 / / zuklakArtikapaMcamyA mAhAtmyaM varNyate tthaa| bhavyAnAmupakArAya yathoktaM pUrva suribhI (bhiH) // 2 // yugmaM etc. Ends.- fol. 5. ye(e), vibhAvya bho bhanyA ! paMcamyArAdhanodyamaH / bhavabhItivibhedAya kAryo bhavanI(dbhiAradbhutaH // 49 // zrImat 'tapa'gaNagaganAMgaNadinamaNivijayasenasUrINAM / ziSyANunA katheyaM vinirmimatA kanakakuzalena // 50 // 25 30 1 This work ought to have been assigned a place just after No. 110.

Page #190
122.] The Svetambara Narratives 155 buddhapadmavijayagaNibhiH pravare(H) bhImAdivijayagaNibhizca / saMso(zo)dhitA katheyaM mUteSuraseMdu(1655)mitivarSa(rSe) // 51 // gaNivijayasuMdarANAmabhyarthanayA kRtA kathA mayakA / prathamAdarzi likhitA taireva 'meDatA'nagare // 52 / / iti zrIkArtike saubhAgyapaMcamIma(mA)hAtmyaviSaye varadattaguNamaMjarIkathA / smaaptaa| saMvat 1858nA vaSa mAga(ge)zi(zI)(rSa) 15 dI(di)ne pAdayAlavijayena likhitaM // sA / parasottame 'sINoramadhye / / Reference.-- Published by Hiralal Hamsaraj in A. D. 1925-1926. Also in Parvakathasangraha ( Part I) published in " Yaso- 10 vijaya Jaina Granthamala in Vira Samvat 2436. For additional Mss. see Jinaratnakosa ( Vol. I, p. 85). kIrtikallolinI Kartikallolini 240. No. 122 1873-74. 15 Size.- 104 in. by 41 in. Extent.-- 13 folios ; 13 lines to a page ; 48 letters to a line. Description.-- Country paper somewhat thick, tough and white; Jaina Devanagari characters with occasional pRSThamAtrAs; sufficiently big, quite legible, uniform and very good handwriting ; borders ruled in two pairs of lines in black ink ; red chalk used ; foli. numbered in the right-hand margin%3B there is some space kept blank in the centre of the numbered and the unnumbered sides as well ; yellow pigment used while making corrections; condition very good; com- 25 plete ; this work is divided into three adhikaras as under :Adhikara I (pratApa ) foll. 1 to 5 ,, II (kIrti ) , , 11 , III ( saubhAgya ) , , 13. Age.- Pretty old. Author.- Hemavijaya Gani, pupil of Kamalavijaya Gani. For his additional work see p. 121. __30

Page #191
156 laina Literature and Philosophy [ 122. 10 Subject.-- A Sanskrit poem eulogizing gang, want and HTMITT of Vijayasena Suri of the Tapa gaccha-the Suri who was born in V. S. 1604 and who died in V. S. 1671." Begins.- fol. I' e0|| OM namaH // aiMdraM vRMdamamaMdamodamabhajad yatpAdakAmAMkuza zreNyaMtaH pratibiMbanena mukuraprApte prayatnaM vinA / pArAvAramidumUrtiramalA vAgIzvarI sA stutI kuryAt koDimadetanUruhaguromAkAmullAsinam // 1 // rUpazrItanujanmane janamanApAthojalIlAline sphUrjatsvarNavareNyakAya[ka] rucaye jesaMganAmne namaH / vAdibAtamadekatArakabhidA kAtyAyanIjanmane bhUyAt sUriziro(5)vataMsamaNaye tasmai kamAjanmane // 2 // etc. Ends.-- fol. 13 zrIlAbhavijayaprAjJapratibhAzaradA bhRzaM / kIrtikallolinI jIyAta suciraM vimalIkRtA // 42 // nAnAzleSoktiyuktiprakaramakara(rai)bhUribhAvAbhidhAyi / ___ sphArAlaMkArakAvyavrajajalajayutA prauDha punnyprvaahaa|| siMcaMtI govilAsai vanavanamidaM kIrtikallolinIyaM / dhAmalIlAmarAlebhavatu sugahanA gAhyamAnA cirazrIH // iti 5 hemavijayagaNiviravite zrIkIrtikallolinInAmni samastasavihitAvataMsayugapradhAnazrIvijayasenasUrIzvaravarNane saubhAgyAdhikAraH // __ iti zrIkIrtikallolinI saMpUrNa / / 7 / / zubhaM bhavatu // 5 // Reference.--- For additional Mss. see Jinaratnakosa (Vol. I, p. 91). 15 25 1 For other details see Patlavalisamuceya (Part I, p. 160 ) and the Gujarati introduction (pp. 14-26 ) of Senapraspa.

Page #192
123. ] The Sretambara Narratives 157 725. kumArapAlacarita Kumarapalacarita ( stena-591979 ( Samskrta-DvyairayaAEIFTET ) mahakavya ) [ #T3-R0 ] [ Cantos I-XX] vivRti sAhata with vivrti No. 123 1875--76. Size.- 11 in. by s in. Extent, - 589 folios; 12 lines to a page ; 37 letters to a line. Description.- Country paper tough and white ; Devanagari chara- 10 cters; big, clear and fair hand-writing ; borders ruled in two lines in red ink; white paste used; numbers for foll, 1-25 entered twice as usual; the rest numbered once in the right-hand margin ; fol. 1a blank; some foll. revised and corrections entered in margins; both the text and its 15 commentary complete ; the former contains 20 cantos; the latter 17574 slokas in entext composed in Samvat 1312 in Palanpur. Age. - Samvat Allai 41. Author of the text,- Kalikalasarvajna Hemacandra Suri. For his life and works see Vol. XVII, pt. 4, pp. 154-156 & Vol. XVIII, pt. I, pp. 79, 179 and 490-491. Furthermore, my book entitled "A History of the Sanskrit Literature of the Jainas" ( Vol. I, p. 335 ) may be consulted. Author of the com.- Abhayatilaka Gani, pupil of Jinesvara Suri. 25. Upadhyaya Lasmitilaka is bis vidyaguru. This Abhayatilaka has composed nyAyAlaGkAraTippaNa known as "pazcaprastha. Fola EITTI", Subject. - The text serves two purposes : (1) application of grammar and ( 2 ) an account of the 'Caulukya' dynasty. 20 This mahakavya illustrates the first seven adhyayas of Siddhahemacandra and describes the life of the kings of the 'Caulukya' dynasty such as Mularaja, Bhima, Karna, Siddharaja Jayasimha and Kumarapala in Sanskrit. Its counterpart written in Prakrit in 8 cantos, deals with the 35 1 His life is narrated in cantos 16 to 20.

Page #193
1 S TO 15 20 25 30 158 Jaina Literature and Philosophy [123. eighth adhyaya of Siddhahemacandra and the life of king Kumarapala. The text is carefully elucidated by means of the Sanskrit commentary. Dvyasraya Eight qualities of t kedAra pAndurgA vaTa zambAkRtA Begins. - ( text ) fol. 20 I, 182 XX, 90 VII, 34 III, 141 XIX, 36 ahamityakSaraM brahma vAcakaM parameSThinaH / 'siddhacakasya sadbIjaM sarvataH praNidadhmahe // 1 // bhImakAMtoddhattodAttahiMsrazAMta guNAtmane / bhadraM 'caulukya vaMzAya ku( kala ) tasyAddAdasiddhaye // 2 // etc. asti svastikavad bhUmerdharmAgAre nayAspadaM / puraM zriyA sadA (ss ) liSTaM nAmnA ('S ) NahilapATakaM // 4 // etc. - ( com. ) fol. 1b iha zrIbhUrbhuvaH svastritayAhitAgni gema (bhito yasya vibhAsvarasya / bhAtaH sphuliMgAviva puSpadaMtau Naisadhacarita XIX,26 ... tajjyotirekaM paramaM namAmaH // 1 // etc. VII, 35 XIV, 37 XVI, 107 XX, 83. zrI pArzvanAtha janadattaguruprasAdAt Arabhyate rabhasato'lpadhiyA ( s) pi kiMcita / zrI hemacaMdrakRta saMskRta durgamArtha- zrI hemacaMdrAcAryAH zabdAnuzAsanavizeSahetu [:] zrIsiddhacakravartizrIjayasiMhadevavaMzAta (ba) dAta (ta) varNanAya ta (ca) dvayAzrayaM zabdAnuzAsana prayoga saMdarbha saMgrahasvarUpatayA sarvakAvyalakSaNalakSitaprabaMdhasvarUpatayA ca yathArthAbhidhAnaM mahAkAvyaM cikIrSataH ... namaskAraM cakruH etc. fol. 60 iti zrIjinezvara sUriziSyalezAbhayatilakagaNiviracitAyAM zrIsiddha hemacaMdrAbhidhAnazabdAnu0 dvayAzraya vRttau prathamaH sargaH samarthitaH 1 // etc. zrIyAzrayasya vivRttiH (tiH) svaparopakRtyai // 4 // ....

Page #194
123.] The Svetambara Narratives 159 Ends.- ( text ) fol. 5870 AyuSpAm bhava bhupatA ! na(3)i ajayana(3): zAntyAna(3) subuddhAna(3) vRSI(3)n / jiSNAta(3)varja tadai(4)da(nda)be jaya ciraM 'cau(4) lukya' cUDAmaNe ! // 5 mAnaNyIkaraNAt pravartaya nijaM saMvatsaraM cetpR(tyUoSi-... vAdhI(gho)Satsu sadA nRpaH padavidhiryadvat samartho(s)bhavat // 102 // ( com.) fol. 588 padavidhiryadvat samartho(s)bhavadityanena samarthaH padavidhiriti bhUtrArtho jJApitaH / zArdUlavikrIDitachaMdaH / / 102 aSTAviMzaH pAdaH samarthitaH iti zrIjinezvarasUrIziSyalezAbhayatilakagaNiviracitAyAM zrIsiddha- 10 hemacaMdrAbhidhAnazabdAnuzAsanadvanyAzrayavRttau viMzaH sargaH samarthitaH / / saMpUrNa cedaM mahAkAvyaM / tatsaMpUrNe ca tattirapi / zrI'cAMdre' vipule kule'tivimale zrIvarddhamAnAbhidhA cAyeMdrasya jinezvaroM'tiSadabhUt sUrijiAnAM ptiH| zrImadU(durlabharAjasaMsadai(di) vasatpa(tya)dhvAnamudho(yo)tya yaH / sAdhana sAdhuvihAriNA vyaracayacchI gurjara(rA)trA vanau // 1 // saMvegaraMgazAlA sudhAthapatve zivapathikahetoH // yAM(yoM)ta siddhipathaM tApaTTe sa jinacaMdrasUrirudait // 2 // tatpaTTe'bhayadevamarirabhavad yaH pArzvakalpadrumaM / ___sacchAya(yaM) zritadattavAMchitaphalaM zrI staMbhane 'ropayat / / 20 jaMtUnAM hitahetave'tra sughaTA arthe sa ydydrse| ___ saMpUrNAzca navAMgavRttisarasI(:) zreyorthya svaasaavytaa| 3 // tacchiSyo jinavallabho gururccaaritrypaavitrytH| sAroddhArasamuccayo nu nikhilazrItIrthasArthasya yaH / / [5]siddhAkarSaNamaMtrako nykhilsdvidyaabhiraaliNgnii(naat)| kIrtyA sarvagayA prasAdhitanabhoyAnAyavidyo dhruvaM / 4 // tatpaTTobarasUraDaMbaradharaH kRSNAtirdaivataiH sevya : zrIjinadattamariravibha: prAiyAM yugAgrIyatAM // kenApyaskhalita[]pratI(tA)pazu(ga)ruDo yasya trilokyA sphura trATa (voTa)mayAsyate(ti) zritaMbatAM vighnAhipAzAna kSaNAt 5 30 tatpaTTAcalacUlikAMcanamalaMcakre'STavarSo'pi sa ___ zrIsAMdro jinacadrasUrisuguruH kaMThIravA (bho)pamaH / / yaM loke(ko)ttararUpasaMpadamA(ma)rekSya svaM puliMdopamaM matvAno nu dadhau smarastaducitAMzcApaM zarAna paMva(ca) caH6 (A)ruhya kSitibhutsamAcaturikA nirjitya durvAdina-- ___35 stedro joDIno(nau) jjvalite lasatyanudi(zaM) nAde yazoduMdubhiH

Page #195
160 Jaina Literature and Philosophy [123. pANIkRtya jayazriyo gurumaharyaH sAradAM mAtaraM / pRthvIM conmuditAM ugadhAjinapatiH sUriH sa jajJe tataH // 7 // prAsAdottamatuMgazRMgasubhagaM paryaskaroda tatpadaM zrImAna sUrijinezvaro'tra bhagavAna gAMgeyakuMbhaprabhaH / / mAdhuryAtizayapriyA nirupamA yadvAcamanvahato nUnaM sA(5)pi sitA su(mu)dhA ca lavaNaM vArIva cautAraNaM 8 / yo rUpAtizayAd vidUSakamivAnagaM hasatyaMjasA saumyatvAnna(nnu) dadAti lakSmamiSataH patrAvalaMbaM vidhau / nAnAsiddhiramAdrutAna karakajAjitvaikalakSyAzritaM padmaM cAttatRNAnanaM vitanute mA(ma)nya nye) mRNAlacchalAt / 9 / sUrijinaratna iha buddhisAgarasudhI ramarakIrtiH kaviH pUrNakalaso(zo) budhaH / jJo(jJau) prabodhedugaNilakSmitilako pramo dAdimUldayo yadvineyottamA 10 sagurostasyAdezAt sa karNakarNotsavaM vivRtimetAM / svamativibhavAnusarAnmunirvAdhAdabhayatilakagaNiH // 11 // AmnAtI sarva(vidyAsvavikalakavitAkelikeli(lI)nivAmaH koyAbdheH pAradRzvA tribhuvanajanatopakriyAsvAttadIkSaH / niHzeSagraMthasAthai mama guru[:] riha tu dvayAzrayeti prakAmaM TIkAmetAM sa lakSmItilakakavi(ravi): zodhayAmAsa samyaka / 12 ayye dvAdazabhitrayodazazate (1312) zrIvikramAbdeSviyaM / zrI pralhAdanapattane zubhadine dIpotsave'pUryata / meghAmAMdyamadAt kathaMcidiha yaccAyuktamukta mayA ___ zodhyaM svalpamato(to) prasadya mayi tannimatsare (3)dhire(rai): 13 // saptadaza sahasrANi zlokAH paMca zatAni ca / catuHsaptatirapyasyA vRttermAnaM vinizcitaM // 14 / prakrIDatparimAdyadAMgasubhagA zva(zrI)bhUrbhuvaHsvastrayI sarveSAM parameSTinA sitayazobhizvetitA sarvataH / yI(yA va dIpamahotsavaM pravibhRte teSAM pratApajvalad dIpastAvadiyaM karotu vivRttiH pra(prAjyaM surAjyaM bhuvi / 15 // 7 // iti zrIyAzrayagraMthatatiprazastisaMpUrNa // 7 // zubhaM bhavatu dvitIyapa(khaM)i(Da)graMthAnaM 8858 sakalagraMthAnaM 17574 7 // zrIkalyANamastuH 7 // saMvata allAI 41 varSe

Page #196
124.] The Svetambara Narratives 161 10 Reference. - Both the text and its commentary edited by Prof. A. V. Kathavate are published in two parts in "The Bombay Sanskrit & Prakrit Series" as Nos. LXIX and LXXVI in A. D. 1915 and 1921 respectivey. The first part deals with the first ten cantos whereas the second with the remaining ten cantos. This second part is furnished with a synoptical statement prepared by D. K. Agashe. Therein he has noted main differences between the grammar of Hemacandra Suri and that of Panini. Further, in this part contents of all the 20 cantos are given in Sanskrit. The first canto along with the first eight verses of the second together with Abhayatilaka Gaoi's com. on them is given as Appendix II ( pp. 93-135 ) in " TATISTIT19ETTATH" published by " Jaina Grantha Prakasaka Sabha". in V. S. 2007. The Gujarati translation of all the 20 cantos by Manilal Nabhubhai Dvivedi is published by "Gaekwad Desi Kelavani Khata" in A. D. 1893. He has given in Gujarati a short summary of all the 20 cantos and dates of the rulers of the Caulukya dynasty. For additional Mss, of the text and those of its commentary see Jinaratnakosa ( Vol. I, p. 186 ). 15 20 22. 25 'kumArapAlacarita Kumarapalacarita No. 124 ( 122 ) 1880-81. Size.-- 164 in. by 24 in. Extent. - 183+2+4+7= 196 leaves ; s to 6 lines to a leaf ; ss to 60 letters to a line. Description-- Palm-leaf grey and brittle ; Jaina Devanagari chara cters with frequent FAITIS; big, fairiy legible and tolerably good hand-writing ; the entire work seems to be divided into two columns, but, really speaking, it is not so since the lines of the first column extend to the second ; borders of each of the columns juled in two lines in black ink ; 1 This work and the next ought to have beon treated just after the work No. 122, 21 (J. L. P.)

Page #197
162 Jaina Literature and Philosophy [ 124. leaves numbered only in the ordinary numerical characters, and that, too, in the left-hand margins; three leaves have been numbered as 93 and two each as 94, 95, 96 and 97: leaves in the beginning are broken and they are stuck together; the writing on the first 65 leaves seems to be older than that on the following leaves; the entire work, 2828 slokas in extent, is divided into 20 sargas ; the extent of each of them is as under :Sarga I leaves 11 to 142 verses 201 14 y 24deg , 110 >> 160 IV 142 VI 107 VII 142 VIII 125 IX 172 kh XI 1096 XII XIII 1 358 45 94 0 0 0 842 946 1006 90 U18 - 81 T0 IIO XIV 1312 74 97 XV 1398 1 24 XVI >> 1478 XVII >> 147 1556 XVIII 1556 1656 , XIX 1656 y 174* , XX 1748 , 1836 1) 102 leaf 1836 is followed by 7 extra leaves, one of them being blank on both the sides ; leaf 101a blank; leat 102b numberd as oft, leaf i as ut, leaf 2 as etc.; on 106 137 >> 203 zrI leaf 1 something is written ; it is preceded by the leaves on both of which something is written. Age.- Pretty old. 3

Page #198
125.] Begins.-- leaf 1* ahamityakSaraM brahma vAcakaM parameSThinaH etc. as in No. 123. Ends. leaf 183deg ityAcArya zrIhemacaMdrakRtau 'caulukya vaMze dvayAzrayamahAkAvye viMzaH sargaH // graMthasaMkhyAcAM zloka 2828 zivamastu // 6 // maMgalaM masazrIH || zubhaM bhavatu lekhaka pAThakayoH // 6 // On a leaf preceeding leaf 1 we have: The Svetambara Narratives *****. 218 varSe zrAvaNamAse paMmArahaNasya nibaMdhaH uttiSThatyA ratAMte etc. N. B. -- For addditional information see Nos. 123 & 128. kumArapAlacarita sarga (3-10 ) No. 125 ( 122b ) 163 Size. -- 8 in. by in. Extent.-- 57-19= 38 folios ; 13 lines to a page ; 37 letters to a line. Description. Country paper tough and whitish; Devanagari characters with occasional garais; smail, legible and good hand-writing; borders ruled in two lines and edges in one, in red ink ; foll. 1-19 lacking ; yellow pigment used ; fol. 29 wrongly numbered as 30; the subsequent one also numbered as 30 and then the following as 31, 32 etc; incomplete; for it begins abruptly with the second hemistich of the 78th verse of the 3rd canto and ends with the 3rd foot of the 3oth verse of the roth canto. Age.- Fairly old. Begins. fol. 20 Kumarapalacarita ro ( Cantos III - X ) 1377. 1891-95. aMtikAd gururAzAste gAyanAzvAMtika jaguH / ( 178 // ) sthAsyAvaH sukhamayAvAM bhAsyAmo'ya vayaM zriyA iti turya pratiravairjAtaH smaiva rodasI 71 etc. 5 IS 20 ityAcAryazrIhemacaMdraviracitAyAM vA zabdAnuzAsanadvayAzravavRttI SaSThaH 30 pAdaH samarthitaH // 6 // 25

Page #199
164 Jaina Literature and Philosophy [125. Ends.-- fol. 576 smRdhI(pI)Ta gonI(bI) bhavateSTadevI / pragopitA pA smariSISTa devI / yat te vittI ts(ru)khNdddhotrii| W gig! Frutaal AT:18311 raMdhimainaM ta(na) na kiMtu redhamA pisphAyiSuryo madanaM na vAtA // pisphAmRrastvasya nircAyatA ( ends abruptly ) N. B.- For further particulars see Nos. 123 & 128. 10 IS Aralganta Kumarapalacarita vivRti sahita with vivrti 225. No. 126 1902-1907. Size.- 11 in. by 4. in. Extent. - 212+6=218 folios; 13 lines to a page; 52 letters to a line. Description.- Country paper thin and greyish ; Devanagari chara cters with patais; bold, big, legible and elegant hand-writing; every fol. divided into two columns but the written portion is not so divided; for lines extend from one column to another ; each column has its borders ruled in sour lines in black ink ; red chalk used; numbers for foll. entered twice as usual; fol. r* blank; this Ms. contains both the text and its commentary as well ; both complete ; a piece of white paper of the size of a fol. pasted to fol. 1*; strips of paper pasted to fol. 2126 and a piece of paper affixed to it; foll, 1-6 written on a different sort of paper seem to be added later on ; they contain errata. Age. - Pretty old. Begins.- ( text ) fol. 2a BELAITETA etc, as in No. 123. -( com. ) fol. 16 V : etc. as in No. 123. 25

Page #200
127.] Ends. -- ( text ) fol. 211 - The Svetambara Narratives AyuSmAn bhava etc. as in No. 123. ,, - ( com. ) fol. 211 padavidhiryadvat samartho etc. up to the end of the f as in No. 123. Then we have :-- dvitIya khaMDa graMthAgraM 8858 // bhakalagraMthAgraM 17574 // cha // tejolakhitaM // 67 // 5 // zubhaM bhavatu // 6 // prAgvATe jJAtIyavaDalIvAsivya 0gehAsako graMthaH // N. B. -- For further particulars see Nos. 123 & 128. Begins. (text) fo!. 3* 165 kumArapAlacarita vivRti sahita No. 127 Sizc.- 100 in. by 43 in. Description. IS Extent. - 260 folios ; 14 lines to a page ; 40 letters to a line. Country paper tough and white; Devanagari characters; big, clear and good hand-writing; borders ruled in three lines and edges in one, in red ink ; numbers for foll. entered twice as usual; foll. 57 etc. also numbered as 1, 2 etc. in the right-hand margin; fol. blank; this Ms. contains both the text and its commentary; both begin abruptly ; otherwise complete ; whitish paste used ; a small portion of fol. 58b blank. Age. -- Not old. bhImakAMtoddhRtodAtta etc. as in No. 123. Kumarapalacarita with vivrti 727. 1892-95, ,, - ( com. ) fol. 1 parisavAdaM parikkhAvaM parisavadaM parikkhadaM pIparisa vadatha nRptAnbhImo'tha iti ceyagAt etc. arhamityanena zabdAnuzAsana sUtrAdisthe 'rhamiti namaskAraH sUcitaH akSaraM brahmetyAdinA ca vRttiH sUcitA athaitatkAvya nAyaka vaMzamAzIrvAdapUrva prazaMsannAha etc. S 10 20 25 30

Page #201
5 10 IS 20 25 30 166 Ends. (text) fol. 259b Jaina Literature and Philosophy " ig etc. as in No. 123. -(com.) fol. 259deg qafafaza etc. up to the end of the fa as in No. 123. This is followed by the line as under iti zrAzrayakAvyaTIkA samAptA. N. B. For additional information see Nos. 123 & 128. [127. kumArapAlacarita [ sarga 1-14] fagia aika No. 128 Size. 10 in. by 4g in. Extent. 293+2 = 295 folios; 15 lines to a page; 52 letters to a line.. Kumarapalacarita [Cantos I-XIV] with vivrti Description. Country paper tough and greyish; Devanagari characters with ggarars; small, clear and good hand-writing; borders ruled in four lines in black ink; red chalk used; yellow pigment, too; numbers for foll. 1-88 entered twice as usual; foll. :65-286 also numbered in the righthand margin as 1, 2 etc.; foll. 215 and 243 repeated; foll. 260, 261 etc. wrongly numbered as 360, 361 etc. and later on corrected; foll. 1 & 293b blank; fol. 82a partly blank and fol. 82 entirely so; same is the case with fol. 164; foll. -36 more or less worm-eaten; some foll. seem to have stuck together; a careless attempt to separate them has resulted in damaging them e. g. foll. 28, 30, 37 & 60; this 'Ms. contains the text and its commentary as well incomplete; for this Ms. ends with the 36th verse of the 14th canto of the text. Age. Not modern. 1 It is utilized for the printed edition (BSPS) noted on p. 161. 404. 1879-80.

Page #202
129.] Begins. (text) fol. 2a f etc. as in No. 123. "3 (com.) fol. 1: etc. as in No. 123. Ends. (text) fol. 293a dr - The Svetambaru Narratives 66 saMbhASi (tu) taM nRpani( ti ) ( na ) mamlo // 36 // ( com. ) fol. abedI ( dI tU / prAkramata | avidat / kSamate Apnot / mamlo | yuyuje / aviyanAzvalaM icchArtheSu / eSIdityatra zakadhRSetyAdinA tum // viMzapAdaH // Reference. Ramlal Chunilal Modi has written a book named as under: - 'saMskRta dayAzraya kAvyamA madhyakAlIna gujarAtanI sAmAjika sthiti". This Gujarati book is published by the Gujarat Verna- 15 cular Society in A. D. 1942. N. B. For additional information see No. 123. apArayat prAkSu kra ) mavA ( tA ) dhyasvA ( vA ) sya daviyatAle kSamati (te ) sma vA ( cA )pnot // (t)dzagie qu( y )a fazsi | kumArapAlacarita ( sarga 1 - 10 ) fagia aika No. 129 167 Kumarapalacarita (Cantos 1-10) with vivrti 1374. 1887-91. Size.-101 in. by 43 in. Extent. X70-2+3 = 171 folios; 17 lines to a page; 57 letters to a line. 5 10 Description. Country paper thin and greyish; Devanagari chara- 25 cters with gerais; small, clear and good hand-writing; borders ruled in three lines in red ink; red chalk used ; foll, numbered as usual; fol. 170b blank; a corner of the second fol, and that of fol. 114 worn out; upper edges of some foll. damaged perhaps owing to their being eaten away by worms; foll. 58, 130 & 167 repeated; foll. 1 and 119 lacking; otherwise both the text and its commentary complete so far as the first ten cantos are concerned. 20 30

Page #203
168 Jaina Literature and Philosophy [129. Age.- Pretty old. Begins. - (text) fol. 20 ahamityakSaraM etc. as in No. 123. ,- (com.) fol. 2* ahamiti varNasamudAya sarvataH sarvasmin kSetre kAle ca praNidadhamahe etc. as in No. 123. ___Ends.- (text) fol. 170* prakRtotsavaiH so'nugato mudaM gate ramRtaM nu pItairvinipIta IkSaNaiH / rucirAsitaH kuMjarapRSTa AsitaH / 10 ___ sadanaM prayAto 'bhAnupate vAsavaH // 90 / / ,-(com.) fol. 170deg sadanaM prayAtaH / abhyanuzatavAsavaH akarmakaH / AsitaH rucirAsitaH / amRtaM pItaiH / sa vina(ni)pItaH / atra gatyarthetyAdinA kno(kto) vA kartari / / 90 // iti...dazamaH sargaH samApta // iti zrIjinezvaramUriziSyalezAbhayatilakagaNiviracitAyAM zrIsiddha. hemacaMdrAbhidhAnazabdAnuzAsana dvadyAzrayavRttau dazamaH sargaH samAptaH // cha / graMthAnaM // cha / zubhaM bhavatu lekhakapAThakayozca // cha / N. B.- For additional information see Nos. 123 & 128. - kumArapAlacarita Kumarapa lacarita (sarga 1-3) ( Cantos 1-3) vivRti sahita with vivrti 405. No. 130 1879-80. Size.-- 10t in. by 4g in. Extent.- ( text ) 25 folios ; 8 to 9 lines to a page ; 36 letters to a line. ,, - (com.), " ; 7 , , , , : 52 " " a line, 1 The correct reading is "'bhyanuyAtavAsavaH".

Page #204
131.] The Svetambara Narratives 169 Description-Country paper thin and white; Devanagari characters with ars; small, clear and good hand-writing; borders ruled in three lines; red chalk used; yellow pigment, too; this 'Ms. contains both the text and its commentary as well; it is a qP Ms.; foll. numbered as usual; the 14th fol. partly damaged; so are foll. 18 & 19; edges of the first and the last foll. slightly damaged; complete up to the 6th pada; the text ends with the 85th verse of the third canto, so incomplete; for, it contains 20 cantos. Age.- Fairly old. Begins. (text) fol. 1 dr - (com.) fol. 1 Ends.- (text) fol. 25b kumArapAlacarita ( sarga 1 - 3 ) fagfa afza No. 131 13 etc. as in No. 123. : etc. as in No. 123. --- graent@gee21(x41)fagrese(s): << affu | namaH karoti sma mahAlakSmI (kSmyai) bhaktibharapuraskRtaH / 85 / / ityAcAryazrIhemacaMdraviracitAyAM zabdAnuzAsanadvayAzrayamahAkAvye SaSThaH pAdaH samArthataH // ,,--(com.) fol. 25deg carisA (tA) (rthAnupAtini ca zabdAtmani rUDhitastaka. 20 (ta) liMga saMkhyopAdAnavyavasthA (S) nusarttavyA / SaSThaH pAdaH samAptaH / iti bhadraM // N. B. For other details see Nos. 1.3 and 128. Size.-10 in. by 4 in. Extent. (text) 20 folios; 8 lines to a page; 35 letters to a line. (com.),, ; 20 ,, per column 14; "" Kumarapalacarita (Cantos 1-3) with vivrti dr 743. 1899-1915. I It is utilized for the printed edition (BSPS) noted on p. 161. 22 [J. L. P.] wr dr dw S 10 15 25 30

Page #205
170 Jaina Literature and Philosophy [13. Description.- Country paper very thin, tough and white; Jaina Devanagari characters with frequent pRSThamAtrAs; this is a pazcapATI Ms. containing the text and its commentary; the former written in small, quite legible, uniform and good hand-writing , same is practically the case with the latter except that it is writien in smaller hand-writing ; borders ruled in three lines in red ink ; numbers for the verses and their dandas written in red ink; foll. numbered in the righthand margin ; in the centre of the numbered and unnumbered sides as well, there is some space kept blank ; sometimes the central portion of each of the margins is also kept blank; at times these blank spaces are decorated; e.g. the marginal portion on fol. 66 decorated with a nandya. varta ; complete so far as the first six padas are concerned ; the text ends abruptly with a portion of v. 87 of the 3rd canto; condition very good except that edges of a few foll. partly gone. Age.-- Pretty old. __Begins.- (text) fol. .. | MUl! ahamityakSaraM brahma etc. as in No. 123. , - ( com. ) fol. 1 || 10 // namaH ___ ahamiti varNasamudAyaM / / parameSTino(5)hato. vAcakaM / ata evAkSara brahma etc. as in No. 123. Ends. - (text) fol. 200 ya(yu)vAmacyauM gRhAlakSmyA yUyamasya bhujAviti // kalyANatilakAkRSya(STA) jA(dA)rA da(ja)gurivAlita (nH)|| 82(3) // godo(do) grAma khalatikaM dhanAni dezamaimakAn / bhoktAro'nye(s)pi bhUyA(pA)staM / namaskRtyAgrato(s)bhayan / / 83(4) / / iti zrIhemAcAryapraNIte dvayAzraye SaSThaH pAdaH samarthitaH ||shriiH|| 19 // puraskelipurasyA(spA)tipurasyuktaH sa te(te)vibhAn / namaH skaroti sma mahAlakSya bhaktipuraskRtaH // 1(85) sthitaM pAdaM tiraH kRtvA tiraskRta(nya) giriM gajaM / tirakRtAriH so'dhyAta tirakRtvA raviM viSA // 2 (86) puMsphAlgunaH sa pusyAtA mattapuMskariNastadA zi (ends abruptly) 20 25 30 35

Page #206
132.] Tlse Svetambara Narratives 171 Ends. -- (com. ) fol. 200 TRATAFITI at TA I wat aat 1 saliMgasaMkhye bastuni syAdvAdamanupatati mukhyopacaritArthAnupAtini ca zabdAnmani rUDhitastalliMgasaMkhyopAdanavyavasthA'nusatavyAH SaSThaH pAdaH samAptaH // 7 // Il soft lill N. B. - For further particulars see Nos. 123 & 128. kumArapAlacarita Kumarapalacarita (art 2-3) (Cantos I-III) TippaNaka sahita with tippanaka 194, No. 132 1872-73. Size -10% in. by 43 in. Extent.-- 12 folios ; 16 lines to a page ; 45 letters to a line. Description.- Country paper very thin, tough and greyish ; Jaioa Devanagari characters; the text written in sufficiently big, fairly legible and tolerably good hand-writing; the tippa- 15 naka written in very small hand-writing in the margins; borders ruled in two lines in red ink; red chalk used; foll. numbered in the right-hand margin; in the centre of the numbered and unnumbered sides as well, some space is kept blank; at times this space as well as each of the cen. 20 tral portions of the margins are decorated with a red spot ; the tippanaka abruptly ends; the text goes a little bit ahead of the sixth pada i.e. up to a portion of v. 92 of the third canto ; yellow pigment used for making corrections ; condition very good ; fol. 126 blank. Age.- Not modern. Author of the tippanaka.- Not mentioned. Subject.-- The text together with its brief explanation. Begins.- (text) fol. a GOI BELI 37fACINI a etc. as in No. 123. 1 - (tippanaka) fol. r Elara nugari Fiata: ASITAT NIETO e stfora sot etc. 30

Page #207
172 Jaina Literature and Philosophy ( 132. Ends.- (text) fol. 124 jyotiSkAmyatsu dhUHkAmyana dhanuSkalpadhruvaM striyaM / FAOLA171(501)sti *#i Sha II 8811 duSprApazakunAnyAviSNu(pu)Nyo(NyA)nyAviSkRtoyamaH The Ms. ends thus. >> (tippanaka) fol. So star warha: PUEDE I widacini=amara vijJAnmadiha na syAta(ta) tatitrINAM N. B. - For additional information see Nos, 123 & 128. kumArapAlacarita Kumarapalacarita 10 [BartalSata] [ Kumaravalacariya ] ( a 271977 ( Praksta-DvyasrayaAEFTETT) mahakavya ) ( FTA-) ( Cantos I-VIII) 374 No. 133 1880-81. 15 Size.- 14 in. by 6 in. Extent.- 36 folios; 11 lines to a page ; 35 letters to a line. Description. Country paper thick, tough and white; Jaina Deva nagari characters ; big, quite legible, uniform and good hand-writing; borders not ruled ; foll. numbered in the right-hand margin ; foll. 25 and 27' incomplete ; a major portion of them is blank and the continuity is not maintained ; extent 950 slokas; condition very good. Age -- Samvat 1936. Author.- Kalikalasarvajna Hemacandra Suri, For details see p. 157. Subject. - A Prakrit mahakavya depicting the life of King Kumara pala, and at the same time it illustrates rules of the 8th adhyaya of Siddhabemacandra. The last canto deals with the insiruction given by Srutadevi to King Kumara pala. Begins.- fol. 1 IUDI TE TIESIESAI(at)ic etc, as in No. 134. 20

Page #208
134.] Ends.- fol. 36a The Svetambara Narratives li(liM) mu (gu) ataMtra (uM) jaha to havA | lahai kuvAlU nivbudi nRvA // 81 (2) / ' isavabhAsavinimayaparihiM paramatatru (tu) sa vi kaha (hi)vi / niakaMThamAla Thavi nRvaurasi gai a devi maMgala maMNiSi // 83 // ityAcAryazrI hemacaMdra viracite prAkRte mahAkAvye aSTama (:) sargaH samAptaM zrI pRthvI caMdramariziSyeNa haricaMdreNa 'pravha (hlA) dana' pure zrIkumArapAla - caritaM nAma prAkRtadvayAzrayamahAkAvyaM kArtikasadi ekAdazyAM rakhau sama pitaM // saM // graMthAgraM zlokamAnaM 950 // 2603 kumArapAlacarita TIkA sahita No. 134 173 yAdRzaM pustake dRSTaM tAdRzaM liSitaM mayA / yadi saddhamasaddhaM vA mama doSo na dIyate // hastAkSara ayAcI maNIzaMkara jezaMkara // zrIpAla zAmajI // saMvat 1936 nA phAgaNazudI 7 guruvAsare samAptaH // Reference. Published along with Purnakalasa's commentary in "The Bombay Sanskrit & Prakrit Series "in A.D. 1900. 15 Herein contents of the text are given in Sanskrit. For additional Mss. see Jinaratnakosa ( Vol. I, p. 186 ). Kumarapalacarita with tika Size.- 117 in by 4g in. Extent. -- fol. 34o to fol. 411 ie, 72 folios; 17 lines to a page ; 53 letters to a line. 224. 1902-1907. 1 The name of the metre of this verse is sumanoramA. 2 Perhaps this is an ending like Se but the scribe has not understood it. 5 Description.-- Country paper very thin and greyish; Devanagari 25 characters with pRSThamAtrAs; small, clear and fair hand writing ; borders ruled in four lines in black ink ; red chalk used; this Ms. contains both the text and its commentary; the former in Prakrit and the latter in Sanskrit; this Ms. seems to be a part of the original Ms. ; for it commerces on fol. 340 30 and, moreover, the text is preceded by a few verses of the 10 20

Page #209
174 Jaina Literature and Philosophy [134. - colophon of the commentary to the work of the same name but in Sanskrit ; edges of several foll, more or less damaged ; some foll. seem to be worm-eaten ; almost complete%3; the commentary composed in Samvat 13073 this Ms. is lacking in the colophon of this com. Age.- Fairly old. Author of the text. - Kalikalasarvajna Hemacandra Suri. See p. 157. Author of the commentary.-- Purnakalasa Gani, pupil of Jinesvara Suri and a fellow-student of Laksmitilaka Gani. Subject.-- The text in Prakrit and its elucidation in Sanskrit. Begins. - (com.) iol. 340deg 'mugurostasyAdezAt etc. up to the end of the colophon as in No. 123. --- ( text) fol. 3402 aha pAIAhiM bhAsAhiM saMsayaM bahulamArisaM taM taM / apaharamANaM sirivarddhamANaM(Na)sAmi(mi) nmso(saa)mo| 1. etc. ,,- (com.) fol. 340 puNyAMkUrAH zivasukhaphalA(laM) zrotRjaMtUna na(nu) netuM / tairagra'stAH kimuta likhituM maMgalAnyaSTa laajaaH| yasyodyate sadasi dazanAbhIzavo dezanAyAM / sa zrIcaMdraprabhajinapatiH prAtibhaM nastanotu // 1 // adhodhihitadurgati praga(ka)Tadivyagotroddati / vRti(? ta) sumanasAM bharaiH priyatarAmRtodyatphalaM // murAjita zubhabhiyaM bhuvanasattamAmodakaM / jinezvaramabhiSTuve gurumabhISTakalpadrumaM // 2 // yaspAzve yAcituM kiM kimapi zaziravI kuMDaladvaMdvadabhAd bhenu dAridyavRtte sa(su)timati yugapad dIpacake nu bhaan(tH)| sahINApustamuktAkSavalayakamalAtalyahastAnjalakSmI gdeivI sA mudhAmA mama manasi sadA stAt prakRtya prasAdaM // 3 // 1. This is the beginning of v. 11. See p. 160.

Page #210
134* J " The Svetambara Narratives yaH prAkRtavyAkaraNaM tu zabdeH sAhitya sarvasvamitrArthabhaMgyA | sa dvayAzrayaH kAvyamanalpabuddhi jJeyaH kathaM mAdRza eva gamyaH ? // 4 // Reference. abhISTakalpadruguruprasAda prAdurbhavatprabhavaibhava hi / svAnyAvabodhAya tathApi kiMcid Ends. -- (text) fol. 411b yatnaM vidhAraye vivarItumenaM // 5 // etc. - fol. 349deg ityAcArya zrI hemacaMdra viracitazrI kumArapAlacaritaprAkRtadvayAzrayamahAkAvyavRttau prathamaH sargaH samAptaH // etc. nAi nibesiu naM lihiu nAvai TaMkuki ( kvi) nu (NNu) / jaNi paDibiMbiu ji (ja) NU (Nu) sahaju kari jiNu maNi uNu (NNu) || 82 (81 ) (com) fol. 411" nivezita sthApitaH / tamiva likhitaH kunyAdau citri- 15 Rana catrorairNaH prastare vilikhitastamitra pratibiMbito darpaNAdo labdhapratibiMbastamiva sahajaH svabhAvastamiva ca jina (naM) manasi avatIrNa kuru / dohakachaMdaH // 175 loka (:) pa[ra]vita mahiSAditiryahi (gi) va jale kra (bu) iti nimajjati / tat kiM nIrANi zivazamdAni ? / na tajjalAni svamadhyapAni (ti) bhya: 20 sadA svAMtasthitebhyo matsyAdibhya iva muktizarmma prayacchatIti bhAvaH // vadanakaM chaMda' / / Both the text and its commentary published. See p. 173. For additional Mss. see Jinaratnakosa ( Vol. I, p. 186 ). 25 1 This is a portion of the commentary of v. 80, 10

Page #211
176 5 Jaina Literature and Philosophy [ 13s. kumArapAlacarita Kumarapalacarita 1300. No. 135 1887-91. Size.-- 103 in. by 4 in. Extent.-- 89 folios ; 19 to 20 lines to a page ; 64 letters to a line. Description.-- Country paper thin and greyish; Devanagari characters with pRSThamAtrAs; small, legible and fair hand-writing; borders ruled in sour lines in black ink ; red chalk used ; foll. numbered as usual; a piece of paper of the same size as a fol. pasted to fol. IA; similar is the case with fol. 8903; foll. 1' and 89 blank ; several foll. wormeaten ; complete ; extent 6307 slokas; composed in Sam vat 1422. Age.-- Samvat 1482. Author.-- Jayasimha Suri, successor of Mahendra Suri of the 'Krsnarsi' gaccha. Subject.-- Life of King Kumarapala depicted in 10 cantos. For details see " begins". Begins.- fol. 10 e60 / ahe namaH / cidAnaMdekakaMdAya namastasmai parAtmane / zivazrI ramate yasmin ha(ha)sIva hi saroruhe // 1 // etc. amArikArakatvena teSu stutyo'sti vastutaH / kumArapAlA kSamApAlo dhAmnA dhISNyeSu caMdravat / / 11 / / tato'sya carita kiMcid vacmyahaM svpupuupyaa| preritastadguNagrAmarAmaNIyakasaMpadA // 12 // etc. fol. 10' iti zrI kRSNa zrIjayasiMhamUriviracite zrIkumArapAla. carite mahAkAvye tatpUrvajazrIhemamUrijanmavarNano nAma prathamaH sargaH / - fol. 21 iti zrIkumArapAlabhUpAlacaritatajanmavarNano nAma dvitIyaH srgH| fol. 30' iti kumArapAlahiMDirAjyAptivarNano tRtIyaH sargaH / / fol. 38' iti digvijayavarNano nAmA caturthaH sargaH / / - fol. 49" iti phalopadezo nAmaH paMcamaH sargaH // - fol. 56deg iti kAruNyopadezo nAma SaSThaH sargaH / - fol. 66* iti zrAddhadharmasthApano nAma saptamaH srgH| - fol. 76deg iti0 kRpAsuMdarIpariNayanAgupadezacaityanirmANAdivarNano nAma aSTamaH sargaH / / fol. 84deg iti0 devAdhidevapratimAnayanatIrthayAtrAdivarNano nAma navamaH sargaH smaaptH|

Page #212
13501 The Svetambara Narratives 177 10 Ends.- fol. 89 zrIvikramanRpAdU dvidvimanvande(1422)'yamajAyata / graMthaH sasaptatrizatI padasahasrANyanuSTubhAM // 74 // yAbaTU dyotayataH svadIdhitibharaiAvyApRthivyAMtaraM / sUryAcaMdramasau nirastatamaso nityapradIpAvitra / tAvat tarpayatAdidaM navasudhAnispaMdavat suMdaraM / pRthvIpAlakumArapAlacaritaM tevAMsi puNyAtmanAM // 275 // iti zrIkumArapAlasvargagamanavarNano nAma dazamaH srgHs0|| vaMze vIrajinAdhirAjagaNabhRt zrImatsudharmaprabho rAsIdArpasuhasta(sti ziSyamukuTaH zrIguptasUriH prbhuH| tasmAccAraNalabdhakelizaraNAt zrI'cAraNAkhyo gaNaH / khyAtaH svastaruvat sanaiva sumanaHstomena saMsevitaH // 1 // zAkhA tasya turIyakAnanakakupazrIvajranAgaryalaM / caryAzrIsthitidharmanAmaviTapaprakhyaM dvitIyaM kulaM / / tatrAsIdapasImalabdhivasativadAruvaMdAraka vAtakhyAtatapAH kRpAjalanidhiH zrIkRSNanAmA muniH // 2 // yo mitravyayaduHkhato vratamadhAd yo'bhigrahAna durghahAn / dadhe byAlaviSAkulAn padajalairujjIvayAmAsa yaH / pratyabdaM caturasvarAM vyaracayad yaH pAraNAtriMzataM / sa mApAlavibodhanaH prazamanaH kRSNapirAstAM mude // 3 // zrIman nAgapure' purA nijagirA nArAyaNapreSThito nirmAyottamacaityamatimAjinaM tatra pratiSThAya ca / zrIvIrAnavacaMdramuptazaradi zveteSutithyAM zubhau / baMbhAdyAn samatiSThapat sa munirAT dAsaptati goSTikAn // 4 // tasmAd vismayanIyacArucarite zrImaricakrakramAd yAte zrIjayasiMhamUrirudabhUnigraMthacUDAmaNiH / saMvidvikramatastrayodazazateSve kottareSvarkarum klAMtaM saMghamajIvivajalabharaiyoM mNtrssttaimro| 5 // prabhAvakaziromaNiH praNatalokacitAmANiH prasannazazabhRtprabhustadanudiyute diiprdhiiH| yadIyacaraNAMbujaM nijaziraHkirITArkaruk ___ bhareNa dharaNIbhujo vikasitattvamAninyire // 6 // 1 1301. 23 [J. L. P.]

Page #213
178 Jaina Literature and Philosophy [135. pratyabdaM dInadustho()tisukRtikRte dIyamAnaM samAnaM / sAkSAd dInAralakSaM tRNamiva karati proSya nirlobhabhAvAt / ekaH so'yaM mahAtmA na para iti nRpaH shriimhNm(?)dsaaheH| stotraM prApat sa tApaM kSapaya tu bhagavAn zrImaheMdraprabhunaH / / 7 // tatpapUrvAcalamaMDanaika caMDadyutiH zrIjayasiMhamUriH / kumArapAlakSitibhRJcaritra midaM vyadhatta svaguruprasAdAt // 8 // avadhAnaH sAvadhAnaH pramANaniSNakavitvaniSNAtaH / alikhanmuninayacaMdro gurubhaktyA(s)syAdyamAdazai // 9 // uccaihArivisArivAridhijale dikptrmaalaakule|| pAtAlasthitazeSanAlakalite lakSmIvilAsocite / yAvat puSyani medinI sarasije 'svarNAcalaH' karNikA bhAvaM tAvadidaM caritramamalaM prINAtu vidvajjanaM // 10 // iti zrIgraMthaprazastiH / saMvat 1482 varSe caitramAse zuklapakSe paMcamyAM tithau ravidine sAMpAbhATIyAme 'puSkara'jJAtIcyAsaanaMtana puNyAMzazrIratanaprabhavAcanArtha zrIkumArapAlacaritraM likhitaM / zubhaM bhavatu / lekhakapAThakayoH kalyANamastu ||ch // zrI / / _Reference.--Published by Hiralal Haimsaraj, Jamnagar in A.D. 1915 20 and also by the managing trustees of the Godiji Jain temple, Pydhonie, Bombay in A.D.1926. See Bhandarkar, Reports 1883-84, pp.6 and 313. For additional Mss. see.B.B.R.A.S. ( Vols. III. IV, p. 434) and Jinaratnakosa (Vol. I, p. 92). kumArapAlacarita Kumarapalacarita No. 136 1274. 1884-87. Size.-- 103 in. by 43 in. Extent.-- 126 folios ; Is lines to a page ; 56 letters to a line. Description.-- Country paper thin and grey ; Devanagari characters with occasional pRSThamAdhAs ; small, legible and elegant hand.... writing ; borders ruled in four lines in black ink ; red _chalk used ; foll. numbered as usual; edges of the first fol.

Page #214
137. ] The Svetambara Narratives 179 slightly worn out; margins of foll. 13-20 worm-eaten ; condition tolerably good; complete ; this Ms. contains the colophon. Age.-- Fairly old. Begins. - fol. : 378 grae*#919 ete. as in No. 135. Ends. -- fol. 1256 wtaATE @le etc. up to a juEASTITA as in No. 135. This is followed by suf913#71: gi vaglio siri etc. N. B.-- For other details see No. 135. 10 709 kumArapAlacarita Kumarapalacarita No. 137 1875-76. Size. 10 in. by 4 in. is Extent.--- 15 folios; 17 lines to a page ; 46 letters to a line. Description-- Country paper very thin and white; Devanagari characters; small, legible and good hand writing ; borders ruled in two lines in red ink; red chalk used; foll. numbered as usual ; letters on fol. 1deg not quite legible, ink having 20 faded, etc.; some lacunae on fol. 36; complete ; composed in Samvat 1424(?); condition very good. Age.-- Not modern. Author.-- Somatilaka Suri alias Vidyatilaka, successor of Sanghati Jaka Suri. He has composed the following additional 25 works: - (1) Jurnales V. S. 1397. (2) TFF V. S. 1389. (3) ilgarigott tigariet V.S. 1397, (4) OTTIAGTTEIT V. S. 1392. Subject. -- Life of King Kumarapala. 30

Page #215
180 Jaina Literature and Philosophy [137. Begins-- fol. 1 // 6 // OM namo vItarAgAya // atra ca zrIkumArapAladevacaritraM vyAkriyate // prapAlayato'pi kAlo dharitrIM ___ svamaGgakA eva yAra nreNdraaH| kumArapAlaH paramAdbhutastu / lokaM tathA ca samuddadhAra !etc. Ends. atha prabhUkte divase sA(sa)mAptAyuH smaadhinaa| kumArapAlabhUpAlaH svarlokamadhitasthivAn // 28 iti saMkSepataH proktaM / caritraM gUrjarozituH / kumArapAlaprabodhazAstrA(t) jJeyaM vizeSataH // 29 / / iti 'rudrapallIpa'gacchAlaMkArahArazrIsaMghatilakasaripaTTAvataMsAcAryazrI somatilaka mUriviracitaM / zrIkumArapAlapratibodhacaritraM saMkSepeNa // 3 // Reference.-- For additional Mss. see Jinaratnakosa (Vol. I, p. 93). 10 20 kumArapAlacarita Kumarapalacarita No. 138 1357. 1891-95. Size.- 81 in. by 13, in. Extent.-- 22 folios ; 32 lines to a page ; 20 letters to a line, Description.- Foreign paper with water-marks, tough and white : Devanagari characters with gerais ; bold, big, legible and good hand-writing: borders not ruled; foll. numbered as usual; incoinplete ; dvitiya varga of the vivada sarga complete; composed in Samvat 1487; condition very good. 25 Age.- Modern. Author.- Caritrasundara Gani, pupil of Ratnasimha Suri. For ___ other particulars see Vol. XVIII, pt. l, p. 127. Subject. - Life of King Kumarapala. Begins.- fol. !* // 6 // ahe namaH // yatpAdasevAsuravRkSalakSA(kSyA)da viziSyate(5)tyadbhutadAnadakSAH /

Page #216
139.] The Svetambara Narratives 181 acityamAhAtmyanidhiH sa nityaM jinezvaro yacchatu maMgalAni // 1 // etc. Ends.- fol. 225 krIDaMtu tAbaddhariNA yatheSTaM yAvat samAyAti vane na siMhaH / puSNaMtu dhiSNyAni vibhAva tAva dudeti yAvanna hi caMDarazmiH // 13 // nirastazaMkA vicaraMtu bhekaa| yApat phaNI no sphurati sphu. This Ms. ends abruptly. ___10 Reference. - Published by the Jaina atmananda Sabha, Bhavnagar as No. 57 in Samvat 1973. For additional Mss. see Jinaratnakosa ( Vol. I, p. 92 ). - 20 kumArapAlaprabandha Kumarapalaprabandha 255. No. 139 A. 1882-83. Size. -- 104 in. by 4.3 in. Extent.- 82 folios ; 15 lines to a page ; 48 letters to a line. Description.- Country paper thin and white ; Devanagari cha. racters with pRSThamAtrAs; small, legible and good hand-writ. ing ; borders ruled in four lines in black ink; yellow pigment and red chalk used ; foll. numbered as usual; fol. 1a blank ; edges of foll. I and 82 slightly worn out; condition on the whole good; complete; composed in Samvat 1492. Age.-- Sarmvat 1653. Author.- Jinamandana Gani, pupil of Somasundara Suri of the __Tapa' gaccha. Subject-- Life of King Kumarapala. Begins.- fol. : 150 / / OM namaH zrImahAvIrajineMdrAya parAtmane / parabrahmasvarUpAya jagadAnaMdadAyine // 1 // etc,

Page #217
10 5 Ends. fol. 82deg 15 20 25 182 30 - Jaina Literature and Philosophy jagadatyadbhutA prArikArakatvAdikairguNaiH / kumAramApateH ko'pi tulAM prApa na bhUpatiH || 6 || etc. rAjJaH kumArapAlasya svarasajJApupUSayA / saMbaMdha yojanApUrva prabaMdhaM vacmi kiMcana // 9 // etc. AkarNya pratikAnanaM pazugaNA'zvAlukya' bhUpavyayaM / kraMdataH karuNaM parasparamado vakSyaMti niHsaMzayaM / possUnnaH kulavardhanaH sa sukRtI rAjarSirastaM yayo / (yAta digaMtaraM jhaTiti re no cenmRtA vyAghataH || nAmRnna bhavitA cAtra hemasUrisamo guruH / zrImAna kumArapAla va jinabhakto mahIpatiH // 45 // H nRpasya jIvAbhayadAnaDiMDimai mahatale nRtyati kIrti nartakI / samaM manobhistimike kitittiri sva (sta) moraNako mRgAdidehinAM // 1 // sAnukaMpA na mahIbhujAM sthA dityeSa klRpto vitathaH pravAdaH / jineMdra dharma (meM) pratipadya yena zlAdhyaH sa keSAM na kumArapAlaH ? || 2 || loko mUDhava (ta) yA prajalpatu divaM rAjarSiradhyapivAn / brUmo vijJA (jJa) tathA vayaM punaridevAste cirAyuSkavat / svati saMcAritano'dhamanubhiH 'kailAsa' vaihAsikaH / prAsAde (dezva bahiryadeSa sukRtI pratyakSa evekSyate // 5 // prabaMdho yojitaH zrImatkumAranRpaterayaM / H kaizvita kaizvit prAktananirmitaiH / 6 // zrI somasuMdaraguH ziSyeNa yathAzrutAnusAreNa / zrIjinamaMDanagaNinA dvayaM kamanu ( 1492) pramitavatsare ruciraH // 7 // girisutAramaNasya vilocanaM (na) pramitasAyakaSavidhu (1653) vatsare / [139. jayavAn guNamUrkha lilekha saH // sUpasi mAsi site dazamIgurau // 1 // cha // Reference Published by the Jaina Atmananda Sabha, Bhavnagar in Samvat 1971. For additional Mss. see Jinaratnakosa (Vol. I, p. 93 ) 35 1_It seems verses 3 & 4 are left ont in this Ms. If not, the numbering of the subsequent verses is faulty.

Page #218
140.] The Svetambara Narratives 183 kumArapAlaprabandha Kumara palaprabandha 1230. No. 140 1886-92. Size. - 104 in. by 44 in. Extent.- 90 folios ; IS lines to a page ; so letters to a line. Description.- Country paper thin, rough and greyish ; Jaina Devanagari characters with frequent quan ; sufficiently big, quite legible, uniform and very beautiful hand-writ. ing; borders ruled in two pairs of lines in black ink; red chalk profusely used; foll. numbered in the right-hand 10 margin; fol, 1 blank except that the title is writtent here as under : zrIkumArapAlaprabaMdhaH vA sarvadarzanasAmAnyatAprabaMdhaH There is some space kept blank in the centre of the numbered and the unnumbered sides as well; a few foll. 15 slightly worm -eaten ; edges of the last two foll. partly goue ; condition on the whole good ; yellow pigment used while making corrections ; complete. In the end we have sarvadarzanasAmAnyatAprabandha. Age.-- Samvat 151 (?) 20 Begins.- fol 1' 560 // OM namaH zrImahAvIrajineMdrAya paramAtmane / parabrahmasvarUpAya etc. as in No. 139. Ends.-- fol. 89 AkarNya pratikAnanaM etc. up to pramitavatsare ruciraH / 7 | as in 25 No. 139. This is followed by the lines as under:____ iti zrIsomasuMdarasUrIzvaraziSyazrIjinamaMDanopAdhyAyaiH zrIkumArapAlaprabaMdho yathAdRSTazrutAnusAreNa yojitaH ciraM jIyAt saMvat 151(?) varSe jyeSTha zudi 3 some zrI'vazvala' nagare vipragoviMdena likhitaH // kamgam. mastu // cha / ___ athA'nyasminnavasare zrIsiddharAje saMgadevasaMsArasAgaratitIrSayA pratyekaM sarvadarzaneSu / sarbadezeSu devatattvadharmatattvapAtratattvajijJAsayA pRcchayamAneSu / nijastutiparaniMdApareSu saMdehadA(do)lA'dhirUDhamAnasaH zrIhemAcAryamAkArya 30

Page #219
184 Jaina Literature and Philosophy [140. 10 vicArya kArya papraccha / AcAryastu catuIzavidyAsthAnarahasyaM bisRzya iti paurANakanirNayo baktamArebhe / yata purA kazci(da) vyavahArI pUrvapatnI parityajya / nUtanA gRhiNI sAkUtasarvasvaH / tataH pUrvapalyApativazakaraNAyatadvedibhyaH kArmaNakarmaNi pRcchadyamAne kazcid 'goDa'dezIyo razminiyaMtritaM tava pati karomItyuktvA kA kiMcidacityavIryabhepajamupAnIya bhojanAMte deyamiti bhASamANaH kiyadinAMta samAgate tasmim / tathA kRte vRSabhatAmApa / sA ca ttprtikaarmnprbudhymaanaa| vizvavizvAkrozAn shmaanaa| nijaduzcaritaM zocayaMtI kadAcit madhyaMdine / dinezvarakaThoratarakaranidavakaraprasarattapyamAnA(s)pi zAhabalabhUmiSu taM patiM vRSabharUpaM caaryNtii| kasyApi tarostale vizrAMtanirbhara. vilapaMtI / AlApaM nabhasi zubhAva / akasmAt tadAvatrAgato vimAnA'dhirUDhaH pazupatirbhavAnyA saha / tataH gAMryA duHkhakAraNaM pRSTo yathAvasthitaM nivedya ca / tasyaiva taro[:]schA(chA)yAyAM puMstvanibaMdhanaM auSadhaM / tannibaMdhAdAdizya tirodadhe / sA tadanu tadIyAM chAyAM reSAMkitA nirmAya tanmadhyavartiauSadhAMkurAna ucchaMdya vRSabhavadane kSipatI / tenApya'jJAtastrarUpeNa auSadhAMkureNa / badananyastena sa vRSabho manuSyatAM prApa / yathA tadajJAtasvarUpo'pi bheSajAMkuraH samIhitakAryasiddhiM cakAra / tathA 'kaliyuge(5)pi mohAt tadapi tirohitapAtrajJAnaM sadbhaktika / sarvadarzanArAdhanena / aviditasvarUpamapi muktipradaM bhavatIti nirnnyH|| iti zrIhemacaMdrAcAryaH sabaidarzanasaMmate nivedite sati zrIsiddharAjaH sarvadharmAnArarAdha 4 / iti sarvadarzanasAmAnyatAprabaMdhaH / cha / zubhaM bhavatu / kalyANamastu sakalasaMghasya // cha / shriiH|| N. B.- For additional information see No. 139. 20 kumArapAlaprabandha Kumarapalaprabandha No. 141 1276. 1884-87. Size.- 1of in. by 4g in. Extent.-75 folios : 15 lines to a page; 55 letters to a line. Description.-- Country paper thin, rough and white ; Jaina Deva fragari characters; big, quite legible, uniform and very good hand-writing ; borders ruled in three lines in black ink; 30

Page #220
142. ] The Svetambara Narratives 185 5 red chalk used; foll. numbered in the right-hand margin ; there is some space kept blank in the centre of the num: bered and unnumbered sides as well ; cach and every fol. more or less worm-eaten ; condition on the whole tole. rably fair ; complete ; fol. 756 blank except that the title etc. written on it. Age.- Pretty old. Begins.-- fol. 1a y Troll RA: STATINITIHazia giraetc, as in No. 139. Ends.- fol. 752 __ Akarya pratikAnanaM etc. up to pramitavatsare ruciraH as in No. 139. This is followed by the lines as under:___ iti zrIsomasuMdarasUrIzvaraziSyazrIjinamaMDanopAdhyAyaiH zrIkumAra qagaa magagano utha: 11. Hg 11 N. B.- For other details see No. 139. IO IS 20 kumArapAlaprabandha Kumarapala prabandha 19. No. 142 1869-70. Size.- 104 in. by 4. in. Extent.-90-4=86 folios ; 15 lines to a page ; 44 letters to a line. Description.- Country paper thin, rough and white ; Jaina Deva nagari characters with occasional qualats; big, quite legible, uniform and very good hand-writing; borders ruled in four lines in black ink; dandas written in red ink; foll. numbered in both the margins; in the centre of the numbered and the unnumbered sides as well, there is a small square with a vertical diagonal in red ink; marginal portions more or less worn out in the case of some of the foll; condition on the whole tolerebly fair ; this work begins abrupily as the first four foll. are missing; it how ever goes up to the end ; in the lelt-hand margin the title is written as FAITI 9deg; numbers for full. written artistically. 24 1J. L.P.1 30 ,

Page #221
S to 15 20 25 186 Age.- Pretty old. Begins. - fol. sa Ends. -- fol. gob Jaina Literature and Philosophy gAmaputro ( S) dhvajAropaM vyadhApayat // 30 ... atrAvasare zrIkaNarAjo dvayo rAjJonaika vasthAnayu miti / 'AzApallI 'nivAsinaM prabalabhujabalazAlinaM lakSabhilayutaM AsAkaM bhillaM jitvA 'karNAvatI 'purI vidhAya || 31 etc. kumArapAlaprabandha No. 143 142. 630 aror pratikAri etc. up to pramitava ( ( sa ) re ruciraH 7 // as in No. 139. This is followed by the line as under:-- iti zrI somasuMdarasUrIzvaraziSya jinamaMDanopAdhyAyaiH zrIkumArapAlabhUpAlaprabaMdho dRSTazrunAnusAreNa yojitaH / chaH / iti zrIkumArapAlaprabaMdhaH paM0 zavadAsena lakhitamiti N. B. -- For additional information see No. 139. Kumarapalaprabandha Size.- 10++ in. by 44 in. Extent.- 72-1=t folios; 20 lines to a page; 45 letters to a lins. Description.--Country paper thin, tough and white; Jaina Devanagari characters with occasional gears; small, clear, fairly uniform and tolerably good hand-writing; borders ruled in two pairs of lines in black ink ; red chalk used; foll. numbered in both the margins; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; yellow pigment used while making corrections; edges of a few foll. slightly gone; a strip of white paper pasted to fol. 72b; condition on the whole tolerably good; this work begins abruptly as the first fol. is missing but it goes up to the end. Age. - Samvat 1669. 375. 1880-81.

Page #222
144.] The Svetambaru Narratives 187 Begins.-- fol. 2 'kaTakapure'zrIbhUyarAjya rAjyaM karoti / tena rAjJA svacyA mahaNala devyA 'gUrjara 'dharitrI kaMbukapade dattA / itazva 'garjaro'kadeze 'DhiyAra'. deze 'paMcAsaragrAme bahiHpradaze zrIzIlasUrayaH zakunAvalokanArtha prAptA vanagahanamadhye vRkSazAkhAnibaddhajholikaM cAlakamekaM dRSTvA samIpasthA tanmAtara. mUchu: (cuH) etc. Ends.- fol. 72deg loko mUDhatayA prajalpatu divaM rAjarSiradhyUSivAm / bramo vijJatayA vayaM punarihabAste cirAyuSkavat / svAMte saJcaritanabho'bdhimanubhiH (1470 ?) kailAzavahAsikaiH prAsAdaizca bahiyedeSa sukRtI pratyakSa evekSyate / 5 / prabaMdho yojitaH zrIkumAranRpaterayaM / gadyapadyenavaiH kaizvit kaizcit prAktananirmitaH // 6 / zrIsomasuMdaraguroH ziSyeNa yathAzrutAnusAreNa / / zrIjinamaMDanagANi[tagaNi] rA(nA) dvyNk[|| 7 // ] manu1492pramitavatsare ruciraH // 7 // iti zrIsomasuMdarasUrIzvaraziSyazrIjinamaMDanopAdhyAyaiH zrIkumArapAlaprabaMdho dRSTazrutAnusAraNa yojitaH / / ch|| // saMvat 1669 varSe caitrasudi 6 dine zrI'mulatANa'bhadhye // zrI'vRhattarataragacche zrIjinacaMdrasarivijayarAjye / zrIjinabhadramUrisaMtAne zrIkamalasaMyamopAdhyAyAnAM ziSyakavicakracUDAmaNizrImanmunimerumahopAdhyAyAnAM 20 ziSyapaMDi zrImAhimasAragaNivarANAM ziSyamuSpapaM zrIraMgavarddhanagaNiprava. rANAM ziSyasiromaNipaM zrIkalyANasAragANavarANAM prAthimakalpikena paM0. rANAmuninA lileSi pratiriyaM // // yAdRzaM pustake dRSTaM tAdRzaM liSi(khi)taM mayA / yadi zuddhamazuddha vA mama doSo na dIyate // 1 // zubhaM bhUyAlleSa(kha)kapAThakayoH // shriiH|| N. B.-- For further particulars see No. 139. kumArapAlaprabandha Kumarapalaprabandha No. 144 562. 1895-98. Size.-- 10 in. by it in. Extent.--- 30 folios ; 20 lines to a page ; so letters to a line. ___30

Page #223
188 laina Literature and Philosophy [ 144 Description.- Country paper very thin, tough and greyish; Jaina Devanagari characters with rare eagis; small, fairly legible, uniform and tolerably good hand-writing ; borders ruled in two pairs of lines in black ink ; red chalk used; foll. numbered in the right-hand margin; yellow pigment used while making corrections: there is some space kept blank in the centre of the numbered and the unnumbered sides as well ; edges of several foll. more or less gone ; condition on the whole good ; complete. 10 Age.- Not modern. Author.- Not mentioned. Subject.- Biography of King Kumarapala. Begins.- fol. 1 e0 // ahaM namA / svayaM kRtArthapuruSArthabhAva jaMgAda pastAna (na) jagatAM hitAya nAthaH prajAnAM prathamaH pRthivyAM jIyAd yugAdau puruSaH sa ko(5)pi // 1 // praNamAmi mahAvIraM sarvajJa puruSottamaM / surAsuranarAdhIzaiH mevyamAnapadAMbujaM // 2 parA manasi pazyaMtI hRdi kaMThe ca madhyamA mukhe ca vaikharItyAhurbhAratI tAmupAsmahe // 3 ajJAnatimirAMdhAnAM jnyaanaaNjnshlaakyaa| netrAnmIlitaM yena tasmai zrIgurave namaH / / 4 sakalasurAsuranaranikaranAyakazira zeSarAyamANapAdAraviMdazrIsarvajJopajJapathapAMthapraSTasya / 'kalikAlasarpajJa zrohemagguirUpadezavivekavizeSaprAptAs. zeSabhUvalayapratiSThasya / sakalajaMtujAtajIvAtujIvadayAdharmaniSThasya nijabhuja balakalitasakalabhUpAla kulArvajayAvalasahyadya)za pratApagariSThasya / zrIkumAra. pAlabhUpAlasya prArabhyate'yaM prabodhaH prabaMdhaH / etc. Ends.- fol. 30deg nAbhUda(da) bhavitA cA'tra hemasUrisamo guruH zrImAna kumArapAlazca jinabhakto mahIpatiH // 2 AjJAvartiSu maMDaleSvaSTAdazasvAdasa dabdAnye ca caturdaza prasumarI mAri nivAryojasA kIrtistaMbhanibhAMzcaturdazazatIsaMkhyAna vihArAMstathA kRtvA nirmitavAn kumAranRpatijaino nijainovyayaM / 3

Page #224
145.5 The Svetambara Narratives 189 karNATe1 gUrjare2 lATe3 saurASTra kacchasaiMdhave / uccAyAM caivattaMbhayo mArave mAlave tathA // 4 kokaNe tu tathA rASTre kore jAlaMdhare punaH / sapAdalakSe mevADe dIpe jAladhare(5)pi ca // 5 jaMtUnAmabhayaM saptavyasanAnAM niSedhanaM / / bAdanaM nyAyaghaMTAyA rudatIdhanavarjanaM // (6) kiMcid gurumukhAcchrutvA kiMcidakSaradarzanAt prabaMdho(5)yaM kumArasya bhUpatelikhito mayA / / 7 / bha.zrI kumArapAlaprabandha Kumara palaprabandba 10 1275. No. 145 1884-87. Size.-- 101 in. by 4* in. Extent. -- 43-10-1 = 32 folios; 17 lines to a page; 52 letters to a line. Descriprion.- Country paper thin, rough and greyish ; Jaina Deva.is nagari characters with cccasional grarais; small, quite legible, uniform and very good hand-writing; borders ruled in two pairs of lines in black ink ; space between these pairs coloured red; red chalk profusely used ; foll. numbered in both the margins; twice in the right-hand 20 margin ; the ist set begins with 331 and the other with II; in the left-hand margin we have letter-numerals corresponding to the second set i.e. Yetc. : for 20 gha, for 30 lA, for 40 pta ; fol. 12 missing ; even the first ten foll lack. ing; thus this work begins abruptly but it goes up to the end. Age.-- Samvat 1482. Begins.- fol. II yAMgre'paThadurga bhaTTo dhAdIzvaro(5)nyadA // 13 'citrakUTa 'midaM bhadre ! pRthivyAmekalocanaM / dvitIyasyAMbakasyAtheM tapastapati medinI // 14 kumAraH saparIdhArastata zrutvA(55)ruhya taM nagaM vismitaH sarvato vIkSya digbhAgAna nijagAda ca / / 15 etc. 35 30

Page #225
190 Jaina Literature and Philosophy [145. Ends.- fol. 430 nAbhUda(da) bhavitA cAra etc. up to bhUpatelikhito mayA // 7 // ch| zrIH // cha / ___iti saMvat 1482 varSe phAguNazudi paMcamyAM gurau zrImati zrI'tapA'pakSe zrIratnAgarasUrIzvarANAM gamache bhaTTArakazrIjayatilakamUrIsvarANAM zikSapa. dayAkezaragaNivarANAM zrI ozabaMza aM(zRM)gAragoThIsagrAmakasya bhAryAbAIjAsUnAmnA liSAdhya pradadau mudA / ciraM naMdatu / / cha / Then in a different hand we have:-- zrIhIravijayasUrIzvaraziSyapaM0zrIpadmavijayagaNiziSyapaM bhImavijayagaNInAM vAcanArtha pratiriyaM // zrIrastu // shrii|| N. B.- For other details see No. 144. 10 kumArapAlapravandha Kumarapalaprabandha 586. No. 146 1884-86. Size.- 10 in. by 41 in. Is Extent.-- 10 folios ; 20 lines to a page ; 45 letters to a line. Description.- Country paper thin, tough and white; Jaina Deva nagari characters with occasional qazis; small, quite legible, uniform and very good hand-writing; borders ruled in three lines in red ink; red chalk used; foll. numbered in the right-hand margin ; fol. 100 blank; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; edges of the last fol. slightly gone ; condition on the wLole good ; complete. Age.- Old. 25 Begins.- fol. 1' yo Oy praNamya zrImahAvIraM etc. Ends.-- fol. 10 a(A)jApatti(tiSu maMDaleSu etc. up to bhUpatilikhito mayA // 2 as in No. 144. This is followed by the line as under:30 iti kumArapAlaprabaMdhaH // 7 // zrI N. B.- For additional information see No. 144.

Page #226
147.] The Svetambara Narratives 191 10 15 kumArapAlarAsa Kumarapilarasa ____157. No. 147 1872-73. Size.-- Iog in. by St in. Extent. - 88 folios ; 16 lines to a page ; 40 letters to a line. Description.-~-Country paper thick, rough and white; Jaina Deva nagari characters; big, quite legible, uniform and very good hand-writing ; borders ruled in two lines and edges in one, in red ink , foll. numbered in the right-hand margin; fol. 1 blank; a few foll. in the beginning are worm-eaten ; condition on the whole good ; complete ; composed in Samvat 1742. Age.- Samvat 1872. Author.- Jinaharsa ( = Jasaraja ), pupil of santiharsa. He is the author of the following 48 additional Gujarati works:- (a) rAsa [ 28, (1) ajitasena-kanakAvatI-rAsa V. S. 1751 (2) abhayakumAra-rAsa V. S. 1758 (3) amaradatta-mitrAnanda-rAsa V. S. 1749 (4) amarasena-jayamena-rAsa (rAtribhojanaparihAraka) V. S. 1759 amarasena bajrasena rAsa No. 22 V. S. 1742 (4) (6) ArAmazobhA-rAsa V. S. 1761 uttamakumAra-rAsa V. S. 1745 (8) guNakaraNDa-guNAvalI-rAsa (9) candana-malAyogiri-rAsa (10) jamvusvAmi-rApta V. S. 1760 (11) matsyodara-rAsa V. S. 1718 (12) mahAbala-malyAsundarIrAsa V.S. 1751 (13) mRgAlekhA-rAsa v.S. 1748 (14) ratnacUDamuni-rAsa (15) ratnasAranRpa-rAsa v. S. 1789 (16) ratnasiharAjarSi-rAsa v. S. 1741 (17) vasudeva-rAsa v. S. 1762 (18) vidyAvilAsa-rAsa V. S. ITH (19) vIsa-sthAnaka rAsa 1 See Jaina Gurjara Kavio ( Vol. III, pt. 2, p. 1157). 20 V.S. 1751 V. S. 1744 25 v. S. 1757 30 v. S. 1748 35

Page #227
192 Jaina Literature and Philosophy [147. v. S. 1749 (20) zatruayamAhAtmya-rAsa v. S. 1755 (21) zIlavatI-rAsa V. S. 1758 (23) zukarAja-rAsa V. S. 1737 (23) zrIpAla rAjAno rAsa V.S. 1740 (24) ,-rAsa ( saMkSipta ) V. S. 1742 (25) satyavijayanirvANa-rAsa V. S. 1756 (26) sudarzanazeTha-rAsa (27) harizcandra-rAsa v. S. 1744 (28) harivalalAchI-rAsa V. S. 1746 (b) copaicatuSpadI [3] (1) candana malayAgiri-copai V. S. 1704 (2) (2) maGgalakalaza-copai v. S. 1714 (3) vidyAvilAsanRpa-copaha V. S. ITIH (c) sajjhAya ( svAdhyAya ) [3] (1) avanti sukumAla-svAdhyAya V. S. 1741 (2) jJAtAsUtra-svAdhyAya V.S. 1736 (3) narmadAsundarI-svAdhyAya V.S. 1761 (4) bayarasvAmI-DhAlabandha-sajjhAya V. S. 1759 (5) sthalabhadra-svAdhyAya V. S. 1759 (d) stavana [3] (1) 'vADI' pArzvanAtha--bRhat-stavana (2) bIsa viharamAna(Na) stavana V. S. 1761 (3) samakita-sittari-stavana V. S. 1736 (e) prakIrNaka [1] (1) RSivatrIsI (2) cobolI kathA-kavitta dahA jasarAja-bAvanI V. S. 1738 (4) jinapratimAdRDhakaraNa-huNDI V. S. 1725 (5) pArzvanAtha-ghaghara nisANI (6) mahAvIra-chanda (7) meghakumAra-coDhAlIu (8) sItAmudraDI (9) sIyala-nava-vADa' V. S. 1729 Subject. - A Gujarati poem depicting the life of King Kumarapala. 1 For some more. works J. C. K. ( Vol. III, pt. 2 ), non

Page #228
193 193 148.] The Svetambara Narratives Begins.--- fol. 1 // 5 6 // zrIgurubhyo namaH // zrIsarasvati bhagavati namuM buddhi taNI dAtAra puraSanaI pAData kareM karatAM na lArge vAra 1 Agala paDhita je huA vartamAna kahavAya ghali paDita je hAisyaI te sarasvatisupasAya 2 etc. Ends.--fol. 880 savata satara baitAlIsaiM (1742) Aso sUdi sujagIsahaM ho so vijayadazamI dina tApa (nadI)saI nayara 'pATaNa 'mana hiMsaiM ho __ so013 10 adhiko oso kavaNo hoi mujhanaI doSa na koi ho mo0 rAsa kIdhA pugva rAsa jAI mAMbhalajyo mahU koi ho yI 14 'paratara' gaccha mAM virAje jinacaMda suri chAja iM ho po (sI). vAcaka zAMtiharaSa(ga)ga(Ni) gAjaI 'Sama zASA mAhe rAje ho 15 so* 15 tAsa caraNapaMkajaramagato bhamara taNI pareM mAto ho so.. kahe jinaharaSa haraSabhara gATho(to) gasa sahU maI suhAto ho 16 so. aTTAvisa meM gAthAno dAbo upari bahotara ThAvo ho mo. rAsa i(rU)Di pari eha ha) matA(lhA)ko so uguNatrIsamI DhAla gAyo ho 17 20 iti zrIkumArapAlarAsa saMpUNa(Na)ma saMvata 1872nA ApAhAdi 13 jJA 1738 pra0 mAmotamAse subhakAri phAlgunamAse kRSNapakSe tithI 30 amA. vAsyA 'kora la madhye cN(pN)| zrAdharavijayatatsIpAvalabhavijayalaSitaM / / 88 Reference. -- Published by Dahyabhai Lalubhai, Premchand Nagin das and Mohanlal Jaychand in V. S. 1951. For additional 25 Mss. see Jaina Gurjara Kavio ( Vol. II, pp. 92-94 & Vol. III, Pt. 2, pp. 1156, 1521 and I522). 30 kumArapAlarAsa Kumarapalarasa No, 148 563. 1895-98, Size.-- 10 in. by 4 in. Extent. - 100 folios ; IS lines to a page; 30 letters to a line. Description.- Country paper thick, tough and white; Jaina 1 This is Kumara palarasa composed by Riabhadas in V, S. 1670. 9. LI.I..PI

Page #229
10 15 20 25 30 35 194 Jaina Literature and Philosophy [ 148. Devanagari characters; big, quite legible, uniform and very good hand-writing; borders ruled in two lines and edges in one in red ink; red chalk used; foll. numbered in both the margins; fol. 1 blank; so is the fol. 100b; in the left-hand margin the title is written in various ways such as kumAra0pAla0, kumAra0 pAlarA0 etc.; condition very good ; complete. Age. - Samvat 1847. Author.-- Jinaharsa. For a list of his additional 48 Gujarati works see p. 192. To these the following Gujarati works should be added: - (a) rAsa [7] (1) upamitibhavaprapaJcA - rAsa ( 2 ) RSidattA -rAsa (3) kusumazrI - rAsa (4) caMdracUDa - rAsa (5) yazodhara - rAsa ( 6 ) (7) (2) (1) navavAhi-sajjhAya ratnazekhara - ratnavatI - rAsa zrImatI rAsa ( navakAra aMge ) (d ) stavana (2 2) V. S. 1745 V. S. 1749 V. S. 1715 V. S. 1757 (b) copai [1] mRgAputra copaDa (c) sajjhAya ( svAdhyAya ) [ 1 ] (1) cha ArA-stavana ( 2 ) sametazikharAMgari-stavana V. S. 1747 V. S. 1759 V. S. 1761 V. S. 1715 V. S. 1729 (e) prakIrNaka [s] ? V. S. 1714 (1) AhAradoSa chattIsI V. S. 1727 ( 2 ) dazavekAlikasUtra - daza adhyayana- gIta V. S. 1737 ( 3 ) nandabahottarI =vIrocanda mahetAnI vArtA V. S. 1714 ( 4 ) vairAgyachIsI S. 1727 (5) sugurupaccIsI Besides, this Jinaharsa is the author of the following 5 Hindi works: (1) upadezachatrIsI- savaiyA V. S. 1713 ( 2 ) covIsI V. ?

Page #230
195 149.] The Svetambara Narratives (3) dohAbAvanI-mAtRkAbAvanI v. s. 1730 (4) nama-rAjamatI-bAra mAsa-savaiyA ? (5) vAra-mAsa-savaiyA Begins.- fol. 1deg // 50 // zrIjina(nebhyo namaH zrIpArzvanAthAya namaH / / sAsati bhagavati naK etc. as in No. 147. Ends.- fol. 100 saMvata satara betAlI se etc. up to gAyo ho / so0 // 17 // as in No. 147. This is followed by the lines as under :iti zrIkumArapAlarAsa samApta // saMpUrNa / / 10 saMvata 1847nA varSe // phAlguna muda 5dne|| guruvAsare // zrImataH bhaTTArkazrIzrIzrImataH kuMmataM(tAM)dhakArAMnabhomaNI // bhaTTArakuzrI108zrIbhAvaratnasarI // tatasISya paMnyAsazrI 5 teyaratnajI / / satISya paMnyAsI 5 zrInemaratnajI / tatasIya munizrI 5 zrIpUMnyaratnajI // tatsIpamunImIDUMgararatnena lakhItaM // zrIbhIDabhaMjanaprasAdAt // // zrI UnAUA'mAhA- 15 subhasathAne // // zrIkalyANamastuH // zrI N. B.- For further particulars see No. 147. 1871-72. 20 kumArapAlavaMzAvalI Kumarapalavarosavali No 149 338. Size.-98 in. by 4g in. Extent.- 15 folios; 14 lines to a page ; 38 letters to a line. Description.-- Country paper thick, tough and white; Jaina Devanagari characters; big, quite legible, uniform and very good hard-writing; borders ruled in two lines and edges in one, in red ink ; foll. numbesed in the righthand margin ; condition very good ; complete so far as it goes. Age.- Pretty old. Author.- Not mentioned. Subject. -- A genealogy of King Kumarapala and at the end a miraculous incident. 25 30

Page #231
196 Jaina Literature and Philosophy [149 Begins.- fol. 1 // 56 // // // kumArapAlavaMzAvalI // zrI / 'caulukya' ehaveM nAmeM uttama kSatrI parAkramI thayo tethI 'caulukya vaMza thayo tethI ghaNA thayA anukrameM siMhavikrama rAjA thayo suvarNasiddhi pAmyo tatputra harI vikrama tehane pATaparaMpara 85 rAjJa / etc. S Ends.-- fol. IF ghare AvyA dharmadhyAnatatpara rAtri thayA sarva pakSane zAsanadevatAI tADanAM vRkSa karyo / prAteM gurune vAMdavA gayA have vanarakSaka badhAmaNI gajAne kahI sarva vRkSa tADanAM thazaM / tehanaI vadhAmaNa [[] daI / AjJA kari lekhakane tADapatra yathA icchAI ANI dio / guruDa pucchayuthI sarva vyatikara (k)hyo| gurunA karNamAM amRtasama thayo tehi ja velA parSadA sahita sarva ArAma joSA gayA dvijApi(? di)ka camatkAra deSI ghaNA samyakta pAmyA / jaina zAsanano mahodaya thayo / lekhaka kumAravihArazataka Kumaravibarasataka 1342. . No. 150 1884-87. Size.- 101 in. by 4: in. Extent. 9 folios; 14 lines to a page; 34 letters to a line. Description.- Country paper thin, tough and greyish; Jaina Devaragari characters with occasional geriais; big, quite legible, unisorm and very good band-writing; borders ruled in three lines in red ink ; numbers for verses, their dandas and a portion of the first line writtin in red ink; foll, numbered in the right-hand margin; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; sometimes this is decorated in red ink; condition very good ; complete; the last verse is numbered as 16 i, e. 116. Age.-- Old. Author.- Ramacandra Gani, pupil of Kalikalasarvajna 'Hema. candra Suri. He is the author of 100 prabandnas. He has composed the following 11 dramas: (1) kaumudImitrAnanda ( prakaraNa ) (2) nalavilAsa (nATaka) (3) nirbhayabhIma (vyAyoga) (4) mallikA-makaranda (prakaraNa) . 30

Page #232
150.] The Svetambara Narratives 197 (5) yaduvilAsa (nATaka) (6) yAdavAbhyudaya (nATaka) (7) raghugliAsa (nATaka) (8) rAghavAbhyudaya (nATaka) (1) rohiNI-sRgADU (prakaraNa) (10) vanamAlA ( nATikA) (11) satyaharizcandra (nATaka) The authorship of the following works is attributed to him : (a) hymns [ 20] (1) Adidevastava (2) jinastotrAvali (3) nAmastava (4) munimuvratastava (5-20) sAdhArajanastavapoDazikA (b) miscellanea [5] (I) prasAdadvAtriMzikA (2) yugAdidevadvAtriMzikA (3) laghunyAsa of siddhahemacandra (4) vyatirakadvAtriMzikA (5) sudhAkalaza He was assisted by Gunacandra Gaai in composing Dravyalankara and its commentary & Natyadarpana and its commentary. Thus these are joint works. Subject. - A versified description of the Jaina temple named as as Kumaravihara and built at Patan by king Kumarapala. Begins.- iol. 1 || 50 namaH zrIsarvajJAya // tejaH puSNAtu pAzvoM duritavijayi vaH zAstra(ca)tAnaMdabIjaM / saMkrAMtaH saptamA bhujagapatiphaNAcakra gyaphabhAji / kamrmANyaSTau samaMtAta tribhuvanabhavanA [utsagitAnAM jnaanaaN| yaThe nu tulpakAlaM vahati nijatanu kluptamaptAnyarUpAM // 1 te vastApa haratAM nakhamaNimukurajyotirabhazchaTAbhi. dikacakaM prINayataH karimakarabhUtaH pAzvanAthasya paadaaH| pananityaprabodhairadharitasaramA mAmAsAdya yeSAM / citra vicchinnatRSNAH kati paramamRtaM prANabhAjo na bhejuH // 2 etc. 19 30

Page #233
198 Jaina Literature and Philosophy [10. -fol. AzcaryamaMdiramuvAraguNAbhirAmaM vizvabharApaNavabhUtilakAyamAnaM / tejAMsi yacchatu kumArAMvahAranAma. bhUmIbhujazrulakavazabhavasya cetyaM // 9 _Ends.- fol. 90 kapU]rAgurukalpyamAnavividhasnAtraM bhramatkAminI. saMghaTitArddhahArarabhamabhrasyannitaMbAMbaraM / vakSaHpIDanalabhyamAnasaraNijyeSThAnuSaMgatrapA tAmyatyorakulAMganaM navavadhUmaprArthyamAnAtmajaM // 14 (194) khalanmaMgalagItidIvyadamarI sAyaM paThan mAgadhaM nRtya porapuraMdhiyAcakazatavyAtIryamANAMgadaM / snAtrAMbugrahaNocchalapAcaTavyAhAramuccaivatan / nAnAnATakamadalaM pratikalaM yad vartate sarvataH // 15 (115) yugma AstAM tAvanmanuSyaH prakRtimalinadhIH zAzvatAlokacakSu va vakvezcatubhirvidhirapi kimalaM tasya sauMdaryalakSmI / kSINAzeSAbhilASaH paramalayamayaM sthAnamAto()pi yasmi bAsthAM zrIpArzvanAthastribhuvanakumadArAmacaMdrazcakAra // 16(116) iti zrIkumAravihArazataka / iti bhadra o Reference.- Published with Sudhabhasana Gani's avacuri and the Gujarati translation and elucidation by Jaina Atmananda Sabha in V. S. 1966. For additional Mss. see Jinaratnakosa ( Vol. I, p. 93). On p. 361 of it this work is named asf Viharasataka", 39 kumAravihArazataka Kumaraviharasataka No. 151 587. 1884-86. Size.- 10 in. by 4g in. Extent.- 4 folios ; 18 lines to a page ; 64 letters to a line. Description.- Country paper somewhat thick, tough and white; Jaina Devanagari characters with occasional pRSThamAtrA; small, quite legible, uniform and very good hand-writing; borders ruled in three lines in black ink ; foll. numbered

Page #234
152. ] The Svetambara Narratives 199 in the right-hand margin ; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; red chalk rarely used ; condition very good ; complete ; 116 verses ; extent 289 slokas and 24 letters. Age.- Old. Begins.-- fol. " 4 60!! A#: gentia qisai etc. as in No. 150. Ends.-- fol. 40 karpagaguru etc. up to rAmacandrazvakAra as in No. 150. This is followed by the lines as under : 11886 11 gia MIHAITITEIT:Tatil jo 268 11 37 38 11 soft II zrIvimalaharSavAcakaziSpamunivimalayAcakottaMsaiH / / zreyo(5) cikoze / muktA praniriyamanalpaguNaH // 1 N. B.- For additional information see No. 150. 10 kumAravihArazataka Kumaraviharasataka is 13:3. No. 152 1884-87. Size.. 101 in. by 4.3 in. Extent. - s folios ; 17 lines to a page ; 58 letters to a line. Description - Country paper thin, rough, tough and white ; Jaina 20 Devanagari characters with frequent ATS; small, quite legible, uniform and very good hand-writing ; borders ruled in two pairs of lines in black ink; red chalk used; foll. numbered in the right-hand margin ; there is some space kept blank in the centre of the numbered and the 25 unnumbered sides as well; edges of each and every fol. more or less gone ; condition on the whole good ; - complete ; the last verse numbered as 116. Age.- Old. Begins.- fol. 1 990F fare il 30 da: gul qiat etc. as in No. 150. Ends.- fol. sb mature etc. up to TTATE 2+1 as in No. 150.

Page #235
200 200 Jaina Literature and Philosophy [152. This is followed by the lines as under : "??& li tie pattIaat Tad para() | TE HTT " STIUTAET stint ( ale li h Tara Hati gli N. B.- For further particulars see No. 150. 318 5 kumAravihArazataka Kumaravib rasataka No. 153 1871-72. Size.-- 101 in. by 4 in. Extent. - s folios ; 17 lines to a page ; 64 letters to a line. Description. - Country paper thin, tough and white; Jaina Deva. nagari characters with occasional peatajs; small, quite legible, uniform and beautiful hand-writing: borders ruled in three lines in red ink; foll. numbered in the righthand margin ; there is some space kept blank in the centre of the numbered and the unnumbered sides as well ; in some cases spaces are decorated ; edges of some of the soll. slightly gone; condition on the whole good; com. plete; the last verse numbered as 116; the me ras occurring in the first line on every side written in an ornamental way. 20 Age. - Pretty old. Begins.- fol. 12 000 : goorra great etc. as in No. 150. Ends.-- fol. sa ka(pU)gaguru etc. up to rAmacaMdrazvakAra as in No. 150. Then we have :-- !1888 11 3 li gian vieA(AT)TIKETT9757 ll 3 il sottra il spre TAUHTET I gli N. B.- For additional information see No. 150.

Page #236
154.] The Svetambara Narratives goatqnitamur No. 154 Size. 9 in. by 41 in. Extent. 14 folios; 14 lines to a page; 30 to 32 letters to a line. Description. Country paper somewhat thick, tough and grey; Jaina Devanagari characters; big, quite legible and tolerably fair hand-writing; borders indifferently ruled in three lines in red ink; foll, numbered in the right-hand margin; numbered and unnumbered sides as well have in red colour a small disc in the centre and in the middle portion of each of the two margins, too; edges of some of the foll. slightly gone; condition on the whole good; complete; this katha ends on fol. 4; there are additional works as under : Kurucandramantrikatha 823 (a); 1892-95. (1) zayanadAne kathA (2) AsanadAne pRthvIpAlakathA ( 3 ) bhaktadAne kanakarathakathA No. 104 ( 4 ) bheSajakathA ( 5 ) vastradAne dhvajabhujaGgakathA ( 6 ) pAtradAne dhanapatikathA // 60 // zrIvItarAgAya // foll., 4a to 4b 6b 53 dr "" "" 13 52 66 9" Iob 13 " 201 dr 91 14* On fol. 9b the scribe has utilized blank space by writing a number of times zrI, vI, ta, rA, ga, naM and m and then fr 3 times. 33 92 10b Author. Not mentioned, Subject. A story of Kurucandra, a minister. It illustrates the fruit of giving a resting place (afa) to a Jaina monk. Begins.- fol. 1a 14" 14b. S 10 IS 20 25

Page #237
202 Jaina Literature and Philosophy [ 154. ghasahIsayaNAsaNA bhattapANA bhesajje vadha sth)pttaaii|| jai vi apajai vi apajattadhaNo / gho(tho)vA vi hu thovayaM deha // 1 // tatra pasativiSaye / kura(ru)caMdramaMtrikathA // etc. ___Ends.-- fol. 44 ityaM parodheH nApikRtaspa vasatidAnasya phalamidaM bhAvanayAH sAdhanA pasatidAne svargApadhArgasaMpattiH syAt // 7 // ___ iti vasatidAnaviSaye kuracaMdrakathA / -- to kurucandramantrikathA Kurucandramantrikatha 1310 (2). No. 155 1886-92 Extent.- fol. 3deg to fol. 40. Description. Complete. For other details see No. 2 1886-92. Author.- Not mentioned. Subject.-- A story of Kurucandra, a minister. Begins.- fol. 3" || 10 // dAnaM supAtre / vizadaM ca zIlaM / tapo vicitraM zubhabhAvanA ca / bhvaarnnvottaarnnsttrNddN| dharma caturdA munayo vadaMti // 1 // etc. Ends.- fol. 4b bhAvanayA sAdhanAM dhasatirdAne svaggA'pargaH syAt / / iti vasativiSaye kurucaMdrakathA // 7 // etc. 20 kuladhvajakumAraprabandha Kuladhvajakumaraprabandha No: 156 1593. 1891-95. Size.- 10$ in. by 49 in. Extent.- 18 folios; II lines to a page; 42 letters to a line. Description.- Country paper thick, rough and white; Jaina __Devanagari characters; big, quite legible, uniform and 25

Page #238
The Svetambara Narratives 203 very good hand-writing; borders ruled in two lines and edges in one, in red ink ; dandas written in red ink ; a major portion of the first line, too, in the same ink ; foll. numbered in both the margins; fol 1 blank; condition very good; complete ; 358 verses in all. Age. - Old. 156.] Author.- Pupil of Kakka Suri of Upakesa gaccha. Is he Kirti - harsa? If so, he is the author of Sanatkumara-copai com - posed in V. S. 1551. , Subject. A story of Kuladhvajakumara in Gujarati. It points to out the importance of chastity-good character (fila ). Begins. fol. 1b // 60 // zrImahAvIrAya namaH zrI // zrI zrI / 5 somavimalasUrigurubhyo namaH / pAsa jiNesara pAya namI || 'jIrAoli' avatAra | mahIpAla mahimA jehatu (nu) || dIsai atihiM udAra // 1 // mani samarUM vAgesvarI || sevaka jana sAdhAri // saMSepi guNa sIlanA || boluM guruAdhAri // 2 // jiNasAsaNi jiNa bhAsIuM // dAna sIla tapa bhAu / sahi guru zrIkaka (kka) sUri bhaNai adhika sIlaprabhAva // 3 // sIlaI mamabaMchita phalaI sIlaI dukkhanivAra / sIla sura sevA | karaDaM || tarIi sIlaprabhAva // 4 // sIla sAdhe saMkaTa TalahaM / / sIla digha (ja) i dAna // mAna sIlaprabhAvaI saMpajaI / kariyali nava ya nidhAna // 5 // vastu // sIla utva (tta) ma uttama sIla suhageha || sIlavaMta jagi jANIhaM || vidhana tAsa navi hoi AsaI || jalaNi jala hoI avataraI // bAgha siMgha anai i (dU) ri nAsaI || sAgara saci thalavaTa jima / ra dhyAi nara soi || zrIkuladhvajakumAra jiuM suddha sIla jasa hoi / / 6 / / etc. S 15 20 25 30

Page #239
204 Jaina Literature and Philosophy [16. Ends.- fol. 18. mahIyali sohai guNagaNa bhUri 'udhapa(e)sa' gacchi zrIzrIkakkAbhUri / pAlA (saMyama) niraticAra guru guruyA goyama gaNadhAra / 54 navarasa bhaviSaNa diiM ubaesa / zIyala vaSANai ati savisesa / tAsu prasAdiI kaviyaNa (ima) khihN| kIu prabaMdha bhaviyAga bhaMgrahai // 55 // zIlaI hiva ja bUkumAra / thUlibhada goyamA guNadhAra // bAhuvAla sa(su)kosala sIha / seThi sudarzana sohaha dhuri liha / 56 sAlibhadra kuladhvaja anudina | e muni caubiha saMgha prasanna / mahI 'meru' jagi dApaDa isAra / tAM jinazAsani jayajayakAra / / 57 / / sIla taNA guNa jANi eha / / bhaNai guNai naranArI jeha / alIya vidhana savi nAsaI dUri / jaya maMgala hui bharapUri // 58 // iti zrIzIlaviSaye zrIkuladhvajakumara(rAsa saMpUNa / / Reference. - For extracts and additional Mss. see Jaina Gurjara Kavio (Vol. I, p. 92 & Vol. III, Pt. I, pp. 521-523). 20 kuvalayamAlA Kuvalayamala No. 157 154. 1881-82. Size.- 12 in. by 4g in. Extent.- 133 folios ; I lines to a page ; 74 letters to a line. Description.- Country paper thin, rough and greyish ; Jaina Devanagari characters with frequent Taras ; small, quite legible, uniform and beautiful hand-writing ; borders ruled in four lines in black ink ; red chalk ased ; mostly all the foll. numbered in the right-hand margin only ; fol. 64 in both the margins ; in the left-hand margins

Page #240
187.] The Svetambaru Narratives 205 of the numbered sides the title is written in various ways such as kuvalayamA, kuva0 mAlA and kuvalayamAlA; a thick paper of the size of a fol. pasted to fol. 1*; some of the foll. slightly worm-eaten ; condition on the whole good ; fol. 1a blank ; there is some space kept blank in the centre of 5 the numbered and unnumbered sides as well; complete ; extent 13000 slokas ; composed in Javalipura in Saka Samvat 700 (one day less) i. e. V. S. 835 = 21st March of A. D. 779 ). Age.- Pretty old. ____10 Author.- Uddyotana Suri alias Daksinyacihna Suri favoured by Hri, a goddess. His guru's name is Tattvacarya. As regards his secular parentage Vadesara alias Samprati is his father and Uddyotana, his grand-father. Subject.- A Prakrit campu narrating lives for illustrating bad effects is of anger etc. Almost in the beginning some of the eminent authors and their works are extolled. They are:Author Work pAlittaya ( pAdalipta) taraGgavaI guNaDDa ( guNADhya ) baDAhA pAsa ( dhyAsa) bhAraha (bhArata) dhammIya (vAlmIki rAmAyaNa chappaNNaya ( SaTparNaka) kAyambarI (kAdambarI) 28 devaguna ( devagupta) tipurisacarita harivarSa harivaMsupatti muloyaNA pamaMjaNa ( pramAna) asaharacariya aDila (jaTila) dharaGga ( gharAGgacaritra) bANa

Page #241
206 J aina Literature and Philosophy [157. rabiseNa ( rayiSaNa) pauma (padmacarita) bhavaviraha ( haribhadrasUri ) samaramiyaGkAkahA (samarAiccakahA) In the end the author gives his genealogy and bows to five Paramesphins and great personages of meritorious attainments, Indras and others. Begins.- fol. 1 e 605 ( ? ) namo dhItarAmAya / / paDhama namaha jiNida jAe naJcati jami deviio| udhvallirabAhulayAraNatamaNibalaya nAlehiM // purisakarariyakomalaNaliNIdalajalataraMgaraMgataM / NivattarAyamajaNabiMba jeNappaNo diDha // 2 vasiuM ciraM kulahare kalAkalAvasahiA NariMdesu / dhUpa va jassa lacchI ajja vi ya sayaMvarA bhamai / / 3 jeNa kao guruguruNA girigharaguruniyamagahaNasamami / saharisaharivAsaddhatamasaNo kesapambhArA // 4 tavataSiyapAvakaliNo nANuSpattIi jassa suranivahA / saMsAranIranAhaM tariya tti paNacire tuTTA // 5 etc. - fol. 133 vasudeva,milANaM hiMDIsuM kIsa nasthi rAgo tti / tattha na kiMci vi jaMpasi amhaM majhe Na tuha neho // etc. - fol. 133 jo jANai desIo bhAsa(sA)o lakSaNAI kmvaaii| ayaNayagAhAcheyaM kuvalayamAla pi so paDau / / etc. Ends.- fol. 133 paNamAmi dhammacakvaM jiNANa uptattiyaM rayaNacittaM dhammajjhayaM ti vaMde cehayarukkhaM pahAjAlaM // paumAsaNaM ca baMde cAmagjubalaM ca caMdakiraNAbhaM / sumarAmi duMdubhiravaM jiNassa pANiM ca baMdAmi // caMdAmi savvasiddhe paMcANuttaranivAsiNo je ya / loyaMtie ya deve vade savve haride ya // AhArehaya devahare baMdaha parihArasaMThie munninno| ughasAmagaNAthe baMdaha taha svayagahitthe / / . 20 25 30

Page #242
207 157.] The Svetambara Narratives baMde ghaudasapuvI UNe taha rAyage ya paNamAmi / egAragami AyArapArae paMcasamie ya akkhINamahANamie vaMde taha sIyateyalesille / cAraNasamaNe baMde taha jaMghAcAraNe nmimo| AsIvise ya vaMde jallosahikhalaosahidhare ya / AmosahI ya viyosahI ya sadhosahiM vade / / caMdAmi vI(bI)yabuddhi / vaMde viulaM ca koTabuddhiM ca / sadhvAyarie paNao ajjhAvayasatta(ba )sAhU y|| u(o )hI( hi )NNANI paNao maNapajjayaNANiNo ya je samaNe / paNamAmi aNaMtehi samvehiM baMdimo ahayaM / / balakesavANa jubaNe( le) sumarAmiha cakkaTTiNo s(bve)| aNNa (puNe) vi baMdaNijje pavayaNasA( re paNi )vayAmi / jiNajamaNabhUmIu baMdaNanimvANanANa' meru' ca / 'saMmeya 'selamihare siddhAyayaNe paNivayAmi / evaM jo paDai naro gAsagge aylmaattmjutto| savva sijjhai kajja tadviyayaha ( ) tamsa viulaM pi // cha / iya esa gaNijjatI terasakalaNAi jai shssaai| anno vi ko vi gaNehi so nAhI nicchiyA sakhA // iya esa samatta ciya hiridevIe varappasAraNa / karaNo hou pasannA / icchiyaphalayA ya saMghamsa // cha / samApteyaM kuvalayAlA nAma kathA // cha / graMthasaMkhyA sahasra 10(13)000 / kRti zrIzvetapaTanAthamune dakSiNya'. lAMchanasya u(da)dyotanasUre) // cha / / // cha / Reterence.- Published in Singhi Jain Series in A. D. 1959. For this edition this Ms. is utilized along with one from Jesalmer. This work is mentioned by Devacandra Suri in his Santinathacaritra in V. S. 1160. For some details see Jina. vijaya's article published in "Vasanta-rajatotsava-anka", A. M. Ghatage's article " Narrative Literature in Jain Maharastri " published in the Annals of B. O. R. I. ( Vol. XVI, pp. 31-35, my book entitled "Paiya ( Praksta ), Bhasao ane Sahitya" (pp. 100 102 ; &"Short History of Jain Literature" ( pp. 175-178) in Gujarati, 25 30

Page #243
208 Jaina Literature and Philosophy [197. For an extract see Kavyamimarinsa (Gaekwad's Oriental Series Vol. I, 31d edn., p. 204 ). For additional Mss. see Jinaratnakosa (Vol. I, p. 94). kUrmAputracaritra Kurmaputracaritra 5 (kummAputtacaritta) ( Kummaputt-caritta ) No. 158 339. 1871-72. Size.- 97 in. by 4g in. Extent.-- 6 folios ; 18 lines to a page ; 42 letters to a lines. Description.- Country paper somewhat thick and white; Deva10 nagari characters; small, clear and good hand-writing; lers ruled in two lines and edges in one, in red ink; red chalk used ; fol. 6deg blank; complete; condition Very good. Author.-- Jinamanikya, pupil of Hemavimala. 15 Subject.- Life of Kurmaputra, an omniscient personage written ___in Prakrit in verse. Begins.- fol. 1. ahe| nabhiUNa vaddhamANaM amugdisuriMdapaNayakamakamalaM / kummAputtacArattaM tucchAmi ahaM samAseNaM / 1 / / etc. 20 Ends..- fol. 6 kummAputtacarita veraggaraM suNei jo bhaviu / so savapAvarahio aNatasahabhAyaNaM haha / / 6 // siriharmAvamalasuhagurusigijanamANikamImarAeNaM / raha pagaraNa meNa ghAIjjataM / ciraM jayau // 7 // iti zrIkUmAputrakevali caritra / lideg cha / zrImuktisaubhAgya gabhiH paM. rAjasobhAgyapaunakate Reference.-- Edited with notes, glossary and introduction by P. L. Vaidya and published by himself in A. D. 1930 at Poona. A note on p. 41 is not faithful to the Jaina view. This work is published in " Jaina Vividha-sastra Sahitya mala", 30 100, in A. D. 1919. For additional Mss. see Jinaratnakosa ( Vol. I, p 95). l See kSetrasamAsa No. 1223 of 1891-95. According to some the author is his pupil named Abantahamsa.

Page #244
160.] The Svetambara Narratives 209 10 kUrmAputracaritra Kurmaputracaritra 1328. No. 159 1891-95. Size.-- 108 in, by 44 in. Extent.-- 5 folios ; 17 lines to a page ; s2 letters to a line. Description. - Country paper thin, tough and white ; Jaina Deva nagari characters ; small, partly illegible, uniform and very fair hand-writing ; borders not ruled ; red chalk used; foll. numbered in the right-hand margin; fol. so blank ; edges of a few foll. slightly gone ; condition on the whole good ; complete; 195 verses in all. Age.- Not modern. Begins.- fol. !' || namiUNa ba(va)ddhamANaM / amariMdasuriMdapaNayapayakamalaM / kummAputtacaritaM / bu(bu)cchAmi ahaM samAseNaM 1 'rAyagihe ' varanayare / nayarehApattasayalapurisaghare / eNasila(e) guNanilae / samosaDhe va(ba)ddhamANajiNo 2 etc. End.- tol. I. ia bohiabaha(hu)anaro kumA(mmA)putto sa kevalippavaro kevaliparibhAyaM pAliUNa suciraM sivaM patto 93 kumA(mmA)putta[ya]cArattaM veraggakaraM puNai jo bhaviu(o) so samvapAvarahiu(o) aNaMtasuhabhAyaNaM havai 94 sirihemavimalasahagurusirijina(Na)mANiksIsarAeNaM raI(i) pagaraName cA(vA)ijataM ciraM jayau 95 iti ku(kU)mAputrakathAnakaM samAptaM // 1 // N. B.- For other details see No. 158. 20 kUrmAputracaritra Kurmaputracaritra No. 160 588 1884-86. Size.-93 in. by 4g in. Extent.- I folios ; 12 to 13 lines to a page ; 34 letters to a line. 30

Page #245
210 Jaina Literature and Philosophy [ 160. Description. -- Country paper thick, rough and white ; Devanagari characters; big, clear and good hand-writing; borders ruled in two lines and edges in one in red ink; red chalk and white pigment used; fol, a blank except that " ! si Sato AA: 1" written on it; foll. numbered in the right-hand margin only; an edge of the fourth fol. slightly worn out; condition on the whole good ; complete. Age.-- Old. Begins.- fol. 16 HAFN GCAIO etc. as in No. 158. Ends.- fol. 116 kummAputtacarittaM etc. upto jayau / / 7 // practically as in No. 158. This is followed by the lines as under :___iti zrAmat'tapA'caMdragacchezaANaMdavimalasaripaTTAlaMkArazrIhemAvi malamariziSyazrIjinamANika yena kUrmAputracAratraM viracitaM // maho___pAdhyAyazrImuktisaubhAgyA ziSyA kalyANasaubhAgyenAlekhi // N. B.- For further particulars see No. 158. 10 15 20 kUrmAputracaritra Kurmaputracaritra No. 161 1231. 1886-92. Size. 10 in. by 43 in. Extent. -- 13 folios; 11 lines to a page ; 28 letters to a line. Description -- Country paper thin, brittle and smutty; Jaina Deva nagari characters with occasional AIES; big, quite legible, uniform and very good hand-writing: borders ruled in iwo pairs of lines in black ink; red chalk used; foll. numbered in the right-hand margin ; fol. 1a blank ; edges of some of the foll. gone ; two or three full. partly torn ; condition tolerably fair ; complete ; the last verse numbered as 195 ; yellow pigment used while making corrections. Age.- Pretty old. Begins. fol. 16 56 011 67972(=)ATT AA: 1 APA GATOj etc. as in No. 158. 30

Page #246
163.] Ends.- fol. 13 kUrmAputracaritra No. 162 kummAputtacaritaM etc. upto vAiaM ( jjaM ) taM ciraM jayau / 195 as in No. 158. This is followed by the line as under :iti kUrmAputrakathAnakaM paramaguruta N. B. For further particulars see No. 158. - -- Begins. fol. 2a Size. 10 in. by 4 in. Extent. 6 folios; 14 lines to a page; 45 letters to a line. Description. Country paper thin and greyish; Devanagari characters with occasional gas; big, clear and fair handwriting; borders ruled in four lines in black ink; red chalk used; yellow pigment, too; foll. numbered as usual; fol. I lacking; otherwise complete. Age. Not modern. Ends.- fol. 7b The Svetambara Narratives jai bhA (tA) tujjha cittaM vicittacittaMmi caMcalaM hoI / tA majjha aNudhAva vayaNamiNaM suNia so kumaro / 22 / etc. kUlavAlakakathA No. 163 211 Kurmaputracaritra 109. 1899-1915. kummAputtacaritaM etc. upto ciraM jayau // as in No. 158. This is followed by the line as under :iti ku ( kU) mAMputrakathAnakaM samAptamiti bhadraM / N. B. For further particulars see No. 158. No. Extent. fol. 24 to fol. 25. Description. Complete; 91 verses in all. For other details see 1310 (a). 1886-92. 5 10 Is 20 Kulavalakakatha 25 1310 (w). 1886-92. 30

Page #247
212 Jaina Literature and Philosophy [163. Author.- Not mentioned. Subject- A story of Kulavalaka depicting the fruit of showing disrespect to the teacher ( guru ). Begins.- fol. 24 syAt tapaH kRtamapyugrga | vane sthAnaM cirAya ca / pratIpasya guro kUlavAlakasyeva niHphalaM // 1 etc. __Ends.- fol. 250 __ kadApi zIrSa()Na giri bhinatti / kadApi siMhaH ka kupito na hanyAt / kadApi bhiMyAnna ca shktikottiH| paraM na mokSo guruhIlakasya / / 91 iti gurupratApe kUlavAla(ka)kathA // 5 // Reference.- For an additional Ms. see Jinaratnakosa (Vol.I, p.95). There this work is said to be same as Kulapalakakatha noted on p. 94 of it. Krta punyakatha ___1310 (y). 1586-92. kRtapuNyakathA No. 164 Extent.- fol. 270 to fol. 28b. Description - Complete ; 63 verses. 1310 (a). For other details see 20 No. 1886-92.. Author.-- Not mentioned. Subject.- A story of Krtapunya (Kayavanna) in Sanskrit in verse. It illustrates the fruit of donation given to a deserving personage. 25 Begins. - fol. 27 sapAtre dadatAM dAnaM / ye kurvatyaMtaraM nraaH| sAMtarAMte zriyaM pretya / labhate kRtapuNyavat // etc. Ends. - fol. 28 jAtismR[ // kRtapuNo ]te / pUrvamavaM viditvA / ghareNyasatvaH kRtapuNya uktaH vrataM jinAMte jagRhe mahIyaH

Page #248
165. ] Reference. The Svetambara Narratives Garaq: ergorgarq 11 63 dAne kRtapuNyakathA // 6 // In Jinaratnakosa (Vol. I, p. 95 ) a Ms. of the work of this name is noted. Is it pertinent ? Age. Samvat 1658. Author. kRSNacaritra (mogafta ) No. 165 Size. 10 in. by 43 in. Extent.- -55 folios; 1 lines to a page; 34 letters to a line. Description Country paper somewhat thick, tough and white; Jaina Devanagari characters with occasional gears; big, quite legible, uniform and very good hand-writing; borders ruled in two pairs of lines in black ink; foll. numbered in the right hand margin; fol. 1a blank; yellow 15 pigment used while making corrections; there is a red spot in the centre of the numbered and the unnumbered sides as well; in the case of the former there is one red spot in each of the two margins, too; in the left-hand margin the title is written as ; condition very good; com plete 1158 verses in all. Not mentioned. Begins. fol. 10 finst a$?: 213 Krsnacaritra (Kanhacaritta ) 670. 1892-95, 25 Subject. A metrical composition in Prakrit describing the life of Krsna, one of the nine Vasudevas. He will be the 12th Tirthankara named as Amama in the ensuing Utsarpini in India (Bharatavarsa), and he along with his former brother will then attain salvation. daMsaNa 9 viNae 10 Avassae ya 11 salie niraiyAro 12 woga 27 az 28 feaur ?4 araraaa 26 Hant a 20 S 10 20 arihaMta 1 siddha 2 pavayaNa 3 guru 4 ghe ('the) ra 5 bahussae 6 tabassIsa 7 vacchalayA ya esi abhikkhanANo cauge ya 8 30

Page #249
21A Jaina Literature and Philosophy [165. apudhvanANagahaNe 18 suyabhattI 19 [pa] pavavaNe pabhAbaNayA 20 eehiM kAraNoha titthayarattaM lahai jIvo tti kAcit dazArhAH samasta' yaduvaMzapUjyAH etc. __Ends.- fol. 55b iha ceva 'bharaha'vAse bhavissacauvIsigAi vissanau / / bAramau amamajiNo hoUNaM sivasuhaM lahihI // 56 baladevo vi hu paMcamakappAu cavittu ittu 'bharaI 'mi // bhavasi vio ya bhayavaM sijjhissai kanhatityami 57 dasArasIhassa muNitu evaM // ___ pabhAvaNaM vi(ti)tyakaratva(ta)he // to bhanvasattA bahubhattimaMtA . kareha sattIi imaM pasaMtA / / 1158 5 iti zrIkRSNacaritaM samAptaH // zrIrastu 5 saMvat 1658 varSe jeSTha sudi 7 vAra some zrI staMbhatIrthA na joso zavajIlaSitaM 7 : dharmArthImAhapUjA. paThanArtha tathA paropakArArthaH / / zubhaM bhavat : 7 / kalyANamastu ::.: Reference.- Only this Ms. is noted in Jinaratnakosa ( Vol. I, p.95). 10 kRSNa-yudhiSThira-dharmagoSTI Krsna-Yudhisthira-dharmagosthi sAthai with artha 710(a). No. 166 1875-76. Size.- Ion in. by 43 in. Extent.- (text ) 34 folios ; 4 lines to a page; 40 letters to a line. , - (com.), "; 10 , , , ,; 57 , , , , Description.--- Country paper, rough and white; Devanagari characters ; big, legible and elegant hand-writing ; borders not ruled ; red chalk used ; foll. numbered as usual ; fol. 1deg & 34deg blank ; this Ms. contains the text and its explanation in Gujarati as well; the latter written mostly above the coresponding lines of the text; both complete ; they are followed by an additional work viz, "vedapurANamadhye GASTIET Jik".commencing on fol. 30* and ending on .fol. 34"; condition very good. . . . . .

Page #250
166.] The Svetambara Narratives 5 10 Age.-- Not modern. Author of the text.-Not mentioned. --, artha.- " " Subject. - A religious conversation between Krsna and Yudhisthira along with its explanation in Gujarati. The former is in Sanskrit in verse. Are these verses extracted from Maha bharata? Begins.-- ( text ) fol. 10 e0 // zrIjinAya namaH / zrUyatAM dharmasarvasvaM zrutvA caivAvadhAryatAM / AtmanaH pratikUlAni pareSAM na samAcarat 1 // etc. satyenotpadyate dharmo dayAdAnena vardhate / kSamayA sthApyate dharmaH krodhalobhAd vinazyati / / 3 / / etc. " -( com. ) fol. 1 zrIjinAya namaH / dharma saghalAe sAMbhalI iM aneM sAMbhalIne hoiM dharIi pachI AtmanaH ke. hatAM ApaNA Atmane hItakArI jANIiM te dharma AdarIiM etc. Ends.-- ( text ) fol. 296 evamAtmA sabho bhUtvA sarvamUteSu pArthiva ! / sarveSAmeva jIvAnAM nityameva sukhaM priyaM / / 61 // pRthyI ratnena saMpUrNA brAhmaNebhyaH prayacchati / ekasya jIvitaM dadyAt phalena na samaM bhavet // 62 // asthi( sthA) (ba)sati rudrazca mAMsa vasati kezavaH / zukre vasati brahmA ca tasmAnmAMsaM na bhakSayet // 63 // iti zrIkRSNayudhiSThiragoSTi samAptaH / ,, - (com. ) fol. 29deg pRthavI sArI ratne bharI pUrI koeka brAhmaNa pratiM dAna dII eke pAse koeka jIvane dAna dAI paNi behunu phala sarakhu nahi // Reference. - Only this Ms. is mentioned in Jinaratnakosa (Vol. I, p.95). 20 -

Page #251
10 IS 20 216 25 Jaina Literature and Philosophy zakumAra catuSpadI (kesI kumAra caupaI) No. 167 Size. 103 in. by 43 in. 5 Extent. 23 folios; 16 lines to a page; 45 letters to a line. Description. Country paper thin, rough, tough and white; Jaina Devanagari characters with gears; sufficiently big, quite legible, uniform and very good hand-writing; borders ruled in two lines and edges in one in red ink; red chalk used; foll. numbered in both the margins; fol. 1 blank; so is the fol. 23deg; in the left-hand margin the title is written as ; yellow pigment used while making corrections; edges of the last two foll. slightly gone; condition on the whole good; complete; composed in Samvat 1806 at Garabadesara. (1) kAlAsavesI - copaDa (2) dharmadatta - copar3a (3) pUjAbattIsI (4) bhAvapacIsI ( 5 ) metArya - copaDa ( 6 ) rAtribhojana - copai samyaktva - sar3asaTha bola - sajjhAya kozala- copai (7) ( 8 ) (9) sudarzana- copaDa (10) supratiSTha - copar3a Kesikumaracatuspadi (Kesikumaracaupai) Age-- Pretty old. Author. Amaravijaya, pupil of Udayatilaka of Kharatara gaccha. His additional works are as under : [ 167. 1595 1891-95, V. S. 1761 V. S. 1786 V. S. 1787 V. S. 1800 V. S. 1797 V. S. 1803 (dhanaterasa) V. S. 1799 V. S. 1790 V. S. 1798 V. S. 1794 V. S. 1771 (11) sumaMgala - rAsa 30 Subject.-- A Gujarati poem pertaining o Kesikumara (a follower of Lord Parsva in the days of Lord Mahavira) and king Pradasi, an out-and-out atheist.

Page #252
167.] Begins. fol. 1b 60 // zrIgaNezAya namaH atha kesIkumAracaupaI likhate Ends.- fol. 23a cUhA svasti zrI arihaMta sidhi AcAraja uSajhAya ratnatrayasAdhaka munI praNamyAM pApa palAya 1 sumita brahmANi jiNaguNa hai agama aneka vine bhagati kari mAMgi ha dIjai bodha viSeka 2 goviMda guru adhika je sarve nita pAya arita zrIdhara kare Atamaridhi pragaTAi 3 vacanakalA tehravI nahI nahi tehavo na gyAMna alapa mane AraMbha kIya sudha karIyo budhavAMna 4 munivaranA guNa gAyavA mo mana bhayo ucchAha zrIgurudevaprasAda vighana abhyaoNna vilAhi 5 zrIpArasasaMtAnIyA kesInAma kumAra tAhi prabaMdha racuM ma (?) dA paradesI adhikAra 6 etc. The Svetambara Narratives nicai nai viSahAra arAdhe paNa samavAyadhama sAdhe jI soI samakitI jIva kahAye syAdavAdamati dhyAve jI 740 nRpaprIthI e adhikArA riSamaMDala bhI bicArA jI kathAko sanI le saMpradAyA ikaThA kari ju milAyA jI 840 haMsane haMsa jyu sUjhe guNa laMbe mana bUjhe jI adhama ulU ravi deSata rIse jisa avaguNa tiNa dIse jI 940 riddha siddha supa saMpati pAU~ bhAvaTha alagI bhAjai jI ANaMda maMgala jaya jasa gAjai dhama dhAre mana sAjai jI 1040 pahirai muniguNagalamAlA sugbha sugata e rasAlA jI tehane pUje tridasanI bAlA miTai kugati duSajAlA jI 1140 kharatara 'pati jiNacada savAyA udayatilaka uvajhAyA jI amaravijaM gurucaraNa pasAyA kesI muni guNa gAyAjI 1240 rasa pUraNa basu haMsa ( 1806 ) supara vijadasama dina hara jI 'gArabadesara' rahyA comAso pAyo suSa ulAso jI 1340 eha saMbaMdha racyo suvicArI vaktA zrutA hitakArI jI suNasI maNasI je naranArI bihune magalakArI jI 1440 4 28 [J. L. P.] 217 5 10 15 20 25 30

Page #253
S to 15 20 218 30 Jaina Literature and Philosophy jAM laga rAja kare suraiMdo jAM laga 'meru' giraMdo jI jAM laga bhUdrU thira ravi caMdo jaina dharama cira naMdo jI 1540 dhana dhana zrIkesI munarAyA // iti zrIkesIkumAracaritra saMpUrNa // zrIH zrIH zrIH etc. Reference. For an additional Ms. see Jaina Gurjara Kavio ( Vol. III, Pt. 2. p. 1458 ). --- kezi-pradezI - rAsa No. 168 Size.-- 10 in. by 44 Extent.-- 22 folios; I lines to a page ; 42 letters to a line. Description.-- Country paper thick, rough, tough and greyish; Jaina Devanagari characters; big, quite legible, fairly uni - form and very good hand-writing; borders ruled in three lines in red ink and edges in one in the same ink; red chalk used; foll. numbered in both the margins; fol. 1 blank ; so is the fol. 220; red chalk profusely used; the title is written in the left-hand margin at times kesI paradesI and many a time as paradesI cau0 ; yellow pigment used while making corrections; edges of the 1st fol. slightly gone ; condition on the whole very good ; complete. as Age.-- Samvat 1813. Author. Jnanacanda, pupil of Dayadharma. Subject.-- An episode pertaining to Kesin, a monk and Pradesi, a king. 25 Begins. fol. 1 | 6011 in. [ 167. Kesi - Pradesi-rasa 669. 1892-95. dUhA praNabhI zrI arihaMta samarI siddha anaMta AcArija uvajjhAya bali sAdhu sahU bhagavaMta 1 sAsananAyaka salahIyai gharadAI vadhamAna gurU gotama guNa gAIyaha dAyaka baMchita darzana 2 etc.

Page #254
169.7 The Svetambara Narratives 219 Ends.- fol. 221 dUra hujyau saha pAtaka mAharau adhika uchanu kAu jeha nirjarA je thaI dharamaguNa joDatAM hiva lahu tiNa bhavacheda 88 jaga. dhanna sAsana mahAvIranau sevIya i jihAM lahyA e adhikAra kahai jJAnacada ima sadaguru sevatAM pAMmIyai sivasukhasAra 89 jagatraguru zrIdayAdharama jayakAra / / iti zrIparadesIprata(ti)bodha samAptaM // saMvat 1813 varSe bhAdravAsudi 13 dine paMDitamahAsiMghajIgaNitatsiSya - paMDitagokalacaMda likhitaM bhaTaneramadhye / 10 15 kezi-pradezI-rAsa Kesi-Pradesi-rasa [kesIvacanaparadesI [ Kesivacana-Paradesiprabodha ] prabodha] No. 169 1478 (a). 1887-91. Size. 9 in. by +} in. Extent. 22 folios; 17 lines to a page ; 34 letters to a line. Description.- Country paper thin, rough and greyish; Jaina Devanagari characters; big, quite legible, fairly uniform and tolerably good band-writing ; borders ruled in two lines and edges in one in red ink; red chalk used; foll. numbered in the right-hand margin; fol. I' blank ; right-hand corners of a number of foll. gone; condition on the whole tolerably good; white pigment used for making letters illegible ; complete ; 595 gathas in all. At the end there is an additional 'work named saptanaya catuSpadI which begins on fol. 22 and ends on fol. 22". Age.- Not modern. Begins.- fol. 1 // 6 // zrItIrthakarAya nmH|| 25 20 praNamI zrIarihaMtapaya samarI siddha anaMta / AcArija uvajjhAya vali sAdha sahU bhagavaMta // 1 // 1 This work ought to have been assigned a place in Vol. XVIII, pt. 1.

Page #255
10 15 20 25 220 Ends. Jaina Literature and Philosophy sAsa nAyaka salahIyai varadAI vadhamAna / ru gotama guNa gAIyaha dAyaka cchita dona // 2 // dharamAvArija dharamagurU mana ghari sudharamasAmi | jaMbUpa (mu )kha mahAyatI samarI zruta zubha nAma // 3 // bIya uyaMga bUjhavyA rAyapaseNA raMga pradesI rAjA pravara sadaguru kesI saMga 4 racanA te adhikAranA rU (ra) cadhA mujha mana rAga paNa manabaMchita pUravA sudhau sadagurulAga 5 etc. fol. 224 zrIdayAdharama jayakAra pAmiyaha bhava taNau pAra jaga0 samakita zuddha AdhAra jagatraguru 0 // iti zrIkesIvacanaparadesIprabodho ( ( ) yaM samAptaH zrIrastu sarvagAthA / / 595 / / 60 N. B. - For additional information see No. 168. [169. kSamarSiprabandha No. 170 Size. - 93 in by 44 in. Extent.-- 2 folios; 15 lines to a page ; 5o letters to a line. Description.---Country paper somewhat thick, tough and white; Jaina_Devanagari characters; small, quite legible, fairly uniform and very good hand-writing: borders neatly ruled in three lines in red ink; the first fol. numbered in the right-hand margin only ; the second, in both the margins ; in the left-hand margin the title is written as 'kSamarSiprabaMdhaH' ; condition very good; complete. Age.-- Samvat 1714, Saka Samvat 1572. Author.--- Not mentioned. Subject.- Life of Ksama alias Boha rsi in Sanskrit. Herein an abhigraha (a sort of vow ) is described at the end. Ksamarsiprabandha 341. 1871-72.

Page #256
221 17] The Svetambara Narratives Begins.- fol. ! // 6 // atha kSamarSiprabaMdhaH // ___ 'citrakUTa 'purAsannagrAme | nirddhano bohAkhyabhAcho neSTAvAnAsIt / ___ sa duHkhena nijakuMTuMbaM nirvahati / anyadA sa paMcadrammaiH snehakutupakaM bhUtvA / 'citrakUTa'mAgacchan padaskhalanAt ptitH| etc. Ends.- fol. 2' tato yazobhadrasUri pattane jJAtvA mayA gurumavaMditvA naivAnodake 5 grAhye ityasigRha 'pattanaM prAptaH gugyo natA / guAdezataH punyarityabhigraha llo| tRpasya paTTahastI madonmatto vRddhastrIvazago yadi pIcaDa / khAriki / khajUra / khaDahaDhI / khala / etaiH paMcakhakAraiH pArayati tadA pArayAmi / nAnyathA / mAse gate zAsanadevatayA jaratIrUpaM kRtvA gajau (jo) vazIkRto yatizca pArAvitaH // evaM caturazItiH pAraNAni yaterjAtAni / tato(s)nazanaM lAtvA svaryayo / cha // 10 iti kSamarSiprabaMndhaH // zrI // munivinayaratnena lakhitA sojhitanagare saMbat 1714 zA 1572 varSe Reference.-Only this Ms. is noted in Jinaratnakosa (Vol. I, p.97). 20 kSullakakumAraprabandha Ksullakakumaraprabandha 69(a). No. 171 1898-99. Size.- 104 in. by 44 in. Extent.-- 7 folios ; 13 lines to a page ; 36 letters to a line. Description.-- Country paper very thin, tough and greyish ; Jaina Devanagari characters with frequent qraiars; big, fairly legible, uniform and good hand-writing ; borders ruled in two pairs of lines in black ink ; red chalk used ; foll, numbered in both the margins; there is some space kept blank in the centre of the numbered and the unnumbered sides as well ; in the left-hand margin the title is written as pulaca. and phulla kumA0, too; condition very good; some foll, have stuck together probably owing to the presence of gum in the ink used ; complete; composed in Samvat 1667 at Multan; this work ends on fol. 7b; this Ms. contains an additional work viz. navakAragItA which is written in a different hand-writing and which commences and ends on the same fol. 7deg; yellow pigment used while making corrections.

Page #257
222 Jaina Literature and Philosophy [171. I0 Age.- Samvat 1669. Author.- Upadhyaya Padmaraja, devotee of Punyasagara of Kha ratara gaccha. He is the author of the following works, 100: (1) abhayakumAracopai V. S. 1650. (2) sanatkumAracopai V. S. I650. Subject.- A Gujarati poem depicting the life of Ksullakakumara. Begins.- fol. ! // 6 // dhuri dUhA // pAsa jiNesara payakamala / paNabhu parama ulhAsa / suSapUraNa suratarusamau / jAgai mahimA jAsa // 1 // samarUM zrutadevI suguru / anupama guNa AvAsa / jasu sAMnidhi sevaka lahai / suMdara vacanavilAsa // 2 // etc. Ends.-- fol. 7* solahasai satasaTTA (1667) baccharadda / zrI'mulatANa' majhAri / phAyaNa mAsa dhavala paMcami dinai / saMgha sayala muSakAra // 38 // 'paratara' gachi jinahaMsa sUrIsarU / mahimA guNa abhiraam| .. tAsa sIma uvajhAyasiromaNI puNyasAgara guNadhAma // 39 // dh0|| tamu padapaMkajamadhukarasama sohai / padamarAja ubajhAya / e saMbaMdha bhaNai suSakArai pAsa jiNida pasAya // 40 // jugapradhAna jaga mAhe paragaDA / zrIjinacada jatIsa | AcArija jinasigha sUrIsarU / tasu upadesi jagIsa // 41 // bhaNai guNai je bhadhiyaNa sAMbhalai / e saMbaMdha rasAla / te pAmai kalyANaparaparA riddhi siddhi muviptAla / / 42 / / dhana / iti zrIkSullaka kumaarrissiprbNdhH| saMpUrNaH 'zrI'mUlatrANa nagari / graMthAnaM 205 lA(zlo)kA / Dhala 7 kalyANamastu / saMvat 1669 varSe / / magasira mudi 12 dine / budhavAre // 'puuglkotttte'|| // 7 zrIpuNyasAgaramahopAdhyAgaziSyazrIpadmarAjopAdhyAyaziSyapaM jJAnatilakagaNiziSyeNa paM0 / / pUrNasiMhamuninA lipIkRtaH // // zubhaM bhavatu lekhanapAThakayoH // zrIH // 7 // zrI // Reference. For extracts and additional Mss. see Jaina Gurjara Kavio ( Vol. JII, Pt. I, pp. 876-877). 30 1-2 Yellow pigment is applied to this portiou.

Page #258
172.] The Svetambara Narratives 223 gAdattakathAnaka Gargadattakathanaka (gaNadattakahANaya) (Gaigadattakahanaya) 1329. No. 172 1891-95. Size.- 101 in. by 4; in. Extent. - 21-1=20 folios ; 13 lines to a page ; 36 letters to a line. Description. -- Country paper thick, tough and white ; Jaina Deva. nagari characters with occasional JEANS ; small, quite legible, uniform and very good hand-writing ; borders ruled in two pairs of lines in black ink; red chalk used; 10 foll. numbered in the right-hand margin ; almost each and every fol. slightly worm-eaten; condition on the whole tolerably good ; there is some space kept blank in the centre of the numbered and the unnumbered sides as well ; the first fol. is missing ; so this work begins abruptly; 15 yellow pigment profusely used in some cases while making corrections. Age.-- Samvat 1682. Author.- Not mentioned. Subject.-- Life of Gangadatta, a Jaina monk narrated in Prakrit in 20 prose. Begins.- abruptly fol. 2" yA soiTrakhohayaM / pacchare muNa ciMteI / jai ko vi paisarissai / to pageNa jANesu / evaM diNe viNe kareUNa rAyassagAsaM gacchai / evaM paJcaI kAlo aha annayA kayAI / jugaMdharo nAma Asi sAhu etc. 25 Ends. fol. 21 jAva mA paDibaMdha kAyakvaM / jAva samaNovAsao jAo / jAva pajubAsaI / tau / gagadattA / / cAudisamuhaTTapunnamAsaNisu / posahovavAsa sa pAlemANo viharai / paramasAvago jiNavarabhatto / guruudevsrmuusaapro| mukkhasuhamagAmANo / acchaDa / annayA / kayAI saMsArabhauvigo pchttaa| bahucauthachaTTaaTTame bahuvIsAo pariyAo pAlittA / jAva savvadukkhANaM aMtaM 30 phAhiti || gaMgadattassa kahANayaM samattaM // graMthasata 550 // saMvati 1682. varSe / Aso'sitadvAdazItithI cNdrvaasre| likhitaM zrI vayarATa'pure / prato yathA tathA // zrIvijayazekharamunibhiH / / zrIH //

Page #259
224 Jaina Literature and Philosophy [ 173. gajasiMhabhUpacaritra Gajasirnhabhupacaritra No. 173 113. 1875-76. Size.- 11 in. by 6 in. Extent.-- 26 folios; 12 lines to a page ; 38 lettets to a line. s Description.-- Country paper thick, tough and white ; Jaina Deva nagari characters; big, quite legible, uniform and very good hand-writing ; borders ruled in two lines in red ink; white pigment used for making letters illegible ; foll. numbered in both the margins ; fol. 1* blank; so is the fol. 26deg3; condition very good : complete ; the last verse is numbered as 421 ; composed in Samvat 1556. Age.-- Not modern. Author.- Nemikunjara. Subject.-- A Gujarati poem describing the life of King Gajasimha. It points out the importance of sila. Begins.- fol. 1 // 60 // zrIjinAya namaH // // pAsa jiNesara paya namI / tevIsamauM jiNaMda sevyau suSa saMpati diyai / paNamaI sara nara iMda // 1 // 'kAsamIra' mukhamaMDaNI / samariya sara(sa)ti mAya / sIla taNau phala varNavaoM / gAvauM gajasiMgharAya // 2 // nava rasa manaraMgi varNavauM / zAstra mAhi je hoh| vIrakathA rasi dharNao / te nisuNauM sahu koi // 3 // etc. Ends.- fol. 26 gajasiMha bhUpa taNau crii| maI kasi( hi? )yau saMkhepi / bhaNai guNaiM je sAMbhalaI / mukha saMpati lahahaM teya // 19 // cupii|| sudaguru taNI nAma 5 mani dharI // bolai zrIgajasiMhanau crii|| 20 25 1 See Jaina Gurjara Kavio (Vol. III, Pt. 1, p. 524 ).

Page #260
174.] The Svetambara Narratives 235 je paMDita nara punya karaMti // suMdara rAja te ima pArvati // 20 // // iti gayasiMharAyacaritraM samAptaM // 421 // Reference. For extracts and additional Mss. see Jaina Gurjara Kavio ( Vol. I, pp. 100-101 and 95 & Vol. III, pt. 1, pp. 524, 526 and 527). s. 15 gajasiMhabhUpacaritra Gajasimhabhipacaritra 278. No. 174 1871-72. Size.- 10 in. by 41 in. 10 Extent.-- Is folios ; 15 lines to a page ; 40 letters to a line. Description.- Country paper thir, rough and white ; Jaina Deva nagari characters ; small, quite legible, uniform and very good hand-writing; borders ruled in two pairs of lines and edges at times in one or two lines in black ink ; red chalk used ; foll. numbered in the right-hand margin ; edges of some of the toll. gone; condition on the whole good; complete. Age.-- Samvat 1733. Begins.- fol. 1* // paMDitazrIcaMdravijayagaNigurubhyo namaH / dRhaa|| pAsa jiNesara pAya namI etc. as in No. 173. Ends.- fol. 15b gajasiMhakumara taNuM carI etc. up to rAja suMdara te ima pAmaMti 11 8C ll as in No. 173. This is followed by the lines as 25 under : saMvata panara pa(cha)cha(pa)naha (1556) sahI / prathama jyeSTha punyama lhii| budhavAra anurAdhA mAMhi / kIo carIta manauchAhi / / 49 / / iti zrIgajasiMharAjAna caupaI saMpUrNa // likhitaM ca paMDitapradhAnapaMDitazrIpadmavijayagaNiziSyapaM jyvijygnninaa| 'viThorA'nagare saMvata 20 1733 varSe / zrAvaNa zudi 2 ravau vAre / svavAcanakRte / zubhaM bhavatu // 1 // 6 // N. B.- For additional information see No. 173. 29 [J. L. P.]

Page #261
s 226 Jaina Literature and Philosophy [ 175. gajasiMhabhUpacaritra Gajasimhabhupacaritra No. 175 675. 1892-95. Size.- 9 in. by 41 in. Extent.-- 17 folios; 17 lines to a page ; 44 letters to a line. Description.-- Country paper thin, rough and greyish ; Jaina Deva nagari characters; small, quite legible, uniform and tolerably good hand-writing ; borders ruled in two pairs of lines in black ink ; red chalk used ; all the foll. except the first numbered in both the margins; the first, in the right-hand margin only ; in the left-hand margin the title is written as starte and TALO ; edges of some of the foll. slightly gone; condition on the whole good ; yellow pigment used on fol. 176 to make the last but one line illegible; complete; the entire work is divided into four khandas as under : Khanda I foll. 16. to go IO 20 , III , 96 >> 136 ,, IV ,, 136 ,, 176. Fol. 1a is blank except that the following line is written on it : jAbAlapura mAhi lipI saMvat 1790 varSe. Age.-- Samvat 1678 (? 1790 ). Begins -- fol. 1deg yo il Tarot #A: 11 ET: Tre HOAT OUT apt etc. as in No. 173. - fol. sa glat BIATHLETI TUA LE FAIT: 11? - fol. g6 sia stagiha3qg feaio die FATA: 113 - fol. 136 haqiqat iT FAIR: 113 Ends.-- fol. 170 TETAE ag att etc. up to FA Trafall 88 || as in No. 173. This is followed by the lines as under : 25

Page #262
176.] The Svetambara Narratives 227 saMvat panarai chapannai (1556) shii| prathama jeTha pUnima dina lhii| budhavAri anurAdhA mAMhi kIdhau carita e mani uchAha / / 92 // iti zrIgajasiMhacaupaI caturtha paMDa samAptaH // 4 // saMvat 1678 varSe / kArtika vadi 11 dine zrIvahadamaMDAhaagadevAbhIzradevasuMdaraziSyamohanajIliSataM / / gAthA 492 // graMthAnaM 772 // // 5 zubhaM bhavatuH // zrIrastuH // AcaMdrAko 'ciri niMdit / / cha: chaH 1 // N. B.- For additional information see No. 173. 15 gajasiMhabhUpacaritra Gajasimhabhupacaritra No. 176 1598. 1891-95. Size.-98 in. by 41 in. Extent.-- 60-2=58 folios ; 16 lines to a page ; 30 letters to a line. Description.- Country paper somewhat thick, rough and white ; Jaina Devanagari characters; big, quite legible, uniform and very good hand-writing; borders and edges as well ruled in two lines in red ink ; numbers for the verses and their dandas and some lines written in red ink ; foll. numbered in the right-hand margin ; the first two foll. are missing ; so the work begins abruptly; condition very good; the entire work is divided into four ullasas ; the extent of each of them is as under: Ullasa ( vierama ) I foll. 3deg to 202 ___" , II , 20,, 320 III , 320, 420 , IV ,, 42' ,, 60. Fol. 37a blank; so is the fol. 606; composed in Samvat 1653 at Pindapura. Age.- Samvat I904. Author.- Manavijaya, pupil of Kapuravijaya and' guru of Pratapa. _He has composed Manatunga-Manavati-rasa. Subject.- A life-sketch of Gajasimha in Gujarati in verse. 20 30 1 Iseems that the correct reading is. "ciraM naMdatAta".

Page #263
5 10 IS 20 25 30 228 Begins (abruptly ).-- fol. 3a Jaina Literature and Philosophy ligAra la0 eka putra diyarasamo | hosyai bhujaniradhAra | la0 / 4 i0 gotrajA kahe bhUpati prate pAlo jinAjJAsAra / arihaMta deva pUjana karo / bhAva gharI suvicAra la0 5 etc. Ends.- fol. 59b zrI ' vaDa' gaccha vijayANaMdasUrI | zrIbIjehIra savAyA jI / sUdhAcAra (kri) yAnA pAlaka / bhaviyaNaneM mana bhAyA jI 12 gA0 tAsa paTTadhara gyAnaprabhAkara // zrIvijerAjasUraMdA jI / afarmarada (a) vikasita karavA / jehavA sArada caMdA jI 13 gA0 tehanA vinamaMDalImaMDaNa / dAnavijaya uvajhAyA jI / jiNa paTa darzana vAda karIneM / vAdIvRMda haThAyA jI 14 gA0 tAsa zISyavara vRddhivIjaya kavI sunIgaNa mAheM mahaMta jI tasa padapaMkajabhamara taNI pare labdhapratiSThAvaMta jI 15 gA0 paMDita | kapUravijaya gururAyA pAMmI tAsa pasAyA jI pyAre ullAse cosaha (Tha) DhAle / mAMnavijaya guMga gAyA jI 16 gA0 saMta rAma bANa dhRtIyA (1853) varaSe / mujha matineM anusAru jI / phAlaguNa si ( dvidhi (ti)yA ne divasa / rAsa racyo eMDa vAru jI 17 gA0 e munIrAja taNA guMNa gAyA / vijayalakSmIsUrIrAjye jI / je zrutasAgara guMNamaNI Agara / 'gaMga' jyu kIrata gAje jI 18 gA0 'pi (piM) Dapure comAsa rahIneM / saMghavacanasaMketa jI / eha sabaMdhanI racanA kIdhI / zISya pratApane hete jI 19 gA0 je ekaciteM munIguMNa sUNasye / thAsye janama pavItra bhI / jyu acala raho 'ilapura' / e gajasIhacarItra jI 20 gA0 e uttama guMNa bhaNatAM thuNatAM / vighana thAi bisarAla jI / bahU lIlAleharI pAMmasye | lahasye Rddhi vauzAla jI 21 gA // [ 176. kalazaH 'tapa' gaccha nAyaka | gyAnadAyaka / zrIvijayalakSamIsUrIsvarU suvihitacArI vaMbhadhArI / bhamara timaharavi (di) nakaru | bidha kapUravijayasevaka / mAMna kahe yaza ma (hama) hai / gajasIha pare je zIla pArle / kIrttikamalA te lahe // 1 //

Page #264
177.] The Svetambara Narratives 229 itI zrIgajasIhacarItre prAkRtaprabaMdhe yogImInAjItya svarNapUra saMprApti vezyAviDaMbanaM caturthakanyAprA(pA)NIgrahaNAMmAgatya rAjyAbhiSekamohachavakevalIdezanA purvabhavavarNana pravajyAgrahaNaM mokSaprAptivarNane yo e bhI padArthe caturthollAsa saMpUrNam // jaba laga 'meru' aDaga he taba laga sasI ara sUra // jaba laga A pothI sadA rehajo guNa bharapUra // 1 // zrIsaMvastu zrIkalyANamastuH / saMvat 1904nA mAhA vada 12 guruvaasre| l| sAdhvI laSamI zrI pomAvA'grAme comAsu kRtvA zrIzaM(zAM)tinAthajI prasAdAtH // shrii||1|| Reference- For extracts and additional Mss. see Jaina Gurjara 10 Kavio ( Vol. III, pt. I, pp. 196-198 & Vol. III, pt. 2, p. 1544). 5 20 gajasukumAlakathA Gajasukumalakatha 1301. No. 177 1887-91. Size.- 10 in. by 4g in. Extent.-- 22 folios ; 15 lines to a page ; 35 letters to a line.. Description. - Country paper somewhat thick, rough, tough and white ; Jaina Devanagari characters with rare garais ; big, quite legible, uniform and very beautiful hand-writing; borders ruled in three lines and edges in two in red ink ; foll. numbered in the right-hand margin ; fol. 1 blank; so is the fol. 22deg; central portions of the numbered and the unnumbered sides as well decorated with a design in red colour: in some cases even the marginal portions are so decorated; dandas written in red ink ; yellow pigment used while making corrections; condition very good except that the edges of the last fol. are slightly gone ; complete. Age.- Pretty old. Author:- Not mentioned. Subject. - This work mostly in Sanskrit narrates the life of Gajasukumala, the youngest brother of Vasudeva Krsna. This narration points out the importance of sorgiveness. 30

Page #265
230 Jaina Literature and Philosophy [1778 Begins.- fol. 1 // 6 // / // khaMtI suhANa mUlaM / mUlaM dhammassa uttamA khetii| harai mahAvijjA iva / khaMtI duriyAI savvAiM / 1 // ihAsmin jinazAsane / sarvasaMsAre sukhAnAM mUlaM kiM / kSatiH kSamA / tathA dharmasyApi mUlaM kSamA / eSA kSamA mahAvidyA iva sarvANi duritAni harati nivArayati / etc. Ends.- fol. 22' kiM bahunA vistareNa? // itthaM zrImajjinazAsane / bahuna bhavyajIvAna prabodhya // zrIariSTanemirapi nAnAhe(de)seSu vihAraM cakre / tat pavaM jJAnvA | yathA gajasuka(ku)mAlena sAdhunA kSamA kRtA / tathA anyerapi muktisuSe. cchubhiH sAdhubhiH kSamA kartavyA // yathA zivarAmA karatalagatA bhavet uttarottarANi suSAn labhadhvaM // // iti zrIkSamAguNaviSaye kRSNabAMdhavagajasuka(ku)mAlamahAmuneH kathA samAptA // vAcyamAnA ciraM // naMdatAt AcaMdrArka yAvat / / chH|| Reference.- This is the only Ms. noted in Jinaratnakosa ( Vol. I, ___D. 102 ). There the title is given as 'gajasukumAlamahAmunikathA'. 15 gajasukumAlarAsa Gajasukuma larasa 676. No. 178 1892-95. Size.-- 97_in. by 41 in. Extent.- 6 folios; II lines to a page ; 32 letters to a line. Description.- Country paper thick, rough and white ; Jaina Deva nagari characters; big, quite legible, uniform and very good hand-writing ; borders ruled in two thick lines in red ink and edges in one ; space between the two lines coloured yellow; foll, numbered in the right-hand margin ; the central portions of the numbered and the unnumbered sides as well are decorated with various designs in red and yellow colours; especially the one on fol. 66 deserves to be specially mentioned in this connection ; the last three lines on fol. 6. and the two lines on fol. 6deg written in red ink; condition very good; completc ; composed latest in Samvat 1991. Age.- Samvat 1690. 30

Page #266
178.] The Svetambara Narratives 231 Author.- Pupil of Subhavardhana. Is he Sudharmaruci? If so, he is the author of ASADhabhUtimunirAsa and that of zAntinAtha stavana, too. Subject. -- Biography of Gajasukumala, the youngest brother of Vasudeva Krsna. Begins.-- fol. !' e60 // namaH zrIgautamAyaH desa 'soraTha' ' dvArA 'purI / nAma tihiM vAsudevU e| dasaya dasArasau raajo| bAMdhava zrIbaladeva e / 1 / jIre jIre svAmi samosaryA / hariSyau gopInau nAzU e / nomicaM(vaM)daNi ati aljyu| alajayau yAdava sAdhU(2) he // 2 etc. 10 Ends.- fol. 6. zrIzubhavarddhana gururAya / maiM praNamI tehanA pAya | gAyau gayasakumAla munIsa / zrIsaMghani hui AsIsa // 77 / jIvau gayasakumAla muNiMda / jasa tUbau nemi jiNaMda / jasu bhaNatAM hui ANaMda / anai nAmiha paramANaMda // 78 // zrIyagayasakumAla je gAi / te manavaMchiya phala thA(pA)i / anai dUrai durIyAM jAi / valI avicala saMpada thAi // 79 / iti zrIgayasekumAlarAsa saMpUrNaH // saMvat 1690varSe zrI'vRhatkhara(tara). gacche bhaTTArakayugapradhAnazrI 108zrImajjinarAjasUrisUrIzvarANAm tasidhyayuvarAjapadabhRtzrIzrIraMgavijayopAdhyAyagaNivarANAma tasiSyaMpaNDitaraMgavinayenAlekhi // suzrAvikApuNyaprabhAvikAzrIpaMcaparameSThimahAmaMtrasmArikA. samyaktvamUlasthUladvAdazavratadhArikA zubhAvikAnAnhIvahUpaThanArtham // zrIrastu kalyANamastuH // zubhaM bhUyAstAM leSikapATa(Tha)kayoH // zrI zrI: etc. Reference.--For extracts and additional Mss. see Jaina Gurjara Kavio ( Vol. I, pp. 408 and 409 & Vol. III, pt. I, p.567).

Page #267
232 Jaina Literature and Philosophy (179. girinArakalpa Girinarakalpa No. 179 641 (i). 1892-95. Extent.- fol. 31deg to fol. 316. Description. Complete ; 23 verses. For other details see Upadesa. malaprakarana ( Vol. XVIII, pt. 1, No. 225 ). Author.- Not known. Subject.- Description of mount Girinara in Saurastra. Begins.- fol. 31 zrI vimala girestIrthAdhipasya paramaM vadaMti tttvjnyaaH| zailamanAdiyugInaM / sa jayati 'girinAra girirAjaH // Ends. 316 zrInAradena likhitaM zrImatkAMcanabalAnakadvAre zrIbhAratIviracitaM zrInemeH saMstavaM tuSTayai / / 23 iti zrIgirinArakalpa 10 15 fotfartigia Girinaroddhara No 180 566. 1895-98. Size.- 9 in. by 44 in. Extent.-- 10-=9 folios ; 12 lines to a page ; 28 letters to a line. Description.- Country paper thin, rough and greyish; Jaina Devanagari characters; big, quite legible, uniform and good hand-writing ; borders ruled in two lines in black ink ; red chalk used; foll. numbered in the right-hand margin; condition tolerably good; for, a few foll. are slightly wormeaten; the 9th fol. missing; otherwise the work is complete ; the last verse numbered as 179; fol. 106 blank; composed at Dadhigrama ( Dehgam ). Age.- Old. 20 25

Page #268
180.] The Svetarbara Narratives 233 Author.- Nayasundara, devotee of Bhanumeru Gani. His additional works are as under: (a ) Narratives (1) naladamayaMtIcaritra v. S. 1665 (2) prabhAvatIrAsa V. S. 1640 (3) yazodharanRpacopada V. S. 1618 (4) rUpacaMdakuMvararAsa V. S. 1637 (5) zatrubhayamaMDaNatIrthoddhArarAsa V. S. 1638 (6) zIlazikSArAsa V. S. 1669 (7) surasundarIrAsa V. S. 1646 (b) Hymns (1) zaMkhezvarapArzvanAthastavana ? (2) zAntinAthastavana ? (c) Miscellany (1) Atmapratibodha Subject.-- A poem in Gujarati pertaining to mount Girinara _____in Saurastra. Begins.- fol. !" 5 6 // vastu sayala vAsava sayala vAsava vasi payamUli / namu niraMtara bhAktibhara saMtikaraNa cuvIsa jiNavara / neminAha bAvIsa susIlarayANabhaMDAra suhakara / tasu payapaMki aNuMsarI e mahimA giri 'girinaar| sahi guru Ayasa sari lahI bolisa kiMpi vicAra // 1 // etc. Ends. - fol. 98 bhIdhanaratnamariMda guNAdhipa / 'vaDatapagacchazrRMgAra | amararatnasUripATha(Ta)prabhAkara | zrIdevaratna guNaghAra re / jaga 76 vibughasaromaNi bhAnumeragaNi sIsa dharI ANaMda / zrI dadhigrAma' mAhi duSabhaMjana / vInavir3a nemi jiNaMda re / / jaMga / / 77 // karu krIpA nayasuMdara Upari / diu prabhu zavirasAtha / hoyo saMgha pratiI zubhadAyaka / suprasana neminAtha re / jg| 78 / 30 [J. I. P.1 30

Page #269
234 Jaina Literature and Philosophy [180. klsh|| iMma 'revatA'cala yAtrAnAM phala kiMpI tasu mahimA bhaNio / bAbIsamu balavaMta svAmI nemi nAyaka saMthuNio / zrIbhAnumerugu()NaMdasevaka kahi nayasuMdara sadA / suvisAla devadayAla avicala Api suSa maMgala mudA // 179 // iti zrIgirinAriuddhAra samApta Reference. --- Only this Ms. is noted in Jinaratnakosa ( Vol. I, p. 105 ). For extracts and additional Mss. see Jaina Gurjara Kavio ( Vol. III, pt. 1, pp. 753-754 ). 10 gIta Gita 1670 (b). No. 181 1891-95. Extent.-- fol. 8a to fol. 86. Description.- Complete. For other details see sudarzanazreSThirAsa No 1670 (a ). 15 20 1891-95. Author.- Deupala. Is he Depala (Depo), a Bhojaka and a protege of Samara and Saranga ? If so, he is the author of the following additional works : (a) Rasa [4] 1 abhayakumAra-zreNika-rAsa c. V. S. 1526 2 jAvaDa-bhAvaDa-rAsa 3 'jIrAulA'pArzvanAtha-rAsa 4 rohiNIyAcora-rAsa (b) Copai [5] / caMdanavAlAcaupai 2 jambUsvAmIpaMcamabhavarNanacopaDa V. S. IF22 3 puNyapApaphala-strIvarNana-copada ? 4 samyaktvavAravratakulakacopar3aV. S. 1534 5 pavasvAmIcopaDa

Page #270
181. J 1 ArdrakumAradhavala 2 ArdrakumArasUDa 3 sthUlabhadrakakkAvalI 4 snAtrapUjA 5 hariyALI' The Svetumbara Narratives ( c ) Miscellanea [s] Begins. - fol. 8 // ja0 // V. S. ? ? ? ? ? 29 " "" " Subject. - A song in Gujarati. Malhara raga and Navakara ( Namaskaramantra ) are here mentioned. 235 yojana lagi prAsAda sAMbhata (? la ) i / tara ati Alasa karai e / arathalobhiA danahara maja lAgi / Arati bAdhau phirai e / kaTare saMsArA vinavallu mAyA dIsati viva (vi)dha viTaMbA // 1 pAmi puna pramAda dharai jIvakAraNi kUDa kuTaMbA | kaTare saMsArA via0 // 2 eka bahuM upavAsapAraNai / pAchai sArIru phirai e / kuTuMba virodhi rAjagraha doSi / bahU ai laMghaNa karai e / kaTare saMsA0 // 3 guruvyayaNa siddhAMtu saMbhalai / tau UghevA lAgai / freeree vinoda vibhrama lagai / cyAri pahara nisi jAgai kaTare saMsArA // 4 paMcapramiti navakAra sAra e / teha UpAre no lasai e / kAmaNa mohaNa vasIkaraNa je / Upara ku ( jha ) lasa e / kaTare saMsArA0 // 5 aMbara na jANauM puNa morau jIva / paravasi parajana gaNai e / mana sudhi rahI mugatiphala mAgauM || deupAlu kavi bhai e // kaTare0 // 6 iti gIta 'malhAra' rAga // 6 // 6 // 1 See Jaina Gurjara Kavio ( Vol. I, p. 37 & Vol. III, pt. 1, pp. 446-452 and_Vol. III, pt. 2, p. 1487 ). In Vol. I, p. 38 sthUlibhadraphAga is mentioned but this entry seems to be erroneous. 5 10 15 20 25 30

Page #271
10 15 20 25 236 30 guNakaraNDaka-guNAvalI - rAsa No. 182 * Description.- Country paper somewhat thick, tough and white; Jaina Devanagari characters; small, quite legible, uniform and very good hand-writing; borders ruled in two lines and edges in one in red ink; red chalk profusely used; foll. numbered in both the margins; in the left-hand margin the title is written as guNAvalIrAsa; yellow pigment used while making corrections; condition very good; complete ; composed in Samvat 17 14. Age. - Samvat 1787. Jaina Literature and Philosophy Gunakarandaka-Gunavali-rasa Sizc.--- 93 in. by 44 in. Extent. 17 folios ; rs lines to a page ; 40 letters to a line. Ends. fol. 17b [ 182. Author. Gajakusala, pupil of Darsanakusala. Subject. A narrative pertaining to Gunakarandaka and Gunavali in Gujarati in verse. Begins. - fol. ra e60 // dUhA // sakala manoratha pUravaI / zrI' saMbesara 'pAsa 1600. 1891-95. paratA pUraNa praNamIhaM / saphala manoratha Asa // 1 // sarasatI[ti] bhagavatI bhAratI / suSadAtA zrutadeva | 'kAsamIra' suSamaMDaNI / caraNa namuM nitameva // 2 // etc. guNAvalInI parisaMpadA / pAMyeM baMchita teha // 6 // etc. saMvata satara caudottarA (1714) baraseM / kAti mAsa varSAMNa re / zubha dazamI zubha dina guruvAreM / rAsa baDhyo parimANa re / 8 me0 zrI 'tapa' gacchati tena (ja) virAjo (je) dina dina adhika divArje re / zrI vijyprbhsuurivrraajeN| rAma (sa) kIyo hitakAri re / 9 me0 gaccha paMDita mAdi (? hi) pradhAMnA vinayakusala buMdha trAM (jA) gare / bAdigaMjaNa kesarI samavaddhi / sahu ko kareM baSANa re / me 10 / darasaNakusala paMDita manamohana | tAsa sisa guNarAgiM jI // upasamadarIyo sakalaguNabharIo | sAdhu guNavayarAgI re / 11 me 0

Page #272
183.] The Svetambara Narratives 237 tAsa sIsa kaheM raMge(?) / jo lageM 'meru' giriMdare / ravi sasI gaganamaMDala e dii| pratapo e jayakArI re // 12 me. bhI saMSesara'pAsapasAI / dIna dina dolati thAI re| DhAla ugatrIsamI rAga 'dhanyAsI' / gajakusala guNa gAve re // 13 me0 caritra ane valI bhalI copaI / kAMdho rAsa meM joI re / bhadhiko Ucho je meM bhASyoM / michA dukkaDa soI re // 14 me0 / je naranArI raMgeM bhaNasaI / tasa ghari jayajayakAra re / riddha vRddha suSa saMpadA pAveM / putra kalatra parivAro re / 15 me // manavAMchita meM saMpadA pAMmI / stavanAM eha muNaMdA re / gajakuzala paMDita kaheM mujane / nita nita suSa a(A)NaMdA re // 16 / / 10 meM sAdhu taNA guNa gAya // iti zrIguNakaraMDakaguNAvalirAsa saMpUrNam // DhAla 29 che / saMdhyAi sarvagAthA 5016 cha // saMvata 1787 varSe Asu badi 13 dine buddhavAsare / sakalapaMDitaziromaNipaMDitazrI5zrIdAnacaMdragaNiziSyapaM0dIpa caMdragaNipaMdolatacaMdragaNivAcanArtha zrI Reference.- For extracts and additional Mss. see Jaina Gurjara Kavio (Vol. II, p. 153 & Vol. III, pt. 2, p. 1202). - 20 guNakaraNDaka-guNAvalI-rAsa Gunakarandaka-Gunavali-rasa [guNAvalIcatuSpadI] [ Gunavalicatuspadi ] (guNAvalIcopAi) (Gunavalicopai) No. 183 279. 1871-72. Size.- 9 in. by s in. Extent.- 26 folios ; 14 lines to a page ; 30 letters to a line. Description.- Country raper somewhat thick, rough, tough and white ; Jaina Devanagari characters; big, quite legible, uniform and very good hand-writing ; borders ruled in three lines and edges in one in red ink ; red chalk profusely used ; foll. numbered in the right-hand margin ; fol. !' blank ; condition very good ; complete. 25 30

Page #273
238 Jaina Literature and Philosophy [183. Age.- Samvat 1890. Begins.-- fol. 10 // 560 / zrI jirAvala pArzvanAthAya namaH // 5 sakala manoratha purave etc. as in No. 182. Ends.- fol. 260 saMvata sattara caudotarA (1714) barame etc. up to nita nita suSa ANaMdA re me* as in No. 182. This is followed by the lines as under : 13 iti guNAvalIcopai / saM 1890 mA 5 paMdevavijayalapItaM : ___'rAnera'grAme AdInAthaprasAdAt : saM. 1890 mAha suda 5 zrI zrI ___N. B.-- For further particulars see No. 182. 10 20 guNakaraNDaka-guNAvalI-rAsa Gunakarandaka-Gunavali-rasa 567. No. 184 1895-98, Size.- 10 in. by 5 in. Extent.- 12 folios ; 19 lines to a page ; 42 letters to a line, __Description.-- Country paper thick, rough and white; Jaina Deva nagari characters; small, quite legible, uniform and very good hand-writing ; borders ruled in three lines in red ink ; red chalk profusely used; foll. numbered in both the margins ; edges of some of the foll. slightly worn out; condition on the whole very good; complete ; composed in Samvat 1751 at Patan. Age.- Samvat 1866. Author:- Jinaharsa, pupil of Santiharsa. For a list of his works see pp. 193-193. Subject.- A life-sketch of Gunakarandaka and Gunavali. Begins.-- fol. ! // 60 / dUhA / zrIarIhaMta anaMta guNa se sUra nara iMda pAyakamala jasa praNamatAM lahIyeM paramANaMda 1

Page #274
185.] The Svetambara Narratives 239 covIse jIna jagataguru jagajIvani jinacaMda jaganAyaka dAyaka sakala zevakane sUSakaMda 2 etc. budhe nArI guNAvalI caDyA bolapramANa / pyAre prItamanA kayAM mukyo nahI nIja mANa 7 tAsa kathA kahesUM sarasa / dharajyo kra(hodaya mujAra vikathA ugha tajI karI sAMbhalajyo naranAra 8 etc. Ends.-fol. 160 zasI bAMNa [na] bhojana (1751) saMvachare bada bIja Aso mAsa DAla satyAvise racyo 'pATaNa mAMho(he ) ruDo e rAsa 16 gu0|| zrIgaccha 'SaDatara guNanilo gaccharAja guMNanilo jiNaM(?Naca)dasarI 10 jasa nAmathI nava nidha mile pratapo guru ho pragaTyo sasI sara 17 gu0|| zrImAMsAgara syobhatAM vAcaka sAtiharSa muNaMda tasa sisa kahe guNAvalI jinaharSa name ho dina dina ANaMda 18 gu0|| iti zrIguNakaraMDa ne guNAvalIno rAsa saMpurNa saMvata 1855nA barSe pujyajImahiSizrIpalakSmIcaMdajI taziSya RpujyajIR / rAmacaMdranI / tatazISya RlAlacaMdaliSitaM 'mAMDavIbidare' / zrIsubhaM bhavatu kilyANamastuH // Reference. - For extracts and additional Mss. see Jaina Gurjara Kavio ( Vol. II, pp. 103-105 & Vol. III, pt. 2, pp. 11651166). guNaratnasArakumArarAsa Gunaratnasarakumararasa 20 1479. No. 185 1887-91. Size.- 10 in. by 4g in. Extent. - Is folios ; 14 lines to a page; 30 letters to a line. Description.- Country paper thick, tough and white ; Jaina Deva-os nagari characters; big, quite legible, uniform and tolerably good hand-writing; borders in differently ruled in three lines in black ink ; red chalk profusely used ; foll. numbered in the right-hand margin ; condition very good ; yellow pigment used while making corrections; complete; 20 composed in Samvat 1586. 1 This title is given by a scribe. The correct one is: ratnasArakumArarAsa.

Page #275
240 Jaina Literature and Philosophy [185. 5 IS Age:- Not modern. Author.- Vacaka Sahajasundara, pupil of Upadhyaya Ratna___samudra of Upakesa gaccha. His additional works are : (a) Rasa [4] (1) AtmarAjarAsa v. S. 1582 (? 1588) (2) RSidattArAsa V.S. 1572 (3) jambUaMtaraMgarAta (4) paradesIrAjArAsa (b) Sajjhaya [4] ilAtIputrasajjhAya . V. S. 1570 (2) kAyAsajjhAya (3) (4) nindAsajjhAya (c) Miscellanea [2] (1) guNaratnAkarachaMda V. S. I572 (2) yauvanajarAsaMvAda Subject.-- A life-sketch of Ratnasarakumara in Gujarati in verse. Begins.- fol 11660 // vastu // sakala sArada sAradapAya praNAmeva // cauvise jinavara namI // sugurupAya praNAme mavasupara // ara[la]dha(tha) lahI sidhAMtano / pApatApa parihari sadara / / 'uvahA(e)sa' gacchi zrosIdhasurI guru pAya // praNami bahujatti / / rtnsaarkumrno| sAjalayo muha carittai / / 12 / / etc. Ends.- fol. Ifb lahisi lIlAballI tasa gharaNa || paraha putra kalaba parivAra re / / saMvata panara chAsai (1586)re // 10 // saMvaccharaha e racIu maha rAsa re|| vAcaka saihAi jasuMdara ima bolai // ANI cudhiprakAsa re // 11 // Then in a different hand we have: iti zrIguNaratnasArakumArano rAsa saMpUrNa || gaNibhInyAnavijaya tasiSyamANIkarativijayapaThanArtha / / / Reference.- For extracts and additional Mss. see Jaina Gurjara Kavio ( Vol. I, pp. 124-125). On p. 125 the date of this work No. 185 is given as 1582. 25 30 -

Page #276
186.] The Svetambaru Narratives 241 guNavarmakathA Gunavarmakatha 242. No. 186 1873-74. Size.- 97 in. by 41 in. Extent.- 60 folios; 13 lines to a page ; 40 letters to a line. Description.- Country paper somewhat thick, tough and white; Jaina Devanagari characters with occasional yarats ; sufficiently big, quite legible, uniform and very good handwriting ; borders ruled in four lines in black ink; foll. numbered in the right-hand margin ; fol. 30 wrongly numbered as 39; fol. ja blank; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; yellow and white pigments used; a portion of fol. 59 gone; edges of the last fol. worn out; condition on the whole good ; complete; composed in Samvat 15 1484 at Satyapura ; the entire work is divided into five sargas; the extent of each of them is as under :Sarga I foll, to 10 >> 109 , 196 >> III ryb 300 >> IV 312 419 , 412 .606. Age. - Pretty old. Author.- Manikyasundara Suri, pupil of Merutunga Suri of Ancala gaccha. He has composed the following additional 25 works 'three of which are mentioned in the colophon of this very work:(1) cap (2) TUIGJAT770177 V. S. 1484 (3) gezizasalia also called Vagvilasa (in Gujarati) V. S. 1478 30 (4) AETATH318taita (5) J*TI*911 (6) SUTERTE V. S. 1463 II 1 For their names gee p. 244, 31 (J. L. P. 1

Page #277
242 Jaina Literature and Philosophy [186. Subject.- A life-sketch of Gunavarman in verse. It points out the importance of various kinds of worship of the Tirthankara. Begins.- fol. 10 560 u namo vItarAgAya vijayatAM jinavAkyasudhArasaH sakalapApaviSApanayakSamaH ajani yasya nirIkSya manojJatA zazadharAdhipa eva sudhAkaraH 1 karotu vRddhiM prabhupArzvadevaH sNklpitaatiitphlprdaataa| kalpadrumo yuktamanena sAmyaM na sAsahe pallavadhunanena 2 vIro jinaH satyapurAvatAraH ___ sArazriyaM yacchatu vAMcchitAM vaH yo barddhamAnAM kamalAM vidhAya pitugRhe (s)bhUd bhuvi varddhamAnaH 3 zrI aMcala' gacchezAH zrImaMto merutuMgasUrIzAH vijayaMtAM yadvANyA sitAjitAsaM[malI]yutA payasA 4 After three more verses we have : guruprasAdAnmANikyasuMdaraH sUriralpadhIH pUjAdhikAre vakSyAmi guNavarmakathAmahaM pUrva rAjagRhe' vIraH zreNikAye jagau yathA tathA kathA(s)sau vijJeyA pUjAphalanidarzane 8 etc. --fol. Ioa iti zrI aMcala gacchezazrImANikyasuMdarasUriviracite pUjAdhikAre guNabarmacaritre priyAcatuSkaprAptivarNano nAma prathamaH sv(s)rgH| cha -fol. 19deg iti etc. up to guNavarmacaritre followed by prA(pA)vilepanavastrayugalAropavAsapUjAphalavaNa(no) nAma[:] dvitIyaH sArga: / -fol. 30deg iti etc. up to guNavarmacaritre followed by puSpa mAlAvarNakatUNoropapUjanaphalavarNano nAma tRtIyaH (sargaH // 5 // -iol.41' zrI aMcalaM gacche etc. up to guNavarmacaritre followed by mahAyajAmaraNAropapuSpagrahapuSpaprakarapUjAphalavarNano nAma caturtha sargaH / 5 // 20 25 30

Page #278
187.] Ends.- fol. 60' The Svetambara Narratives guNavarmA guruyogyaM guNAtbItaM nije pade zikSa saMsthApayAmAsa zAsanasya pravarttakaM 99 te sarve svAyupUrva gRhItAnazanAstataH zubhadhyAnaparA mRtvA 'brahmalokaM' divaM yayuH / 600 / vi(ciraM sukhAnyasI tu (bhuM ) kyA devalokAstatayutAH samutpadya 'videheSu siddhiM prApsati siddhidA 1 zrutvA (S) kSatAna vidhipramukha prakAzana paMcA (S) tatphalavilAsavicArasArAt / tAnAditastu na tu saptadazApi puNyA mANikya suMdararuci bhavikA! bhajadhvaM 2 iti zrI 'aMcala' gacchezazrI mANikya suMdarasUriviracite pUjAdhikAre guNavarmmacaritre sAkSatASTamAMgalika dhUpagItavAdyanATya pUjAphalavarNanoH nAma paMcamaH sargaH / 6 zrI evaM snAna vilepanAMzuka yugAdhyAropavAsAcenIpuSpasragvaravarNapticayAlaMkArapuSpAlayAH satpuSpaprakA (ka) rA'kSatArcatamatho dhUpaM ca gItato vAyaMtAdyamatho jayaMtu jagatAM nAthasya pUjA imA 1 // zrI / cha // : // 243 Reference. Published at Ahmedabad in A. D. 1901. For additional Mss. see Jinaratnakosa ( Vol. I, p. 105 ). Gunavarmakatha 401. 1879-80. 5 IO guNadharmakathA No. 187 Size. 11 in. by 4 in. Extent. -- 36 folios; rs lines to a page; 58 letters to a line. Description.- Country paper thin, tough and greyish; Jaina Devanagari characters with frequent gas; small, quite legible, uniform and very good hand-writing ; borders ruled in two pairs of lines in black ink; red chalk used; foll. numbered in the right-hand margin; fol. 1" 30 IS 20 25

Page #279
10 IS 20 25 30 244 Jaina Literature and Philosophy [ 187. blank ; so is the fol. 360; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; edges of the first and last few foll. slightly gone; condition on the whole good; complete; the entire work is divided into five sargas as under :-- foll. Sarga I II 33 KHn "" Age.- Samvat 1486. Begins. fol. 1 // 60 // III IV V Ends.- fol. 35a "" 33 39 "" T! 6a 12a 19a 252 to 6a 122 19" 25a 36a "" " 31 " vijayatAM jinavAkya sudhArasaH etc. as in No. 186. gurugyaM etc. up to mANikyasuMdararuci bhavikA! bhajadhvaM // This is followed by the lines as under : 600 iti zrI'aMcala' gacche zrI mANikya suMdarasUrivicite pUjAdhikAre guNavacaritre sAkSatASTa mAMgalika dhUpa gItaM (ta) vAdyapUjA phalavarNano nAma paMcamaH sargaH // 6 // cha // zrI // evaM etc. up to nAthasya pUjA imAH // 1 // practically as in No. 186. Then we have : AsAM kathA vyaracayat svagurUpadezAnamANikya suMdara gururjagatAM hitAya / tAvA vayaM tu munayaH paribhAvayaMtu tadvajjanAnavidhI upadezayaMtu // 2 caturazItyadhikeSu samA catu teSu || 1484 gateSu ca vikramAt / ayamabhUjjinapUjana satkathA samudayaH sa karotviha maMgalaM // 3 zrIvarddhamAnajinabhavanabhUSite racite eSa 'satyapure' graMthaH zrImadupAdhyAyadharmanaMdana viziSTa sAMnidhyAt // 4 'mANikya' kaJcatuH parvI zukarAjakathA tathA / pRthvIcaMdra caritraM ca | graMthA ete ( ( ) sya bAMdhavAH // 5

Page #280
188.] The Svetambara Narratives 91-'a'Aci arac aradaffarsit | vAcyamAno janaistAvad | graMtho (S) yaM bhuvi naMdatAta // maMgalaM sarvasaMghAya / kartre bhavatu maMgalaM / vyAkhyAyakebhyo mAMgalyaM / zrotre bhavatu maMgalaM // 7 // iti prazasti // cha // graMthAgraM // 1808 // cha // cha // zrI // saMvat 1486 AsauhRdi 10 vAra budha zrI aNahilapattane' zrIjinacaMdrasUrINAM pustakaM likhitaM 'kharatara 'gacche N. B. For further particulas see No. 186. - guNadharmakathA No. 188 Size. 10 in. by 4 in. Extent. 58 folios; 13 lines to a page; 42 letters to a line. Description. Country paper thin, tough and white; Jaina Devanagari characters with occasional gears; big, quite legible, uniform and very good hand-writing; borders ruled in two pairs of lines in black ink; red chalk used; foll, numbered in the right-hand margin; fol. 58b blank; several foll. more or less worm-eaten; the right-hand corner of fol. 7 gone; condition on the whole tolerably good; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; the first six foll. are missing; so this work begins abruptly; it however goes up to the end; this work is divided into five sargas; the extent of each of them is as under : Sarga I foll. 7b to II ga 22 "" 19 III IV V "" Age. Samvat 1618. "" "" "" "" 186 29a 39 dr r dr r 18b 29a 392 245 58 Gunavarmakatha 1302. 1887-91. 5 10 15 20 25 339 30

Page #281
S 10 IS 20 25 20 246 Begins (abruptly)-- fol. 1a Jaina Literature and Philosophy Ends.- fol. 57b ....... maMDape akasmAnnAtha ! te mUrcchA cetanA cAbhavat kathaM ? // 66 kutazvatyAni kAvyAni kuto rItiriyaM matA (?) | sarvametat prabho ! brUhi kautukaM mama varttate / / 6 etc. ari etc. up to mANikya suMdararuciM bhavikA ! majadhvaM 601 practically as in No. 186. This is followed by the lines as under : [189. iti zrI 'aMcala' gacche mANikyasuMdarasUriviracite pUjAdhikAre guNavarmmacaritre sAkSatASTamAMgalika dhUpagI0pUjAphalavarNano nAmaH paMcamaH sargaH // evaM etc. up to nAthasya pUjA imAH // 1 as in No. 186. Then we have :-- AsAM kathA etc. up to zrotre bhavatu maMgalaM // 7 as in No. 187. This is followed by the lines as under :-- iti prazasti // saMvata 1618 varSe mAhavadi 10 gurau // zrI 'aMcala'gacche vA kamalazekharagaNipustikA likhApitaM // N. B. - For additional information see No. 186. guruguNaratnAkara kAvya No. 189 Gurugunaratnakarakavya 1365 1887-91. Size.-- 10++ in. by 44 in. Extent.-- 22 folios; 13 lines to a page; so letters to a line. Description.-- Ccuntry paper thick, tough and white; Jaina Devanagari characters with frequent garais; big, perfectly legible, uniform and beautiful hand-writing; borders ruled in two pairs of lines in black ink; foll, numbered in the right-hand margin; fol. 1' blank except that the title etc. written on it; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; condition very good except that the last fol. is slightly worm

Page #282
189.] The Svetambara Narratives 247 IV 10 eaten ; fol. 22b practically blank ; for, only the title is written on it; complete; composed in V. S. 1541; this work is divided into four sargas ; their extents are as under :Sarga I fol. b to fol. , II , II , III II , Isb 21. Age.- Not modern. Author.- Somacaritra Gani, pupil of Caritrahamsa. Subject. - A Sanskrit poem dealing with the life of Laksmisagara Suri, the teacher (guru ) of this poet. For a Gujarati summary of this poem see "Short History of Jaina Literature" ( Pp. 496-502). Begins.- fol. 1 // 50 // zrIpArzvanAthAya namaH / / zreya zrIdharmabIjaM vimalamativRhad bhArata kSetradhAjyAM __ yenoptaM yad yugAdau tadanu nijalasahno(go)rasaiH siktametat / prauDhiM va prApi ta(j )jJaiH sukRtiguruguNaiH svAbhito(5)dyApi dadyAdAdhivyAdhivyipAya paramasukhaphalaM nAbhisUH stAt sa siddhayai // 1 // etc. -fol. 20 bhIjainezvaradharmanirjarataruH kAle klaavpyso| yadvAksaudharasena nityamadhunA saMsijyamAnaH satAM // yAMcchAyogyaphalAni yacchati 'tapAgacchAdhipAH zrIyutA / lakSamIsAgarasUrayazciramime me saMtu saMtuSTaye / 10 / zrIlakSmIsAgaragurubhAgyAdiguNAlibaNNamavareNyaM / navyaM karomi kAvyaM / guruguNaratnAkaraM nAma / 11 etc, - fol. 7' iti paramaguruzrIlakSamAsAgarasUrIzvarANAmutpattarArabhya bhaTTArakapadaprAptisamayaM yAva / shrii| gotamAdigaNadharaparaMparAvarNanaga guruga(guNaratnAkaranAmni kAvye prathamaH sargaH // 7 // - fol. 11' iti zrIparamagurulakSmIsAgarasUrINAM gacchanAyakapadavIprAptigacchamelagacchaparidhApanikAdividhAnagambho gurugaNaratnAkaranAmni kAvye dvitIyaH sargaH // cha / 20 30

Page #283
248 Jaina Literature and Philosophy [189. -fol. 15 iti paramaguruzrIlakSmIsAgarasUrividhIyamAnazrIjinArthA'nUcAnAdipadasthApanAvasara / proDhopAsakapraNItotsavaparaMparAvarNanaga guruguNaratnA karanAmni kAvye tRtIya(:) sargaH // cha / / Ends.-- fol. 214 evaM puNyAni nityaM jagati vidadhataH sadvivekasya meghaa| jIbAkaNrNAyabhISTa svajanaparivRtasyA'dhunA ratnasAdhoH // devANoddIpakasyA'prati[pa]hatavacaso dAnazDAgravRtte / ___kIrtirdetroSu sarveSvapi vizadatarA sarvataH posphurIti // 38 // zrIman mAlava' mediniiNduvdnaalNkaarhaarprbhoH| ___ rugrAmAgaravAsikarmatanayaH zrIratnasaMgharatnaprabhoH // AkSepAda(da) vidhuvedavarmavasudhAvarSe 1541 subhikSodbhave / lakSmIsAgarasUrirAjavilasadbhAgyaprakarSastave // 39 // zrIjaMbUsamasomasuMdaraguroH shriisomdevaadvyH| ziSya mUrivarazca ziSyavRSabhazcAritrahaMso'sya yaH / / tasya zrIvivudhasya ziSyazizunA kAvye mudA nirmite / sargazcAtra caturthako gurugaNAdU rtnaakraakhyaayuto| 40 / yugmaM / / iti zrIparamagurulakSmIsAgaramaribhAgyAdiguNavarNanagarbhe guruguNaratnAkaranAmni kAvye saMratnAmeghAsaM0jesigakRtayAtrAvistaramahazcaturthaH sarga // guru / / ch|| yasmina deze vihAraM [vidadhati yati]yatipA ye caturmAsakaM thaa| ___tasmin deze subhikSaM bhavati nanu kadApItisaMbhUtibhItiH yeSA mAhAtmyamIna vidhimiha vibudhaijJAtamAste nRpAghaiH / zrIlakSmIsAgarAkhyA gaNadharaguravaH saMtu baste zivAya // 1 yat kaH prAMvatpratApaH savituratizayI bhuurbhuvHsvprkaashii| yeSAmAste yazo(s)pi jJapiturabhinavaM taamsdhvNsy'dossH|| muktyA paMkyA yadIyA guNatatiradhikAcchidramuktA(s)pi tanyAt / yat puMsAM kaMThakAMti tadiha guru(ravaH kena tulyAH syurete ? // 2 haMho gacchata mA vidUraviSayAnavajJAkara vArNavaM / / dhAturvAdavidhau mrame patata mA durmavayatrAdike //

Page #284
190. ] The Svetambara Narratives bhUmyarthe bhAvikA! bhajadhA ( dhva ) manibhAnetAn yathArthAbhidhAn / lakSmIsAgara gacchanAyakavarAn sarvArthasiddhipradAn // 3 'meru' ratnAkararatnagarnA ( ) / vibhAvarI rAjavIva yAvat // bAjeti jaineMdramataM jane (S) smin / stAvatvaM naMdatu kAvyametat // 4 // zrI pUjyaprAjyabhAgyAbhyudayaguNamayaM somacAritrasAdhuH kAvyaM navyaM vyadhAtta svanayanaviSayaM prApaNIyaM prasannaiH / AcAryairvAcakairvA bahuvibudhavaraivI ( vIM ) tadoSaM vidheyaM / tadvad vidvajjanAnAmidamiha sadasi syAnmude vAcyamAnaM (5 // ) tathA / 249 Reference. Published in Yasovijaya Jaina Granthamala in Vira Samvat 2437. For additional Mss. see Jinaratnakosa ( Vol. I, p. 106 ). guruguNaratnAkara kAvya No. 190 zrI abhayanaM divibudhA Agama cAritra paMDitAzva yake | vijayaMte kaviretad viracitavAMstatprasattipadaM // 6 iti saMprati vijayamAna paramaguru zrI lakSmIsAgarasUri saubhAgyAdiguNavarNanagarbhe gurugaNaratnAkaranAmAbhirAmaM kAvyaM saMpUrNa || pUjya bhaTTArakabhI - 15 somasuMdarasUriziSyazirovataMsa sakala sakarNapUjyArAdhyapaMcAritra haMsagaNipAdavineyaparamANunA somacAritragaNinA viracito graMthaH // cha // Gurugunaratnakarakavya Size.-- 10 in. by 43 in. Extent. - 12 folios; 21 lines to a page ; 52 letters to a line. Description. Country paper somewhat thick, tough and greyish; Jaina Devanagari characters with frequent gears; small, quite legible, uniform and beautiful hand-writing ; borders ruled in two pairs of lines in black ink; space between the pairs coloured red; red chalk profusely used; foll. numbered in the right-hand margin; the unnumbered sides are decorated with a spot in red colour in the centre only; 32 [J. L. P.] 150. 1872-73. 5 TO 20 25 30

Page #285
250 Jaina Literature and Philosophy [190. the numbered, in each of the two margins, tco; edges of each and every fol, more or less gone ; so in some cases letters are gone ; condition tolerably fair ; complete ; yellow pigment used while making corrections. 5 Age. - Old. Begins.- fol. [* 160 // zrIpArzvanAthAya namaH / zreya zrIdharmabIja etc. as in No. 189. Ends.- fol. 12 ___ evaM puNyAni nityaM etc. up to ( somacAritra gaNinA viracito graMthaH #gouf: Il practically as in No. 189. This is followed by the line as under : likhitaH // cha / zrI // cha / zubhaM bhavatu leSakapATha N. B.- For additional information see No. 189. 6 Is godhanakathA Godhanakatha No. 191 1310 (31). 1886-92. Extert.- fol. 32%to fol. 33". Description.- Complete so far is it goes. For other details see ___No. 1310 ( 1 ). ___No. 1886-92.. Author.- Not mentioned. 20 Subject.- A story of Godhana pertaining to pride. Begins. - fol. 32 stathomAnena jIvoMtaHpraviSTeneva zaMkunA / rukhsyo dRssttsnmaargH| pateibhuktaM bhavATe // 1 mAnavI mAnaso mAna / mAnamAnayatIha yH| tasya na syAdavazyaM hi / dharmakarma sunirmalaM / / 2 etc. 5 Ends.- fol. 33* atha godhana Asmani deko rjitajAtismRtirAstiko(5)bhavat / samaye(5)nazanena sapriyaH sa vidyAdimakalpamAsadat / / 37 // mAne godhanakathA // cha / 30

Page #286
193.] The Svetambaru Narratives 25 gopakathA Gopakatha (govakahA) (Govakaha ) No. 192 1310 (19). 1886-92. Extent.- fol. 20deg to fol. 21'. Description.-- Complete. For other details see No. ' v. 1310 ( 1 ). - 1886-92. Author.- Not mentioned. Subject.-- A story of Ranasura in Prakrit in verse. The ending portion deals with a narrative of a gopa ( shepherd ) whosc desire was not fulfilled as he was lacking in merit (punya). Begins.- fol. 20deg aTumicauhasIpapu(mu)hapu(pa)vyadiNesu posaha jo kuNa(i) pAvaya(i) ubhayamavesu ! so raNasUra va kallANaM // 1 // etc. Ends.- fol. 20* paDiamasesaM duddhaM / dharaNIe tassa mubuddhisma(ssa) / punarahiANamevaM / maNorahA niSphalA huMti // 19 // manorathavaiphalye gopakathA / / 7 / / " gautamasvAmirAsa Gautamasva mirasa [ goyamagururAsa] [Goyamagururasa ] 20 641(1). No. 193 1882-95. Extent.--- fol. 34 to fol. 369. Description.-- Begins abruptly but goes up to the end. This rasa is composed in Samvat 1412. Its last verse is numbered . as 45. For other details see Vol. XVIII, pt. I, No. 225. *25 Author.- Upadhyaya Vinayaprabha, pupil of Jinakusala Suri. Subject.- A biography of Gautamasyamin alias Indrabhuti, the ist apostle ( ganadhara ) of Lord Mahavira in Gujarati in six sections known as ' bhasa'. 30 Begins ( abruptly ) --- fol. 34 ... goymgururaaso| maNu taNu vayaNe kaMta karavi nimuha NaM / bho bhavIyA !! jima ni3(va)saI tumha dehagehi guNa maNagahagahiyA // 1

Page #287
252 Jaina Literature and Philosophy [ 193. 10 End.- fol. 36a praNavakSaru pahilaM pabhaNIjahva(i) mAyAvIjaI siuM nisuNIjai / zrImati zobhA saMbhavae / devahaM dhuri arihaMtu namIjai / vinayappaha uvajjhAya ghu(dhu)NIjai / iNi maMtrihiM goyama nmo||43|| para paravasa paratA kAMi kIjai / deza dezAMtara kAMI bhamIjai / kavaNu kAja AyAsa karo / prahi UThI goyama samarIjai / kAja samaggU tatakSiNi sIjhai | nava nihi vilasai tAMha dhare / / 44 // caUdaha saya bArotara (1412) gharasihiM / goyamagaNaharakevaladisihi / / kIuM kavitu upagAraparo / Adihi maMgalu eha bhaNIjaha / paraba mahocchavi pahilaM dIjaha | RddhivRddhikalyANakaro // 45 // iti zrIgautamasvAmirAsaH // // zubhaM bhavatu // 7 // kalyANamastu / / zrIzramaNasaMgha // Reference.-- Published in " Jaina prabodha". Also published by " Jaina dharma prasaraka Sabha " in V. S. 1965 and by Jhaverchand Ramchand from Navasari in "navasmaraNani gautamarAsazca" on pp. 19-24deg in A. D. 1947. For extracts and additional Mss. see Jaina Gurjara Kavio ( Vol. I, pp. 15-16 & Vol. III, pt. I, pp. 416-417). For discussion of metres, grammatical forms and extracts the reader may refer to pp. 273-279 of "ApaNo kavimo (khaMDa 1, narasiMhayuganI pahelAM)". 15 gautamIyamahAkAvya Gautamiyamahakavya gautamIyaprakAza with Gautamiyaprakasa (vyAkhyA ) sahita (vyakhya) 569. No. 194 1895-98. Size. - 10 in. by 4 in. Extent. -- 103 folios; 15 lines to a page ; 48 letters to a line. Description.- Country paper very thin, rough and white ; Deva nagari characters; small, legible and fair hand-writing; borders unruled ; yellow pigment used ; several foll. have 30 their numbers entered twice as usual (vide foll. 17-19 etc. ); fol. I blank; condition very good; this Ms.

Page #288
194.] The Svetambara Narratives 253 contains the text as well as its commentary; both complete; the text composed in 11 cantos at Yodhapura in Samvat 1807 and its commentary in Samvat 1852. Age.- Samvat 1858. Author of the text.-- Rupacandra, pupil of Dayasimha of the 5 Kharatara gaccha (Ksemakirti sakha). He is the author of Gunamala prakarana ( V. S. 1817 ). of the com.- Ksamakalyana Gani alias Ramavijaya, pupil of Amstadharina Gani. For a list of his works see Vol. XVII, pt. s (p: 3 ) and Short History of Jaina Literature 10 pp. 676-677. I may here mention his following works :(1) guzatara gureIIG #TSDIENIA ( Gujarati) ? (2) atat 'englant V. S. 1830 (3) Tawar V. S. 1835 (4) GRATAT TITATS (5) T99TFTISTA* V. S. 851 (6) auraita V. S. 1839 (7) **1# (8) Aralara 157 ( Gujarati ) (1) samarAdityacarita V. S. 1873 20 ( 10 ) Ararat This Ksamakalyana has commented upon the following works : (1) 'stalatie, ( 2 ) '*#TT,( 3 )vara, ( 4 ) *auan, (5 ) 'fraiciet, (6) sa radom and (7) 25 bailarasi. Subject.- Life of Gautama, the first ganadhara of Lord Mahavira. Begins.-( text ) fol. 1b bhIrAvIrAsIdiva divyadIpti yasyAtmani jJAnamayI smgraa| IS 1 Its com, is dated as V. S. 1850. 2 Its com.is named as T ETE T . It is dated as V. S. 1854. 3 Its com, is dated as V. S. 1860. 4 Its com, is dated as V. S. 1869. 5 Its com, is dated as V. S. 1847. 6 This is his own work. Its com. is dated as V. S. 1847. 35

Page #289
254 Jaina Literature and Philosophy [194. tIrthapravRttyai sa va vIranAthaH prasthAtunai(mai)cchannagarImapApAm // 1 // etc. Begins.- ( com. ) fol. rb // // hI namaH zrIgavaDIpArzvanAthAya nmH| anaMtavijJAnamayaM vizuddhaM niruddharAgAdiparapracAram jinottamaM vIramaciMtyazaktiM nidhAya bhakttyA hRdayAjakoze 1 etc. praNampa ramyaM gurupAdapadmaM sarasvatIM cAbhinivezya citte / zrIgautamIyottamakAvyabaMdhe vitanyate(5)so dra(pra? )vara prakAzaH 3 // etc. - ( text ) fol. I020 bhavyAMbhoruhabodhane dinakarastriMzasamA bhUtale mohAjJAnatamobharaM vighaTayana yo dharmarAjyaM vyaghAt / yazvAhnAya ninAya jaMtunikara svargApargAlayaM sa zrIvIrajinezvaro bhavatu naH saMghasya ca zreyase // 4 // - (text) fol. 103" iti vAcanAcAryazrIdayAsiMhagaNiziSyakavirUpacaMdra viracite gautamIye mahAkAvye metAryaprabhAta(sa )dIkSAgrahaNavarNano nAmaikAdazaH srgH| - ( com.) fol. 1033 iti spaSTam / ( text ) fol. I03 tatsamAptau ca samApto(s)yaM granthaH / / - (com.) fol. I03" iti vAcanAcAryazrImadamRtadharmagaNivineyavAcanA cAryakSamAkalyANagaNinirmitAyAM gautamIyamahAkAvyavyAkhyAyAM gautamIyaprakAzAkhyAyAmekAdazaH srgH| tatsamAptau ca samApteyaM vyAkhyeti shreyH| atha yatsaMvatsarAdau yasmin pure yadrAjye cedaM kAvyaM yAdRzena va(ca) satA kavinA nirmitaM tat sarva svayameva granthakadAha // Ends.-- ( text ) fol. 1036 saMvacchailabiyadgajodu(Du)pa(1807 )mite mAghe(se) 'sahasyAdime / pakSe 'dakSasutAdhinAthadivase zuddha tRtIyAtithau / zrImadayodhapure' kamadhvajaravau zrIrAmasiMhe nRpe| zrImacchajinalAbhasUriMgaNabhadrAjye punardhAmmike // 1 // 1 mArgazIrSastha. 2 candavAsare, 3 rAThoDa..

Page #290
194.] The Svetambara Narratives 255 vidyAcAraca(va)re gaNe 'kharatare' zrIkSemakIya'nvaye / saMjAtA bhuvi zAMtiharSagaNayaH zrIvAcakAkhyAbhRtaH / / tacchiSyA jinaharSanAmamunayo vairaMgikAgresarAstacchiSyAH mu(su)khavardhanA api dayAsiMvhA(hA)stadIyA stathA // 2 // 5 tacchiSyo(s)bhayasiMhanAmanRpaterlabdhapratiSTho mahA gaMbhIrAItazAstratattvarasiko'I rUpacaMdrAvha (va)yaH / prakhyAtAparanAmarAmavijayo gacchezadattAkhyayA kAvye'kAmidaM kavitvakalayA zrIgautamIye zramam // 3 // doSAH zabdasamudbhavAH katipayAlaMkAradoSAH punaH / padye'veSu mama pramAdavazatazceta saMbhaveyuH kvacit / / gItArthAstu tathApi yuktikavitAkArye zramaM prekSya me| sAdho ! sAdhukRtaM tvayeti dadatAmutsAhamevepsitam // 4 // Ends.- (com. ) fol. I03deg etatpadyacatuSTayamapi spaSTArthamiti na vyAkhyAtam / / iti granthakRtakRtA prazastiH / svastyastu / bAhujJAnavamukSamA( 1852)pramitije varSe 'nabhasyu(ja)jvalai kAdazyAM vilasattithau kumudinInAthAnvitAyAmiha / zrImajjaizalameru'nAgni nagare zrImUlarAjezvare / ___ rAjyaM kurbati yAdavA'nvayarabau sannyAyamArgAzrite // 1 // zrIdevA(ryapadA)jasevanapaTuzrImatsudharmAnvaye / pUjyazrIjinacaMdrasUrimunipe gacchezatAM bibhrati / / zrImatpAThakarUpacaMdravacasAmarthaprakAze kSamA [kalpa] ramyA(s)sau paripUrNatAmabhajata vyAkhyAnamAkhyAnabhRt // 2 // prArabdhA nidhinetrasiddhivasubhU(1829)saMkhye susNvtsre| ___yA(ss)sI(t sadguNabhAji (rAja) nagare' zrI guja(ja)ratrAvanau // 25 pUjyazrIjinalAbhArisuguro saiddhAMtikAnuttare / sadbuddhyA samayocitena vidhinA gacchAvanaM kurvati // 3 // tribhirvizeSakam // zrImanto jinabhaktisAragurava'zcAMdre' kule jajJire ___sacchiSyA jinalAbhasArimunipAH zrIprItitaH saagraaH| 30 tacchiNyA guNarAjarAjitamahAprajJAH susaMvignakAH / zrImanto'mRtadharmavAcakavarA jAtA dhraassishrutaaH||4|| 1 bhAdrapade.

Page #291
256 Jaina Literature and Philosophy [194. tacchiSyo varadharmavAsitamatiH prAjJaH kSamApUrvakaH / kalyANaH kRtavAnimAM kRtijanasvAMtapramodAptaye // buddharmadatathA pramAdavazato vA kiMciduktaM mayA bAzuddhaM para(ri)zodhayaMtu saMdhiyo mithyA(s)stu me duSkRtam // (5 // ) iti zrIgautamIyaprakAzaH sadbhiH paThyamAnazciraM naMdatAt ||shraaH|| zrIH / // zrIsiddhavaktrAya namaH // ||shriiH // zrIsadgurubhyo namaH // ||shriiH / / // zrIvidyAgurumyo namaH // zrIH / / 'vasubANASTasiddhayabde bhAdrave kRssnnshle| SaSThItithI maMdavAre (jaitrabAre) lilkhaannNdvllbhH||1|| zAstramiti zeSaH // 'vIkAnera ityabhidhAne pure // caturmAseSu // zrIH / / // shriiH|| // shriiH|| // shriiH|| // zrIH / / Reference. The text is published in "Candrasimha Suri Jaina Granthamala". This text along with Ksamakalyana's com. is published in D. L. J. P. F. Series as No. 90 in A. D. 1940. For additional Mss, of the text and its commentary see Jinaratnakosa ( Vol. I, p. 112 ). To catuHpratyekabuddhacaritra Catuhpratyekabuddhacaritra [cAra pratyekabuddhanI DhAla] [Cara pratyekabuddhani dhala ] No. 195 790 (b). 1892-95. 20 Extent.- fol. 56 to fol. 7a. Description.- Complete. Composed at Patan. For other details ___see No. 790 (a). 25 1. 1892-95. Author.- Samayasundara. For his works etc. see Vol. XVII, pt.2, No, 520; Vol. XVII, pt. 4, No. 1356 & Vol. XIX, sec. I, pt. 2, Nos. 465& 490. Subject. A life-sketch of four praty ka-buddhas based upon Uttarajjhayana in Gujarati in verse in s dbalas. They are : (1) karakaNDa, (2) dvimukha (dummai ), ( 3 ) nami & ( 4 ) nagnajita (naggai ). 1 1358. .0

Page #292
196.] The Svetambara Narratives 257 Begins.- fol. 5 // 6 // 'caMpA' na(ya)rI atibhalI huM ghArI (da)dhIvAhana la(bhU)pAla re hUM vArI lAla padamAvatI kuSa upana hu kameM kIdhau caMDAlari huM0 etc. Ends. - fol. 7a utrAdhyeyanmai e kahyA sutra mAMhI he cyAre pratye)kavudha / sma(samaya)sudara kahasai sAdhanA guNa gAyahi 'pATaNA nagara prasiddha) 10 iti zrIcAra pratyekabudhanI DhAla 5 saMpUrNa // Reference.- Published in " samayasundara-kRti-kusumAMjali " on pp. 267-275. 20 caturgatibhavasvarUpavijJapti Caturgatibhavasvarupa vijnapti No. 196 825 (b). 1892-95. Extent.- fol. 24 to fol. 3". Description.- Complete. For other details see Caturdasasvapna vicara No. 197. Author.- A devotee of Amolaka. Is he Sukhasagara ? Subject.-- A Gujarati poem pointing out the nature of births in the four grades of existence. Begins.- fol. 2 // 6 // tribhuvanatAraNa deva | seva karai nita saragabhuvananA rAjIAi | jinavarapAya nAmavi sAsaNadevati sAmaNi mani dharU e // 1 // etc. Ends.- fol. 3 zrIjinazAsana mAhi / ratna amulika sUri pasAi pAmIi / amarita vaTaDau meha / nava pallava thaI dharama taNI savi velaDI e / surataru phalIu Aja / rAja karuM nitu sukhasAgara mAhe jhIlatAM e // 24 // iti caturgatibhavasvarUpAnatI saMpUrNaH / / 25 33 [J. L, P.]

Page #293
10 IS 20 25 258 Size.-93 in. by 4 in. Extent. 6 folios; 16 lines to a page; 42 letters to a line. 5 Description.- Country paper thin, tough and white; Jaina Devanagari characters; big, quite legible, uniform and good hand-writing; borders ruled in two pairs of lines in black ink; red chalk used; foll. numbered in the right-hand margin; in the case of the numbered and unnumbered sides as well, there is some space kept blank so that it forms a design; edges of one or two foll. slightly gone; condition on the whole very good; complete; it ends on fol. 2; this Ms. contains in addition the following works: 30 Jaina Literature and Philosophy caturdazasvapnavicAra No. 197 Age. Pretty old. Author. Caturdasasvapnavicara 825 (a). 1892-95. (1) agza No. 196 foll. 2a to 3* (2) paryuSaNAparvabhAsa (3) vastupAlatejapAla sa ( ) khimARSirAsa ( 2 ) balibhadragasa 22 [197. "" 3a 1, 4 4a 66. dr Lavanyasamaya. If he is pupil of Samayaratna he was born in V. S. 1521. His father's name is Sridhara and that of his mother Jhamakala, his own name being Laghuraja. He became a Jaina monk in V. S. 1529, a poet at the age of 16 and Pandita in V. His . S. 1555. works are mentioned in Jaina Gurjara Kavio (Vol. I, pp. 68-88). They can be classified as under : (a) Rasa [ 5 ] V. S. 1589 V. S. 1589 (3) yazobhadrasUrizasa V. S. 1589 V. S. 1568 ( 4 ) 'bimalarAsa = vimalaprabandha (5) surapriyakevalIrAsa V. S. 1567 1 Herein at the end the author has given some details about himself.

Page #294
197.] The Svetambara Narratives 359 V.S. 1554 V.S. 1543 v.S. 1562 V. S. 1562 (b ) Copai [3] (6) gautamapRcchAcopai (7) devarAja-vajcharAja-copai (8) siddhAntacopai = lukAvadanacapeTA (c) Vinatil 3] (9) AloyaNavinati (10) jIrAuli-pArzvanAtha-vinati (1) vairAgya-vinati (d) Sajjhaya [1] (12) AThamada-sajjhAya (13) Atmabodha- " (14) dAna- , (15) dRDhaprahArI- , (16) paMcatIrthI- , (17) paMcaviSaya- , (18) puNyaphala- " (19) manamAMkaDa- , (20) zrAvakavidhi-, (21) sAtabAra- " (22) hitaziA-, (e) Chanda [2] (23) aMtarikSa pArzvanAtha-chanda (24) gautama chanda (f) Stavana [2] (25) caturviMzatijinastavana (26) 'serisA'pArzvanAtha stavana (8) Samvada [ 2 ] (27) karasaMvAda (28) rAvaNa-mandodarI-saMvAda v. S. 1585 25 V.S. 1562 V.S. 1575 V. S. 1562

Page #295
S 15 20 25 260 30 V. S. 1553 10 Subject.- A Gujarati poem describing the 14 dreams that are seen by the mother of the Tirthankara. Begins. fol. 14 e6 // OM namaH // zrIsarvajJAya || Ends. nebha-rAjula - bAramAso ( 29 ) ( 30 ) neminAtha- hamacaDI ( 31 ) pArzvajinastavana prabhAtI ( 32 ) raMgaratnAkara - neminAtha- prabandha ( 33 ) rAjimatIgIta ( 34 ) vairAgyopadeza (35) sumatisAdhuri - vivAhalau ( 36 ) sthUlabhadra - ekavIso Jaina Literature and Philosophy ( h ) Miscellanea [ 8 ] fol. 2a Reference. deva tIthekaramA keraDI mAtaDIo bivahara samajha e / guNamaNi uraDI puDhIyA igoraDI || cauda supana siUM mana ramai e // troTaka | etc. [197. ? V. S. 1562 ? ? ? ? ? caturviMzaticatuSpadI ( copai ) jiNavara bhASIyA sahiyari dASIyA supana te UlaTiA paNai e / gAIyA vArUya mai matisArUa muni lAvaNyasamai ima maNai e // 16 // iti caturddazasvamavicAraH samAptaH // Cf. " cauda supananI sajhAya "of which the ending lines are given in Jaina Gurjara Kavio ( Vol. I, p. 87 ). Caturvirsaticatuspadi ( Copai ) No. 198 Extent. - fol. 49b to fol. 5ot. Description..-- Complete. For other details see Vol. XVII, pt. 3, No. 735. Author.-- Varasanga Is he Varasinga Rsi, pupil of Dama of Lonka gaccha? If so, he is the author of Navatattvacopai ( V. S. 1766 ). 1269 (54). 1887-91.

Page #296
261 199.] The Svetambara Narratives Subject.-- 24 couplets in Gujarati dealing with various topics. Begins. - fol. 490 ___ haragharaNI jau nigharI huI / gaurI kanhaligo hiNgi| bolai sudhi pUchaMtI bADa / hAm karatI bhAMjai hADa // 1 // Ends. - fol. 50 koThI dhotA kAdava thAi / hari hara vici iMma pADai rAo / nivaNa vArU nAradi koDaM / varasaMga bhaNai bhalaM thIu / / 24 iti cuci| 10 15 caturvizatijinacaturvidhasaGgha- CaturviinsatijinacaturvidhasanghasaGkhyAgIta sankhyagita No. 199 1604 (b). 1891-95. Extent.-- fol. 132. 8 1604 (a). Description.-- Complete. For other details see No. : * 1891-95. Author.- Not mentioned. Subject.- A small poem in Gujarati. It mentions the numbers of Jaina monks, nuns, Sravakas and Sravikas of the 24 Tirthankaras of the present avasarpini who flourished in Bharatavarsa ( India ). Begins & Ends.-fol. 13' caubIsa tIrthakaranau parivAra cabadai sai bAvana gnndhaar| lASa aTThAvIsa sahasa aDayAla e munivara baMdo triNi kAla // 1 // cyAri sai chaDottara sahasa chayAla lASa caumAlIsa guNaha visAla / bhagavati jiNazAsaNi kahI praha UThI nita vaMdana sahI // 2 // paMcAvana lASa e zrAvakasAra sahasa aThatAlIsa atihi udAra / vratadhArI e tAsU vicAra etalA zrAvika samakitadhAra // 3 // zrAvikA taNau paramAratha lahyo sahasa aDatrIsA pravacana kahyau / pAMca lASa nai eka ja koDi e zrAvikA namUM kara joDi // 4 // cauviha saMgha taNau e sAra mai kahyau gurunai AdhAra / teha taNA nita lIjai nAma kara jomI(DI) nu (hu~) karUM praNAma // 5 // iti caturvizatijinAnAM caturvidhasaMghasaMkhyAgItaM // 20 25 "

Page #297
262 Jaina Literature and Philosophy [200. caturvizatijinendra CaturvimsatijinendrasaGkSiptacarita sauksiptacarita No. 200 285 (b). A. 1882-83. Extent.-- fol. 200* to fol. 256'. Description.- Complete; fol. 201 repeated. For other details see Padmanandamahakavya No. 285 ( a ). Author.-- Amaracandra, pupil of Jinadatta Suri. His additional works are as under : (:) alaGkAraprabodha (2) ekAkSaranAmamAlA (3) kalAkalApa (4) kavizikSA = kAvyakalpalatAvRtti (5) kAvyakalpalatAparimala (6) kAvyakalpalatAmaJjarI (7) chandoratnAvalI (8) padmAnandamahAkAvya (9) bAlabhArata (10) muktAvalI (11) syAdizabdasamuccaya Over and above these works Amaracandra Suri has composed 4 verses at the end of each of the cantos of Sukrtasankirtana. Subject- Life-sketches of the 24 Tirthankaras ( Lord Rsabha up to Lord Mahavira) in Sanskrit in verse. Begins.-- fol. 200 zreyoballivanAMkurAH kujnnshrenniividhaane(s)rglaa| mohadrohaNamudgarAH zivasukhArohe mahArajjavaH / / aMhaHsaMhatijaitradharmavijayastaMmA zubha bhAvinAM / puSyAsavRSabhaprabhoH padanakhaprAptodayA razmayaH // 1 // etc. 20 25

Page #298
201.j Ends. fol. 256a Reference. o(A)naMdAsvAdasImA sujanajanadUdIbhAgya saubhAgya sImA vizvAlI locanAnAM paramazamasasyAdbhutaizvarya sImA || dharmasyollAsa sImA ziva sukha paTalI saMzrayopA[pa]yasImA zraddhAnAM zarma saMvarddhayatu jinavibhovarddhamAnasya mUrttiH // 1 // ityAcAryazrI jinadattasUriziSya paMDita zrImadamara caMdraviracitAni catuviMzatijineMdracaritAni samAptAni // cha // zraH // Edited by me along with Padmanandamahakavya as its Appendix I and published in the Gaekwad's Oriental Series as No. 58 in A. D. 1932. Its Gujarati translation is published by the Jaina Atmananda Sabha. candanabAlAcarita [ candanabAlAcatuSpadI ( candanabAlAcopai ) No. 201 The Svetambara Narratives - 263 Candanabalacarita [ Candanabalacatuspadi ] (Candanabalacopai ) 686, 1892-95. 5 Size. 10 in. by 48 in. Extent. 12 folios; 14 lines to a page; 40 letters to a line. Description. Country paper somewhat thick, tough and white; Jaina Devanagari characters; sufficiently big, fairly legible, 20 uniform and tolerably good hand-writing; borders mostly ruled in two pairs of lines in black ink; foll. numbered in the right-hand margin; fol. 1 blank; so is the fol. 5a but on that account there is no break in the continuity of the work; in the left-hand margin the title is written as 25 caMdanabAo and caMdana cupai 0; there is some space kept blank in the centre of the numbered and unnumbered sides as well; condition very good; complete; composed in Samvat 1676. Age. Not modern. Author. Vinayasamudra, pupil of Siddha Suri. Instead of pupil 10 IS 30

Page #299
_264 Jaina Literature and Philosophy [ 201. he may be his grand-pupil and pupil of Harsasamudra. If so, his additional works are :(1) aMbaDacopar3a V. S. 1999 (2) ArAmazobhAcopar3a , 1583 (3) citrasena padmAvatI-rAsa , 1604 (4) padmacaritra (5) mRgAvatIcopaha ,, 1602 (6) rohiNeyarAsa , 1605 Subject.-- A life-sketch of Candanabala, a princess and the fore10 most nun in the tirtha established by Lord Mahavira. ____Begins.- fol. 1 // 6 // // zrIvItarAgAya / cupii|| praNamuM vIra jiNetararAya / sayalasurAmuravaMditapAyi / vAgavANI gurutuM leuM nAma / karimuM dAna taNA guNagrAma // 1 // samosaraNi baiThA bhagavaMta / dAna sIla tapa bhAva kahati / cyAra bheda cihu vayaNi rasAla tihAM ghuri bhASi dAMna visAla // 2 // etc. - fol. 2b pAtra lahI prabhU prmaannNd| bhagatAvyA zrIvIra jiNaMda / dAna taNI sobhA vistarI / bolisa caMdanabAlAcarI // 10 // 20 Ends.- fol. 120 je jagi Apai dAMna supAtri nirmala karinai se nija gAtra / caMdabAla taNI pari karI tehanAM vistara hui ima carI // 69 // zrIsidhasUrisari guNabhUri va(?)iThA thAppA zrIkakasUri / tehanau aMtevAsI nAmi / vinayasamudra dAna abhirAma // 70 // saMvat 16 solAha chiDottarai (1676) // Aso mAsi carita ucarai / mUla carita valI ika joi karI | bihu milI te kIdhu vistarI // 71 // iti zrIcaMdanabAlAca upii| samAptaH // zubhaM bha(ba)tuM(tu) // lesskpaatthkyoH| kalyANaM astu / zrAvikAsahuvadesuttA(tA)zrAvikAdevakIpaThanArtha // punya prabhAvikApaTanArtha // liSataM munikRssnnaa| N. B.-. This work is mentioned in Jaina Gurjara Kavio ( Vol. 30 I, p. 168 ) but neither its extracts are there given nor its Ms. noted. ___25

Page #300
202.] The Svetambara Narratives 265 candana-malayAgiri-catuSpadI Candana-Malayagiri-catuspadi (candana-malayAgiri-copaDa) (Candana-Malayagiri- copai ) 687. No. 202 1892-95. Size.-- 109 in. by 4; in. Extent.-- 12 folios; 12 lines to a page; 33 letters to a line. Description.- Country paper thin, tough and greyish; Jaina Devanagari characters; big, quite legible, uniform and very good hand-writing; borders ruled in two lines and edges in one in red ink ; dandas and sometimes 10 some words here and there written in red ink; foll. numbered in the right-hand margin; edges of several foll. gone; condition on the whole tolerably good ; complete ; composed in 8 dhalas in all. Age.- Pretty old. Author.- Bhadrasena. Subject.- A life-sketch of Candana and Malayagiri in Gujarati in verse. Begins.- fol. ! // 6 // zrIvi(vI)tarAgAya nmH|| zrIjinagharacaraNe namI gAsu DhAla rasAla / caMdana-malayAgarI taNo / uttama kahaM upAya // 1 // svasti zrI vikramA'purI / praNamI zrIjagadIsa / tanamana jIvana suSakaraNa / puraNa mujha mata jagIsa // 2 // varadAika vara sarasvatI / masI(ti)visata(stA)raNa mAta / praNatuM mana dhari modasaM / haraNa bIghanasaMghAta // 3 // mama upagAri parama guru / guNa assydaataar| vaMda tAke pagajugala / bhadrasena munIrAya // 4 // kihAM caMdana kihAM mlyaagiirii| kihAM sAyara kihAM nIra? / kaheuM tAkI vAratA suNo sahu virataMta // 5 // etc. Ends.- fol. 120 saravaranI suSa bhogavI / 'mahAvI(vi)da(da)he' utAra / karaNI meM bala paamsii| avicala sIvapura ThAma / so049 / pu.|| dhana dhana ehavA munIvaru / dhana teno avatAra / so0| pra(ha) uThIne praNamIiM / nAmaha nava nidha hoya / so0| 50 pu0|| 34 II. L. P.] 30

Page #301
266 Jaina Literature and Philosophy [ 202. AThamI DAla purI thaI / saMjamano adhIkAra so0| dharama karo bhavi prANIyA ! / jima pAmyau suSa caMga / so0| 51 pu0|| iti bhIcaMdanamalIAgarIcopaI saMpUrNaH // samAptaM // Reference. For extracts and additional Mss. see Jaina Gurjara _Kavio (Vol. I, pp. 596-597& Vol. III, pt. , pp. I088-89). candradUtakAvya Candraditakavya 354. No.203 1884-87. Size.- Io in. by 4g in. Extent.- I folio; 9 lines to a page ; 39 letters to a line. 10 Description.- Country paper somewhat thick, rough, tough and white; Jaina Devanagari characters; big, quite legible, uniform and very good hand-writing ; borders ruled in two lines and edges in one in black ink; red chalk used; there is only one fol.; it is numbered in the left-hand margin, and, above this number the title of this work is written as Jaga; this fol. is slightly torn; condition on the whole tolerably good; complete%3; 12 verses in all; in this Ms. in the beginning there is a portion unconnected with this work; this consists of one verse in Prakrit and its Sanskrit rendering, and it deals with the nine brahmacaryaguptis. Age.- Not modern. Author.- Vinayaprabhu. Subject. -- A message sent to her husband by a love-lorn lady through the moon. Begins.- fol. !" (na )vavADibrahmacaryasya vivaraNaM / vasaIkahanisijidiyakuDiMtarapubakIliyapaNIe aimAhAravihasaNA nava (ba )bhayattIo // 1 // On this verse the chaya is written as Ti #9 afrar etc. - fol. !' e 6 0 // OM namaH siddhebhya(:) bilokya kAcid ramaNI nizAkaraM zuci babhASe rucirAMbujAnanA | 25

Page #302
204.] The Svetambara Narratives padAmi kiMcid bhavato(5)grato(5)dhunA vidho! samAkarNaya tanmadIritaM // 1 // vinirmitastvaM vidhinA nisA(zA)pate ! paropakArAya surottamo mudA / badAmyahaM tena tavAgrataH saSe(khe)! nijaM svarUpaM viraheNa pIDitA / / 2 // etc. Ends.- fol. 1 athAyamasyA vacanAni caMdramA nizamya tatrAzu jagAma shuddhdhii(:)|| nivedayAmAsa tathA tadagrato yathA tayA tatpurato niveditaM // 10 // nizApatervAkyasamUhamIdRsaM(zaM) nisa(za )mya gatvA nijamaMdire(5)dhvaga(:) sa satvaraM nirgatamanmathavyatha zvakAra keliM nijakAMtayA samaM // 11 // caMdradUtAdvayaM kAvyaM vinayaprabhuNA kRtaM / yaH paThet pANayAvAsaH sa bhavet saukhyabhAjana (12) iti zrIcaMdradUtakAvyaM samAptaH likhitaM kesarIsiMgha lepI // ni (?) Reference.- Only this Ms. is noted in Jinaratnakosa (Vol. I, p. 464). 20 25 candradhavala-dharmadatta-kathA Candradha vala-Dharmadatta-katha ['dharmadattakathAnaka] [ Dharmadattakathanaka ] 262. No. 204 A.1882-83. Size.-- 104 in. by 3 in. Extent.-- 16 folios; 9 lines to a page ; 40 letters to a line. Description.-- Country paper somewhat thick, rough and white; Jaina Devanagari characters; big, quite legible, uniform and very good hand-writing ; borders ruled in two pairs of lines in red ink; red chalk profusely used; foll. numbered in the right-hand margin; some in both the margins; there is some space kept blank in the centre of 30 1 This work is separately noted.

Page #303
10 15 20 25 30 [204. Jaina Literature and Philosophy the numbered and the unnumbered sides as well; this space is decorated with a square; a part of the first line and that of the last line written in red ink; edges of a few foll. slightly gone; condition on the whole good ; complete; composed in V. S. 1484; extent 338 slokas. Age. - Pretty old. 268 Author. - Manikyasundara, pupil of Merutunga Suri. For his additional works see p. 241. Subject.-A narrative of king Candradhavala and Sresthin Dharmadatta pertaining to 'samvibhaga ' vow. Begins.-- fol 1 e zrIvItarAgAya namaH // zrIsAradAya ( ye ) namaH // // atha catupavvIkathA proktAH poSadhavRttahetaveH / saMvibhAgavratasyAthaH / rucirA procyate kathAH // 1 // caMdradhavalabhUSasya [ : ] | dharmadattazyA zreSTinoH kathA jJeyAH // tathAhi // // iha ' bharata 'kSetre / 'kAzmIra 'dese / ' caMdrapuraM nAma nagaraM / tatra yasodhavalo nAma rAjAH / tasya yasomatI devI: / tatakuSyi ( kSi )samudbhUtaH / prabhUtaguMNanistazrcaMdra: / caMdradhavalo nAma kumAra: / sa sarveSu zAstreSu pArINoH / va (vi) se (ze ) pata zakunazAstreSu nipuNo babhUva / etc. Ends. fol. 160 vIradhavalena rAjA mahotsavena 'caMdrapuraM' pravizyaH / prajAya ca pAlayan pitrA (S) pi: / tatsvarUpaM / jJAtvAH / bahumAnitoH | rAjyazrIyamabhaMktasamaye zrIdattaM putraM rAjye sthApipatvA saMjamazrIyAM sidhisauSyaM suSeviH / zrImeratUMgarI ( ) draziSyo mANikya suMdara sUrinAM karotiH / smaH saMvibhAgavRte kathaMH // 1 // yAvanmera (ru) hI yAvad yAvacaMdra divAkaro (rau ) / vAcyamAnA janaistAvat kathAH || sau labhatAM praptaH // saMvibhAge vRtte caMdradhabaladharmmadattakathA samAptAM saMpUrNaH // graMthArtha 338 saMpUrNaH // zrIH // zrI' saMDera 'gacche pUjya mahoupAdhyA (ya) - zrI || jIvarAjalipataM // 1 Reference. Published on behalf of the Hamsavijayaji Free Library in A. D. 1924. For additional Mss. see Jinaratnakosa ( Vol. I, pp. 118 and 189 ).

Page #304
205.j argatezaila zar arka No. 205 Size. 10 in. by 43 in. Extent. 17 rw Subject. "" (text) 226 folios; 6 lines to a page; 36 to 38 letters to a line. (tabba),, a line. The Svetambara Narratives Al dr - Description. Country paper somewhat thick, tough and white; Jaina Devanagari characters; this Ms. contains the text and its interlinear stabukartha (tabba) as well; the former is written in big, quite legible, uniform and very good hand-writing; same is the case with the latter except that it is written in smaller hand-writing; borders and 15 edges, too, ruled in two lines in red ink; dandas written in red ink; foll. numbered in both the margins; fol. 1a blank; condition very good; this Ms. ends abruptly; so both the text and the tabba are incomplete. Age. Not modern. Author of the text. Not known as the work ends abruptly. 19 22 33 33 33 tabba.A narrative of Candra, a royal sage. Begins. - ( text ) fol. 1 // 60 // zrIvItarAgAya namaH // // ht dhyAtvA zrIjinAna natvA || vaMditvA zrIgurukramAt (n) / / zrIcaMdra rAjarAjasya || caritraM prathayAmyahaM // 1 // ger sfagarzer || fs16: dixi( s )goft 11 ekadA viharan nAtha || ' vaizAli 'nagarIvarAM // 2 // tatra zrI ceTako rAjJA // pramodAt parivArayuk // gaNabhU [ : ] calanAnaMtu // samAgAda ( d) gurubhaktimAha // 3 // etc. ; 12 19 dr 269 Candranarendra caritra with tabba 1145. 1891-95. wr dw 23 ; 42 32 "" (tabba ) fol. 1 | 0 || dhyAtvA zrImanmahAvIraM natvA zrIgurupaMkajaM faziPanaw tageru aeuaeg || ? || 33 33 "} 5 IO 20 25 30

Page #305
270 Jaina Literature and Philosophy [265. iMkAra siddhano dhyAna dharIne cauvIsa ti(tIrthakara prate huM namaskAra karIne zrIguruvAdikanA caraNakamala te prateM namIne etc. Ends.- (text ) fol. 226 zrI(vi)mirvizeSakaM // maMconmaMcamahAmace raMbhAstaMbhaiH satoraNe / / mauktikasvastikAdyaizca prodyakuMkumamastake / / 7 / / pupphaabhivitAnai ca vicitre paTamaMDapai // dhvajai gIte nRtai vAdyairanekaza vicitrataH // 8 // striNAM dhavalagAnaizca / sthAne sthAne [a]tisobhite. It ends thus abruptly. - ( tabba ) fol. 226deg phulanI mAlAnA samUheM karI vicitra prakAranA maMDapa mAMDave karI nAnA prakAranI dhvajA gIta nATika vAjItra aneka prakAranA thAte thake strIonA ghavalamaMgalagIta sthAne karI ThikANe ThikANe atyaMta somato thako. It ends thus abruptly. 10 candranarendracaritra Candranarendracaritra 15 [canda rAjAno rAsa ] [ Canda rajano rasa ] No. 206 1603. 1891-95. Size.-97 in. by 4} in. Extent.-- 93+1=94 folios; 13 lines to a page; 45 letters to a line. 20 Description.- Country paper thin, rough, tough and white; Jaina Devanagari characters; small, perfectly legible, uniform and beautiful hand-writing; borders ruled in two lines and edges in one in red ink; lines here and there and the dandas as well written in red ink; foll, numbered in both the margins 3; fol. I decorated with svastikas etc. in various colours; fol. 1 has all its four borders coloured yellow; same is the case with fol. 93deg and fol. 936; in the left-hand margin the title is written as caM0 ca0; condition very good; complete; composed in Samvat 30 1783 at Rajanagara in 108 dhalas ; the entire work is

Page #306
271 10 206.] Svetambara Narratives zA divided into four ullasas as under : Ullasa I foll. 1 to 171 , II , 17* ,, 350 , III , 33 , 64* , IV , 64 , 93. Fol. 16 contains the same matter as given on the next fol. also numbered as I Age.- Samvat 1914. Author.- Mohanavijaya, pupil of Rupavijaya Gani. His addi tional works are as under :(1) corAsI V. S. ? (2) narmadAsandarIrAsa V. S. 1764 (3) puNyapAla guNasundarI-rAsa V. S. 1763 (4) mAnatuMga-mAnavatI-rAsa V. S. 1760 (5) ratnapAlarAsa V. S. 1760 (6) harivAhananRparAsa V.S. 1755. Subject.- A life-sketch of King Canda (son of Virasena) in Gujarati in verse. Begins.- fol. 1 60 // zrIparamAtmane nmH|| dohaa|| prathama dharAdhipati prathama // tIrthakara Adeya // prathama jiNaMda diNaMdasama // namo namo nAbheya // 1 // amita kAMti adbhUta ziSA zirabhUSita socchAha // pragaTayo padma' draha thakI / 'siMdhu'salilapravAha // 2 // kSudhA sahI kevala lahI dI, prathama ja mAta // jananIvacchala ema jo // te jagi jAta sujAta // 3 // jA[va]sa vaMza avataMzasama // prabhutA yukti subhukti / / bilasI mukuranivAsasama // varI vadhU je mU(8)kti // 4 // laghu ba(dha )ya ichA(chA) ikSunI | pAraNadina piNa teha // miSTa iSTa prabhunai sadA // mITho maMgala eha / / 5 // gaNadhara dvAdaza aMganAM / dhAraka sUtra kaheba // jaMgama nANa taNA jaladhi // puMDarIka praNameva // 6 //

Page #307
to 5 IS 20 25 30 272 - - - Jaina Literature and Philosophy tUM varadA tUM sAradA // sacarAcara AbhAsa // kahAM sIlasaMbaMdhanUM // basi mujha mukhaAvAsa // 7 // cukaMdarIyo bharIyo guNe / tarIyo kiNa vIdha jAya // jAsa akatha upagArabhara / praNamUM tehanA pAtha // 8 // caMda nariMda taNo racUM | zIlaguNe sucaritra // zrotA zrutabhUSaNanipuNa || parama dharama supavitra // 9 // etc. fol. 17 iti zrIcaMdacaritre prAkRta[ saM ]baMdhe vIrasenarAjAdi ( dI ) kSA caMdajanmavIramatI vidyAprApti 2 vadhuvipratAraNavacana || 3 || vimalapUryAgamanarUpA // 4 // AbhizcatubhiH kalAbhiH pratipAditaH prathamollAsa ( : ) saMpUrNa // zrIH // fol. 35deg iti zrIcaMdacaritre prAkRtabaMdhe caMdasiMhala milanasvarUpa 0 // 1 // kanakadhvajakathA zravaNarU0 2 bhATikapANIgrahaNAtmikA || 3 || - 'rAmA' puryyAgamanAMkA || 4 || AbhizcaturbhiH kalAbhiH prabodho dvitIyollAsa 0 // / 1086 // 8 Ends. fol. 93* [206. fol. 64 iti mohanaviracite caMdacaritre prAkRtabaMdhe premalAlacchIjIvata ( na ) svarUpa // 1 // caMdakurkaTajananAtmikA 2 zivamAlAyAH karkaTa - pradhAnasa( saM ) jJikA 3 premalA milanasvarUpA 4 AbhizcaturbhiH kalAbhiH samarthito ( 5 ) yaM tRtIyollAsaH // 3 // s 1 caritravacana ( v. 1, ), 'tapa' gacchanAyaka guNagAyaka | vijaya senasuraMdA jI // pratibo ( bodhyo jiNai 'dilI 'no pati // akabarasAha bhumIMdA jI // 16 // tAsa caraNasatapatra madhukara | kIrtivijaya uvajhAyA jI // tAsa sIsa kavikulamuSamaMDana || mAMnavijai kabirAyA jI // 17 // ta padasevaka matizrutisAgara || lajjha (bdha ) pratIka kahAyA jI || paMDita rUpavijayaga (gu )Ni guruyA || dina dina sujasa savAyA jI // 18 // tehane vA( bAlaka mohanavijaye || aTTotara so 108 DhAlo jI // gAyo caMdacaritra ju raMge || 'caravacacanaparinAle jI // 19 // kIdho cothe ulAsa saMpUraNa || guNa vasu saMyama ( 1783 ) varSe jI || posamAsa zita paMcama divase // tiNe guravAre harSe jI // 20 //

Page #308
206.] The Svetambara Narratives 'rAjanagara' comAsa karineM // zravaNa deva zrotA sAMbhalasyai // je koI maNasyai guNasyai suNasye / tasu ghara maMgalamAlA jI // dina dina vadhatI vadhatI thAsyai // nirmala kIrti visAlA jI // 22 // adhika ( ko ) u (o) chu je kahitrANuM // micchA dukaDa teha jI // dhUmija acala hojyau dharaNItala // caMda taNA guNa eha jI // 23 // gAyA caMdacaritra jI // thAsyai teha pavitra jI // 21 // kalaza || e cAritrasAgara hUMtI || niraSI yatana muragira Acaya // caMdanRpasaMbaMdha sasI jima || ati prabhAkara udharyau || zrI vijayakSemadarAje || karI parama guruvaMdanAM || kavirUpasevaka mohana vijayai // varNavyA guNa caMdanA // 1 // iti zrImohanavijaya viracite caMdacaritre catuSkaMDena prAkRtaprabaMdhAcaMdapragaTavArtA kRtAH tatra caturthakhaMDe caMdapragaTavIramatIvadhI (ghA) bhAgamane purIprApte saMyamagrahaNa || 3 || zIvapadaprAptirUpAbhizvaturbhiH kalAbhi (:) samartho caturthollAsaH // // graMthAgraMtha | zlokasaMkhyA // // 4032 / / // samAptam // lipa...... pU ( ? )ramadhye || liSAyata' paMcapallI 'vAra...... .ArajAjI zrIzrIzrIrAdhAjI tatAgre paThanArthe ArajAjI zrI // ...mItI caitakRSNA 14 ravivAsare saMvat 1994 kA | 15 35 [J. L. P.] 273 In connection with the story of king Candra my article entitled " kUkaDAnuM dAna " is published in " Akhanda Ananda " ( Vol. VII, No. 7). Reference. --- Published by Bhimsi Manak in A. D. 1888. This text along with the Gujarati translation (bhavartha) and elucidation (vivecana) is published by Amrutalal Amarchand Salot in A. D. 1938. For extracts and additional Mss. see Jaina Gurjara Kavio ( Vol. 1I, pp. 438-441 & Vol. III, pt. 1, pp. 1383-1387) In Jinaratnakosa ( Vol. I, p. 118) additional Mss. are noted. Here this work is named as ' candranRpacaritra 25 S IO 20

Page #309
689. 5 10 274 Jaina Literature and Philosophy [ 207. candranarendracaritra Candranarendracaritra No. 207 1892-95. Size.- 95 in. by 44 in. Extent.--- 109 folios ; 14 lines to a page; 36 letters to a line. Description.-- Country paper thin, tough and white; Jaina Deva nagari characters; small, quite legible, uniform and very good hand-writing ; borders ruled in two lines and edges in one in red ink; space between the two lines coloured yellow; numbers for the verses, their dandas and lines here and there written in red ink ; foll. numbered in the right-hand margin: fol. 1a blank; so is the fol. 1096; at times foll. are found stuck together probably due to the presence of gum in the ink used; small bits of paper pasted to a few foll.; condition on the whole good ; complete ; the entire work is divided into four sections partly named as khandas and partly as ullasas as under : Khanda I foll. 10 to 216 Ullasa II , 21 , 44* , III , 44s , 764 Khanda IV , 76 ,, 109*. Age.- Samvat 1850, Saka 1715. Begins.- fol. 10 // 16 // zrIjinAya namaH // 30 prathama dharAdhava tI (pra) prathama etc. as in No. 206. Ends.- fol. 1080 ___ 'tapagacchanAyaka etc. up to varNavyA guNa caMdanA // 1 // as in No. 206. This is followed by the lines as under : - ____ iti zrImohanavijayaviracite caMdacaritre catuSkaMDena prAkRtaprabaMdhe caMdapragaTavArtA kRtAH / tatra caturthakhaMDe caMdapragaTanavIramatIvadhAbhAgamane / / purIprApta saMyamagrahaNaH // zivapadaprAptirUpAbhizcaturbhi kalAbhi(:) samartho(5)yaM caturthollAsaH samAptam // // saMvat 1850rA varSe 1715 / / || mitI jeTha sudi 13 dine // 1 // zrIrastuH / zrI 1 N. B.- For additional derails see No. 206. 35

Page #310
208.] candranarendracaritra No. 208 The Svetambara Narratives Size-10 in. by 48 in. Extent.- 46 folios; 13 lines to a page ; 38 letters to a line. Description.- Country paper thick, tough and white; Jaina Devanagari characters; big, quite legible, uniform and beautiful hand-writing; borders ruled in three lines and edges in one in red ink; numbers for the verses, their dandas and some lines here and there written in red ink; foll. numbered in the right-hand margin; fol. 1a blank; condition very good; this Ms. goes up to two ullasas only though there are four; the extent of each of them is as under :---- Ullasa I foll. Th to 22b II 22b 466 Ends. fol. 46b - "" 13 dr Age. -- Samvat 1837. Begins. fol. 1 960 // zrIsarasvatyai namaH / / sakalapaMDitasiromaNI paMDitottamapaMDitazrIzrI 108 zrIpaM / bhAMNavijayagaparamasadgurubhyo namaH (namaH) Candranarendracaritra 345. 1871-72. 275 dUhA prathama gharAdhava tIma etc. as in No. 206. simI DhAleko DhA0 mohaneM bIjeM ullAsa su0 sa0 / zrIjinadharma thaki lahe gha0 caMdanaridaprakAsa 22 su0 sa0 // zrIcaMdacaritre prAkRtaprabaMdhe caMdasiMhalavi (? mi ) lanasvarUpa 1] kanakakathA suvarNarUpA 2 bhATikapANigrahaNAtmikA 3 puna 'rAmA' puryAgamanakA 4 AbhizcatubhiH kalAbhi prabuddho dvI ( dvi ) tiyollAsaH 2 saMpUrNa zrI ' kozala' nagare[:] // lakhitAniH // saMvat 1837 varSe vaizApamUdi 13 ravau // 11 aft !! N. B. - For additional information see No. 206. 5 10 IS 20 25

Page #311
276 5 Jaina Literature and Philosophy [ 209. candraprabhacaritra Candraprabhacaritra 1280. No, 209 1884-87. Size.- IT in. by 4g in. Extent.- 12t folios ; IS lines to a page ; so letters to a line. Description.-- Country paper thin and white; Devanagari chara cters with pRSTamAtrAs; small, clear and good hand-writing; borders ruled in four lines in black ink; fol. 1* blank ; a part of fol. I kept blank probably with a view to decorating it with a design of a jina (Tirthankara); edges of the first fol. slightly damaged; complete; com. posed in two paricchedas in Samvat I 264. This work was completed in two months. Age. Old. 15 20 Author.- Devendra Suri, pupil of Vijayasimha Suri of the Nagen dra goccha and successor of Dhanesa. Subject - Life of Lord Candraprabha, the eighth Tirthankara of the Jainas. Begins.- fol. 1 / / 6 // OM namaH zrIcaMdraprabhasvAmine // dRSTo(5)pi hRSTajanalocanacaMdrakAMta mazrAMtamAMtarajalAvilamAdadhAnaH / caMdraprabho jayati caMdra ivezamitraM citraM punaH zubhazatAya yadaSTamo(s)pi // 1 // kSetre(5)khile 'bharata' nAmani bodhivIja vApAya yaH kila purAdidhurAmavAha / aMsasthalasthitirasau kiNakAlimeva kezAvalivijayatAM vRSabhasya tasya // 2 // etc. Ends.- fol. 1216 tato 'naMdIzvara'dvIpe zAstrataH pratimotsavaM / kurvANAssUnugIrvANAH seMdrAH svaM svaM padaM yayuH // 32 // kaumAre pUrvalakSe dve sADhe rAjyasthito punaH / pUrvalasthAH SaT va (ca) sArdAzcaturvizyaMgasaMyutAH // 33 // caturvizatyaMgahInaM pUrvalakSaM punadra (ba)te / ityAyuH pUrvalakSANi daza caMdraprabhaprabhoH // 34 // 30

Page #312
209.] The Svetambara Narratives 277 supArzvasvAminirvANAnutthI caMdraprabhanivRtiH / zateSvarNa ca koTInAMta punavasvamUt // 35 // iti zrIdeveMdrAcAryaviracite zrIcaMdraprabhasvAmicarite lavanayavarNano nAma dvitIyaH paricchedaH / 5 samAptaM cedaM caMdrapramasvAmicaritaM / cha / 'nAgeMdra'gacche vikhyAtAH / paramArAtvarayoH tmaaH| zrIvarddhamAnanAmAnaH / marAyAdamUgayA 5)bhavan // 1 // guNagrAmAtirAmo dharAmRmUrirbabhUva sH| yadAsyakamalakroDe vikrIdurdhananRzriyaH // 2 // siddhAMtAdityamAbhitya kalApUrNaH sudRttabhAk / caMdravat prItidaH so(s)bhUccadrasaristataH paraM / / 3 // vidyAvallIvRkSaH sNymprtimaarthH| saMsArAbdhisadAyAna devasariguruprabhA // 4 // siddhavidyArasarya(sparzA)tA (t) suvarNatvamupAgataM / zivAyAlayamUrINAM vadha (4) sUrinupAsmahe // 5 // nirvAsyAnyagirazcittAnya vaSTabhya sthitA tRNAM / yadvAkasobhUjagaradyAtaH / zrIvadhanezvaraH prabhuH // 6 // yadvAgagaMgAbhitrimArkasAhityalakSaNaH / punAti jIyAd vijayasiMhamUriH sa bhUtale / 7 // zrIdhanezapade bhUridevedrAkhyAH svabhaktitaH / puNyAya caritaM cakre zrImaccaMdraprabhaprabhoH / / 8 // vyomasvAnalasthitiH pratidizaM vikSipya tArodanaM / pItvA caMdramahApayo'dadhadavaSTaMbhaM ca dhAvyA karaiH // 9 // bAlArkapatadiMdukaMdukamAmAvAsyAsu dhRtvA kSipe ghA tatvAt tAvadidaM caritramavanau cAMdraprabha naMdatAt / catuSavekasaMkhye ca / 1264 jAkha vikrama(va)tsarau / 'somezvarapure'ratra / dvimAsyA caritaM kRtaM / 2161 sarvasaMkhyA // 5325 cha / / Reference.- Published in the Armavallabha Series as No. 9 from Ambala in A. D. 1930. For additional Mss. see Jinaratnakosa ( Vol. I, p. 119 ). 30

Page #313
278 Jaina Literature and Philosophy [210. s 15 candraprabhacaritra Candraprabhacaritra 158. No. 210 1872-73. Size.- 12 in. by 43 in. Extent.-- 106 folios ; 17 lines to a page ; 50 to 52 letters to a line. Description.- Country paper thin, tough and white ; Jaina Deva nagari characters with occasional AES; small, quite legible, uniform and very good hand-writing; borders ruled in two pairs of lines in black ink ; red chalk used; foll. numbered in the right-hand margin; fol. I blank; so is the fol. 1066; the unnumbered sides decorated with a spot in red colour in the centre; the numbered in each of the two margins, too; edges of several foll. slightly gone; condition on the whole tolerably good ; complete ; the entire work is divided into two pa: icchedas; the extent of each of them is as under :Pariccheda I foll. 10 to 684 , II , 68 , 106. Age.- Not modern. Begins.- fol. 1 // 6 // OM namaH zrIcaMdraprabhajineMdrAya / / dRSTo(5)pi hRSTajanalocana etc. as in No. 209. - fol. 68 iti zrIdevedrAcAryaviracite zrIcaMdraprabhasvAmicarite pUrvavaMza prastAvanAparicchedaH prathamaH // 3 // graMthAgraM 3162 // Ends.-- fol. 1056 tato 'naMdIzvara'dvIpe etc. up to dvimAsyA caritaM kRtaM // 7 // as in No. 209. This is followed by the lines as under : // 7 // 2161 sarvasaMkhyA 5325 / akSaramAtrapada[ : ] svarahInaM / vyaMjanasaMdhirvivarjitarepha // sAdhubhireva mama kSamitavyaM / ko na vimuhyati shaastrsmudre|| iti // 5 // zubhaM bhavatu lekhakapAThakayoH // 7 // shriiH||5|| zrI pattana' vAstavyaiH pdmaaraajaakthaavrvnaakssaiH| pUMnAbhImAdetAdamAra / tAzreSThidetAkaiH // 1 // 20 30

Page #314
211.] The Svetambara Narratives 279 sazraddhArddhavarairAsAvAcchAkamAbhidheH ribhyaH / thAIyAmAtaragoMgAviNAyagaizcApi saMbhUya // 2 // zrI aMcala gacchezaH zrImanmANikyasuMdaraguru(rUNAM / zrImatimerUNAmiha / ziSyazrIrAjavarddhanagaNInAM // 3 // zrIcaMdraprabhacaritaM / vihAritaM bhaktibhAvitairetedri(di)gbANatithi( 1558 )pramite varSe / svA(sva)paropakArAya // 4 // sulalitamuvacanaracanaM / sujanamana pAvanaM ca jinacaritaM / naMdyAdAcaMdrArka / sadasi satAM vAcyamAnamiha // 5 // prazasti / shrii|| / // // zrI shrii|| // // kahalAravATake // // // N. B.- For further particulars see No. 209. 10 candraprabhacaritra Candraprabhacaritra 347. No. 211 1871-72. Size.- 115 in. by 3} in. 15 Extent.- 206-2-6-120%D78 folios ; II lines to a page; 40 letters ___to a line. Description.- Country paper thick, rough and greyish, Jaina Devanagari characters with frequent pRSThamAtrAs; big, quite legible, uniform and very good hand-writing; borders 20 ruled in two pairs of lines in black ink; red chalk pro. fusely used; foll. numbered in the right-hand margin ; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; in a majority of cases the central portion is decorated with a disc in red 25 colour; in the case of the numbered sides even each of the two margins is so decorated; there is a hole in the centre of each of the foll., several foll. slightly wormeaten ; condition on the whole tolerably good ; complete ; the entire work ends with the second pariccheda ; it begins abruptly since the first 120 foll. are missing ; the extent of su the two paricchedas is as under :Pariccheda I foll. 121 to 135 " II , 135 , 206.

Page #315
280 Jaina Literature and Philosophy [21LL Age.- Samvat 1462. Begins.- fol. 121 tA // 10 // padayaM hi na me garbhAduHzIle duSyati vrate / yAhi nissaramadrehAdityenAM niraghAsayan / / 11 // .... ca piturveimrodnotsuunlocnaa| jJAtvA pitrA(5)pi jAmAturukti nirvAsitA hyasau // 12 // etc. Ends. fol. 206 tato 'naMdIsva(zva) radvIpe etc. up to dvimAsyA caritaM kRtaM // 10 // cha | as in No. 209. This is followed by the lines as under :-- bAlANa ravo turayANa hiMsaNaM bNdiviNdnigghoso| garUDa maMthaNa saho .... .... viphurai // 1 // graMthAnaM sarvasaMkhyA 5827 // cha / caMdraprabhasya caritaM 'kaMthadurgavare pure / vyalikha .... .... mUriNA puNyahetave // 1 // saMvat 1462 varSe bhAdrapadasudi 9 navamyAM somavAre mUlanakSatre zrI'caMdraga .... .... dharmaghoSAcAryasaMtAne prabhuzrIdhanatilakasariziSyeNa zrIsAgaratilakasariNA zrIcaMdraprabhasvAmi.... .... kathAsaMgraho(5)yaM likhitaH // cha // zrI kaMthamahAdurgasthAnasthitena // cha / / yAvat pRthvIra / / .... yAvaccaMdrAhimAcalau / paThyamAnabudhaistAvadeSA naMdatu pustikA // 1 // udakAnalacau ... bhyo vishesstH| rakSaNIyA prayatnena yataH kaSTena liSyate // 2 // bhagnapRSTika .... STiradhomukhaM / / kaSTena likhitaM zAstraM yatnena paripAlayeta // 3 // yAdRzaM pustake dRSTaM tAdRzaM .... .... / yadi zuddhamazuddhaM vA mama doSo na dIyate // 4 // caMdraprabha:prabho(bho)zcaMdramarIcinicayojjvalaH / mUrti .... nirmitai (te)va[:] zriye(5)tu (stu) vaH // 5 // zrI caMdraprabhasvAmicaritaM .... va .... samAptaM // cha / shrii| N. B.- For further particulars see No. 209. 1 This is v. 10 of Sakalarrhat,

Page #316
212.] The Svetambara Narratives 281 candraprabhacaritra Candraprabhacaritra 782. No. 212 1895-1902. Size.- 114 in. by 43 in. Extent.--- 88 folios ; 17 lines to a page ; 62 letters to a line. Description.- Country paper thin and greyish; Devanagari characters with pRSTamAtrAs; small, legible and very good hand-writing ; borders ruled in three lines and all the four edges in one line in red ink ; red chalk used ; foll. numbered as usual ; a piece of paper of the size of a fol. 10 pasted to fol. I"; fol. I blank ; almost every fol. wormeaten ; some very badly e. g. foll. 12-14; small strips of paper pasted to several foll. ; complete. Age.- Samvat 1494. Begins.- fol. 10 dRSTo'pi hRSTajana etc. as in No. 209. Ends.-- fol. 88 tato 'naMdIzvara'dvIpe etc. up to cAMdraprabha naMdatAt // as in No. 209. This is followed by the lines as under :devapuraskRta iMdro dAnarato'dhikamavAptasanmAnaH 20 bhavatu sudha(dhA? )moghasukhaH 'suvarNagiri'labdhapadalakSmIH / / 11 / / samAptaM cedaM zrIcaMdraprabhasvAmicaritaM // paM0 5725 // evaM // zubhaM bhavatu // cha // zrI // // 60 / / namaH zrIjinAgamAya / / asti svastipadaM 'revA'taTakoTIrasaMnibhaM / puraM 'bhRgupura' nAma tIrtha zrIsuvratAItaH // 1 // prauDha prAgvATa 'vaMzAgramuktAmaNiriSAmalaH / sAdhuH sAmalanAmA'bhUt tatra sadvattabhAsuraH // 2 // tasya jAyA'bhavad vi.....raparA 'vidhya 'bhUriva / yasyAM svairaM pracikrIDurguNA madragajopamAH // 3 // tayorAsIt sutaH somasiMhaH siMhaparAkramaH dUrato'pi yamAkarNya dAninastat tyajurmadaM / / 4 / / 36 1J. L. P.]

Page #317
282 Jaina Literature and Philosophy [212. dhatto dharmadhuraMdharyAviva tasyAnujAvubhau / bhImaH sImAtigaH zrImAna sahadevAhvayaH paraH // 5 // na kasya mAnyo bhuvi bobhavIti bhImaH sa sImAtigabhAgyayuktaH / adRSyadAkSiNyavazA ivAyu guNA yamekaM sahavAsahetoH // 6 // bhAkU bhAryA(5)bhavat tasya zubhasaMparkazAlinI / hararAja-vatsarAjo nAkarastAsutAtrayaH // 7 // pratipadamanuyAto nirmalAbhiH kalAbhiH zriyamiha gurughargollAsavizrANinIbhiH / atimadhuramadhUdyatsvAdasaMvAdigomAn samajani hararAjo rAjavaccArumUrtiH // 8 // itazva diviSatpurIjayini 'naMdapadme' pure dhanI dhanadasaMdaro nivasati sma caMgAyaH amuSya vizadA'mavacchazikaleva bAsU priyA ___sutA guNamANazriyAM sphuTakhanIva mAM-riti // 9 // tAM prAcyapuNyasubhagAM zubhabhAgyazAlI pANI cakAra hrraajmhebhyraajH| zIlena cArughanasArasugaMdhinA yA lebhe lalAmakamalAM ca satIjanasya // 10 // tattattapasvikAvivAdicaritrasiddha saiddhAMtikaprakaTasAdhukRtapratiSThe / gacche 'tapA' iti jagatritaye'pi gIte zrIsuMdaragurupravarA babhUvuH // 11 // tatpaTTodayazailamaulitaraNizcAritricUDAmaNiH / siddhAMtAmRtasAraNiH zritajanAbhISTArthaciMtAmaNiH / saubhAgyAdbhutabhAgyavastuvipaNiH somatvarAkAmaNiH / ___ bhAti zrIyutasomasuMdaragururnavyaH sudharmA gaNiH // 12 / / giraM tadIyAM vidhivannizamya vizuddhasadarzanamApya bhAvAt / mAM....SaDAvazyakamukhya svaM....tI zvaraprasAdAt // 13

Page #318
213.] The Svetambara Narratives 283 alekhyaya vikramabhUpakAlAd yugI(gAM)kavedeMdu 1494 mite'tra varSe / sAdhvarthamAvazakasUtrayugmaM / laghvI tathA viMzatipATavRttiM // 14 // AvazyakabRhadvRtti karNikAbikRti tathA / caMdraprabhacaritraM ca kathAkozaM tathA pRthu // 15 // 'bhRgukaccha 'zrutakoze gurUpadezAdalekhaya graMthAn / caturo'pyetAn jenAgamabhakyA zrAvikA mAMIH / / 16 / / iti prazastiH / saM. 1494 varSe....pustikA lekhitaa| 'vRddhtpaagcchggntrnnisuvihitbhttttaarkiisomsuNdrsuuripkssiiyaa| 10 yAvad vAdhirmahI yAvad yAvad varSadharA ngaaH| yAcanmerurbudhaistAvat gustikA vAcyatAmasI / / 17 / prazastipadyAni | zrIH // zrIH / shriiH| N. B.- For other details see No. 209. Cf. candraprabhacarita ( IX, 38 ; pUtkaroti ) with naiSadhacarita 15 (XX, 145). 1239. 20 candraprabhacaritra Candraprabhacaritra No. 213 1886-92. Size.-93 in. by 4g in. Extent.- 229-1-1=227 folios ; II lines to a page; 36 letters to a line. Description.- Country paper thin and greyish; Devanagari characters ; big, clear and good hand-writing; foll. numbered as usual; fol. I blank ; red chalk used; borders mostly ruled in four lines in black ink; the original first three foll. replaced by the new ones; the corresponding paper being white, and its borders ruled in three lines and edges in one in red ink ; fol. 34 lacking ; so is fol. 41; foll. 116-124 and 176-229 worm-eaten; colophon not completed; so incomplete. 25

Page #319
5 10 15 20 25 30 284 Age. -- Fairly old. Begins-fol. 1 Jaina Literature and Philosophy dRSTo'pi hRSTajanalocanacaMdrakAMta etc. as in No. 209. Ends (abruptly ) -- fol. 2290 tato 'naMdIzvara 'dvIpe etc. up to pItvA caMdramahaH payodadhadavaSTamaM as in No. 209. N. B. - For further particulars see No. 209. [213. candraprabhacaritra No. 214 Size.- rog in. by 4g in. Extent. - 122-47 = 75 folios; 15 lines to a page 51 letters to aline. Age. - Samvat 147c. Begins ( abruptly ) - fol. 48 Description. - Country paper tough and grey; Devanagari characters with pRSThamAtrAs; small, clear and good hand-writing ; borders ruled in four lines in red ink; red chalk used; this Ms. contains marginal notes at times; on fol. 72 ratnamAlAkathA completed ; so a part of fol. 72deg kept blank ; fol. 122b blank; edges of fol. 122 slightly worn out; fol. 1-47 lacking ; otherwise complete. Candraprabhacaritra 1303, 1887-91. jA putrakaH syAnnidarzanam // 2 // sa hi jIvitaM nRNAM satyameva hi kIrtaye / vinA sattvaM pumAMso'Si strIpaMktyAsanabhojanam // 3 // etc. Ends. fol. 121 tato 'naMdIzvare' dISe etc. up to caritaM kRtaM / 2169 / / sarvasaMkhyA 5325 / as in No. 209. This is followed by the lines as under : saM. 1470 kArtikavadi 4 aparAMta 5 gurau 'aNahillapura sthAnasthi likhitaM / zubhaM bhavatu // cha // yAvat pRthvI raviryAvat yAvaccaMdra'himAcalo' / paThyamAnA budhaistAvadeSA naMdatu pustikA / / 1.

Page #320
215.] The Svetambara Narratives 285 udakAnalacaurebhyo mUSakebhyo vishesstH| rakSaNIyA prayatnena yataH kA(ka)pTena likhyate // 2 yAdRzaM pustake dRSTaM tAdRzaM lIkhitaM myaa| yadi zuddhamazuddhaM pA mama doSo na dIyate / zrIbRhadagacchIyarAmasenIyAdhaTaMkazrImAnadevamUri tatpaTTe bha.zrImAnatuMga- 5 sUri tasya saMtAne bha0zrIdhanadevasUri tatpadRzaMgArabhaTTArakazrIdharmadevamUri tanpaTTe bha zrIdharmasiMhamari svayamalekhi AtmapaThanArtham / zrIH // zubhaM bhavatu // 1 N. B.- For other details see No. 209. 10 15 candra-bhAnu-bhIma-kRSNa- Candra-Bhanu-Bhima-Krsna- sundara-kathA Sundara-katha 1288 (c). No. 215 1884-87. Extent. fol. 4b to fol. 76. Description.- Complete. For orher details see No. 1288 (a): 1884-87.. Author.- Not mentioned. Subject.- The topic treated in this Ms. has a bearing to " dana". The entire narration is in Sanskrit and is composed in 83 verses. It furnishes us with a life-sketch of the follow- ing: candra, bhAnu, bhIma, kRSNa and sundara. Begins.- fol. 40 mugdhatvenApi si(da )dhye sthAna dAnaM dattaM mahAmane / ityarthe candrabhAnvAdyAH suMdarazrutidarzanaM // 1 // etc. Ends.-- fol. 70 niravadyaM tapaH kRtvA yayuH sarve surAlayaM / punamAdisAmagrImApya sensyati te'cirAt 83 // caMdrabhAnubhImakRSNasuMdarANAM dAne kathA / . 20

Page #321
10 20 286 25 candralekhArAsa No. 216 Size. 7 in. by 4 in. Extent. -- 18 folios; 18 lines to a page ; 38 letters to a line. 5 Description.-- Country paper somewhat thick, tough and greyish ; Jaina Devanagari characters; very small, quite legible, uniform and very good hand-writing; borders ruled in two lines and edges in one in red ink; red chalk used; foll. numbered in the right-hand margin; edges of the last fol. gone; condition on the whole good; complete ; composed in 29 dhalas in Samvat 1728 at Paciakha. Age.-- Samvat 1812. Author. 30 Matikusala, pupil of Mativallabha of the Kharatara gaccha. 15 Subject. A narrative of Candralekha in Gujarati in verse. It points out the importance of "samayika", a temporary vow of preserving equanimity of mind. Begins, fol, 12 // 60 // zrIgurubhyo namaH Jaina Literature and Philosophy Ends. fol. 18b [216. Candralekharasa 475. 1882-83. dUhAH sarasati bhagata namI karI praNatuM sadagurupAya vidhanavihAraNa suSakaraNa parasiddha eka upAya 1 samarUM gAMDIpAsajI paratA pUraNahAra sAmayika Upara sarasa kahisa kathA suvicAra 2 etc. time tumhe bhavayaNa hita gharI jI sAmAika karau sudhare niramala thaI jima nistarau meM ima kaheM jina svayaMbuddha re 10 gu0 chedagraMtha meM e ache re sarasa saMbaMdha rasAla re gurusuSa guNa suNi gAiyA re vintra vizva kavIyaNadhyAla re 110 saMvat 1728 siddhi kara muni sise jI yadi AsU dasama rivIvAra re 'yA' mai prema jI eha racyo adhikAra re 12 gu0 'paratara' guNapati muSakarU jI zrIjinacaMda suriMdare vaDha jima vadhatI sAtha 'Sema 'nI jI jAMghU (dhu) rajanIsa da ( di )NaMda re 13 gu0

Page #322
287 217.] The Svetambara Narratives suguNa zrIsuguNakIratigaNI jI pAcaka padavI dharata re aMtevAsI ciraMjayau jI mati[ma vallabha mahaMta rai 14 guNa prathama tamu ziSya atipremasUM jI matikuzala kahai ema re sAmAika mana sudha karI jI jayavarau caMdralehA jema re 15 gu0 .. ratanavallabha gurusAMnidhai jI e kIyo prathama abhyAsa re cha sai covIsa gAhA achai jI ugaNatrIsa DhAla ulhAsa re 16 gu0 bhaNe suNe je bhAvasaM re girUa taNA guNa jeha re mana sudhi jina bhrama je karai jI tribhuvanapati huvai teha re 17 gu0 sarvagAthA 625 iti sAmAyaka adhikArI caMdralehAcopaI saMpUrNam saMvat 1812rA 10 varSe mitI Asu sadi 7 tithau guruvArai / / gurajIzrImahimAvallabhajIgaNi taziSya vAlhacaMdra likhataM // pAdaru' madhya // zrIrastuH // kalyANamastu / / zrI // leSakapAThakayo // zrI. Reference. For extracts and additional Mss. see Jaina Gurjara Kavio (Vol. II, pp. 265-268 & Vol. III, pt. 2, 15 Pp. 1269-1270). candralekhArAsa Candralekharasa No. 217 1604 (a). 1891-95. Size.- 9 in. by 4; in. 20 Extent.-- 13 folios ; 21 lines to a page ; 48 letters to a line. Description.- Country paper somewhat thick, tough and white; Jaina Devanagari characters; very small, quite legible, uniform and beautiful hand-writing; borders ruled in two lines and edges in one in red ink ; red chalk used; foll. 25 numbered in the right-hand margin; fol. I3 blank ; some space kept blank in the centre of the numbered and unnumbered sides as well ; yellow pigment used while making corrections; condition very good ; complete. In the 30 end there is an additional work named as "caturvizatijinacaturvidhasai saGkhyAgIta" (see No. 199)...

Page #323
288 Jaina Literature and Philosophy [ 217. Age. - Samvat 1767. Begins-- fol. 1a y Q011 gen Tefa Ana FAT ** etc. as No. 216. Ends -- fol. 120 PA CF anauor etc. up to iyaaga gar ao que yo as in No. 216. This is followed by the lines as under : iti zrIsAmAyikopari caMdralehAcatuSpadI saMpUrNAH saMvat 1767 varSe liSitaM vidvatnayanabhadragaNipravaraiH zrI navaharakoTTe' caturmAsI vihitA zrImadguro(:) prasAdAta vAcyamAnaM cirAyubhava / kalyANaM bhava / zrIH // shriiH|| etc. N. B.- For additional information see No. 216. 10 IS campakamAlAkathA Campakamalakatha 1304, No. 218 1887-91. Size.- 10 in. by 4: in. Extent.-- 20 folios; 17 lines to a page; 44 letters to a line. Description.- Country paper thin, tough and greyish ; Jaina Devanagari characters with occasional galats; small, quite legible, uniform and very good hand-writing; borders ruled in two lines in black ink; red chalk used; foll. numbered in the right-hand margin ; fol. r' blank except that the following lines are written on it :-- 11 FAST !! 59111 ___ bhAvavijayagaNikRtA fol. 200 blank; yellow pigment used while making corrections; edges of a few foll. gone; condition on the whole good ; complete ; composed in Samvat 1708 at Vidyapura ; the entire work is divided into four prastavas; the extent of each of them is as under :Prastava I foll. 10 to 4' 11 4 a ,, ga III , 8e 13b , IV ,, 130 25

Page #324
218.] The Svetambara Narratives 289 Age.-- Not modern. Author.- Bhavavijaya Gani, pupil of Munivimala Gani. Subject. --- A story of Campakamala, a sati ( chaste lady). It points out the importance of sila. Begins.-- fol. 1 e 60 // ahaM namaH // OM namo vizvavikhyAtakIrtaye sphAramUrtaye / zrI zaMkhezvara'pArdhAya / trailokyAlAdakAriNe // 1 yo bAlye suracANUraM / vijigye(s)riSTanAzaka yazodayA(Da)zritaM vaMde / taM vIrapuruSottamaM / / 2 aiMdrI digiva maartddN| yA bodha janayatyalaM / tAM zAradAM zraye nAvamiva zAstrAbdhipAradAM / / 3 svagurUna sajjanAMzcaiva | vaMde vizvopakArakAn / duttamapi ye sUkyA |nyNti zreSThattatAM / / 4 ziSTAcAra vidhAyeti / zIlamAhAtmyamaMjulA / kathAM caMpakamAlAyA / yathAdRSTAM tanomyahaM / / 5 etc. Ends,- fol. 196 samAdhimRtyumAsAdya / prAMte(5)pyanazanAdinA / sugati to gatI sA hi / suprApA jinasevinAM // 86 itthaM caMpakamAlayA suvimalaM zIlaM dadhatyA dRDhaM / lebhe( s)vApi mahAn pramAvavibhavaH pretyApi zarmottamaM / tadhetau duritakSayAya parame heto prbrhmnnH|| ___ samyagbrahmaNi bhAvasAdhumahite yatnaH samAdhIyatAM // 287 iti zrI tapA 'gacchAdhirAjazrIvijayadAnasUrIzvaraziSyamahopAdhyAyazrIvimalaharSagaNimahopAdhyAyazrImunivimalagaNiziSyopAdhyAyazrIbhAvavijayagaNiviracitAyAM caMpakamAlAkathAyAM caturthaH prastAvaH nNpuurnnH| 25 tatsaMpUtau ca saMpUrNeyaM cNpkmaalaakthaa|| 'tapa'gaNagaganaravINAM / zrIvijayANaMdasUrizakrANAM / rAjye kadhA( thA )nakamidaM / bhAvavijayavAcakastena // 1 siddhigaganamunicaMdrapramite( 5 )nde 1708 vijydshmikaastithau| 'vidyApure' vitene kathAma so( 5)rthitaH praajnyH||2 mahAsatIvRttamidaM vitanvatA / 'yuktaM yaduktaM mayakA(olpabuddhinA // miththA()stu tat pApamapAgrahasya me| sadbhizca tacchodhyamudArabuddhiImaH // 3 a [.L. P.] 30

Page #325
S JO 15 20 25 30 Jaina Literature and Philosophy [218. Reference. Published by the Jaina Atmananda Sabha in V. S. 1970. For additional Mss. see Jinaratnakosa (Vol. I, p. 121 ). 290 campakazreSThikathA No. 219 Size - 11 in by sog in Extent.- 18 folios; to lines to a page; 32 letters to a line. Description.- Country paper tough and white; Devanagari chara cters; big, legible and good hand-writing; borders not ruled; numbers for foll. 1-2 entered twice as usual ; foll. r(c) & : 8b blank ; white paste used; complete; corrected at times. Age.-- Not quite modern. Author.-- Jinakirti. For his additional works see No. 65 & Nos. 196 and 267 of Vol. XIX, sec. I, pt. I. Subject.- Story of Campaka sresthin ( merchant ) illustrating the importance of "anukampadana ", a donation given out of compassion. The city of Campa is said to have 84 squares (catuspathas) where different dealers carried on their business. Begins. fol. 1 // 60 // zrIgaNezAya namaH // Campakasresthikatha 717, 1875-76. 'caMpA' nAma nagarI saugaMdhikagAMdhikatAMbUlika kAMdavika suvarNakAramaNikArasauvarNikamANikyavarti kanANAvarttaka sukha makSikAkArakaNAvaNika dRSyikacarmakAra - kAMsyakAramAlAkArasUtradhAra lohakAraghRtApaNikatailika sautrika kArpAsikamAMDazAlikarajaka paTTikA vaijJAna zAlika taMtuvAyaprabhUti caturazIticatuSpatharamaNIyA tatra sAmaMtapAlo rAjA etc. Ends. fol. 184 tadA ca tvayA vaMcanAmateH zreSThinaH parAbhavaH kRtaH / tenAtra taba beraM jAtaM mAhAsenabhave tvayA kulamadaH kRtaH tena karmaNA tvaM 'kAMpIlyapure' trivikramazreSThina dAsyAH putro jAtaH iti pUrvabhavaM zrutvA caMpakavyavahArI bhAryAyuto dIkSAM lAvA tapastepe ca anazanena mRtvA svarga jagAma / tatazcyutvA 'mahAvidre (de) he ' mokSaM yAsyati / iti anukaMpAdAne caMpakavyavahArIkathA |

Page #326
221.] The Svetambara Narratives 291 Reference. Edited and translated into English by Hertel in ZDMG (Vol. 65, pt. I, p. 425 ); into German in Indische Erzahler (Vol. 7) in A. D. 1922. For additional Mss. see Jinaratnakosa ( Vol. I, p. 121). campakazreSThikathA No. 220 Size. 10 in. by 41 in. Extent. 4 folios; 22 lines to a page; 72 letters to a line. Description. Country paper thin and greyish; Devanagari characters; small, clear though close and fair hand-writing; borders neatly ruled in four lines in black ink; numbers for foll, entered twice as usual; edges of every fol. more or less worn out; condition tolerably good; complete. Age. Pretty old. Begins. fol. 1 q & deg ! 'caMpA' nAma nagarI etc. as in No. 219. Ends. fol. 4b tadA ca tvavA vaMcanAmateH etc. up to iti anukapAdAnopadi as in No. 219. This is followed by the line as under : likhitaM paM0 bhuvanamerugaNinA N. B. For additional information see No. 219. - campakazreSThikathA No. 221 Size.- 101 Campakasresthikatha 718. 1875-76. in. by 48 in. Campakasresthikatha 1281. 1884-87. Extent. 4 folios; 24 lines to a page; 55 to 60 letters to a line. Description. Country paper thin, rough and grey; Jaina Devanagari characters; small, quite legible, uniform and very good hand-writing; borders ruled in three lines in black ink; red chalk used; foll. numbered in the right-hand S 10 15 20 25 30

Page #327
292 Jaina Literature and Philosophy [ 221. margin ; there is some space kept blank in the centre ot the numbered and the unnumbered sides as well; sometimes it is so kept that it forms a pattern; yellow pigment used while making corrections ; edges of each and every fol. more or less gone; condition on the whole tolerably good; complete. Age.- Old. Begins.--fol. 1 a 11 GOLI FA: shinaari SqI' RIA 7 Trt etc. as in No. 219. Ends.-- fol. 46 mar o caur etc. np to ATR artufa Il as in No. 219. This is followed by the lines as under : itya'nukaMpAdAne caMpaka zroSThikathAnakaM // zrIjinakItiribhiH a II & II HER II N. B.- For further particulars see No. 219. 10 20 Descri 15 Fastigaoqat Campakasresthicatuspadi (campaka seThanI caupd| (Campaka sethani caupai.) No. 222 1605. 1891-95. Size.-- 9 in, by 4 in. Extent.-- 10 folios ; 19 lines to a page ; 55 letters to a line. Description. - Country paper thick, tough and white; Jaina Deva nagari characters; small, perfectly legible, uniform and beautiful hand-writing ; borders not ruled ; red chalk used to bring into prominence numbering of verses and some words; foll, numbered in both the margins ; in the lefthand margin the title is written as hiTa ; condition very good; complete ; composed; in V. S. 1695 at Jalora. Age.- Samvat 1746. Author. Samayasundara, pupil of Sakalacandra. For his addi tional works etc. see p. 256. Subject.- A life-sketch of Campaka sresthin in Gujarati in verse. It points out the importance of "anukampardana ", a kind of donation... 25 Suhi 30

Page #328
223.j The Svetambara Narratives 293 Begins.- fol. I e 60 // zrIgurubhyo nmH|| jAlora mAhe jAgatI pArasanAtha pratyakSa praha UThInai praNamatAM sAnidhi karai samakSa 1 gaDha Upari giruaDa nilo 'sovanagiri' siNagAra mahAvIra praNamaM mudA daulatinau dAtAra 2 mAta pitA piNa mani dharUM jiNa dIghau avatAra nAma leInai guru namuM dIkSAnyAnadAtAra 3 kara joDI praNamI karI kahisa ghaj zrIkAra caMpaka seThanI caupaI anukaMpAadhikAra 4 etc. Ends.- fol. Io anukaMpA Upari kahyau caMpaka seThano dRSTAMto re anukaMpA saha Adarau ehavI(thI) chai mugati ekAMto re 14 ke. saMvata sola paMcANu (1695)vaha maI 'jAlora'mAhe joDI re caMpaka seThanI caupAI aMgi Alasa ne UMgha choDI re 15 ke. zrI kharatara' gaccharAjIyo zrIyugapradhAna jinacaMdo re / prathama ziSya zrIpUjyanA zrIsakalacaMda muNido re 16 ke. samayasuMdara ziSya tehanA tiNa caupaI kIdhI eho re / ziSya taNaI Agraha karI je Upara adhika saneho re 17 ke. naranArI rasiyA huspai te sAMbhalisyai sadA AvIre sughaDa sukaMThI be jaNA vAMcajyo bhalI vAta vaNAvI re 18 ke. iti zrIanukaMpAdAne caMpaka zreSThicaupaI saMpUrNA saMvat 1746varSe vaizAkhasadi 2 dine zrI mAMDivIvaMdire' likhitA paM.rAjasAgaragaNinA zrIrastu Reference.-- For extracts and additional Mss. see Jaina Gurjara Kavio ( Vol. I, pp. 366-368 ). ___In " samayasundarakRtikusumAJjali" (pp. 513-514 ) a portion describing a famine is given from caMpakaSThicopada". This portion belongs to khanda II, dhala 6. 20 25 campakazreSThicatuSpadI No. 223 Size.- 9} in. by 4 in. Campakasresthicatuspadi 30 1606. 1891-95...

Page #329
294 Jaina Literature and Philosophy ( 223. Extent.-- 18 folios; 13 lines to a page; 40 letters to a line. Description.-- Country paper thin, rough, tough and white; Jaina Devanagari characters; big, quite legible, fairly uniform and good hand-writing ; borders ruled in two pairs of lines in black ink ; red chalk used; foll, numbered in the right-hand margin ; edges of the first fol. slightly gone ; condition on the whole good; complete. Age. - Samvat 1717. Begins-- fol. 14 il flusso AA: 11 10 AISIT AIC etc, as in No. 222. Ends.-- fol. 18 anukaMpA Upari etc. up to vAta vaNAi ri ke // 18 // as in No. 222. This is followed by the lines as under : sarvagAthA 163 iti zrIdAnAdhikA[2]re caMpakaseThacatuSa(pa)dI saMpUrNa saMvata 1517 varSe ma(mA)ga(sa)ravadi 11 ravIvAsare likhitaM zrI rAghaMpura' IS N. B.- For other details see No. 22. 20 campakebhyakathAnaka Campakebhyakathanaka 348. No. 224 1871-72. Size.-- 10 in. by 4in Extent.- 17 folios; 14 to 15 lines to a page ; 35 letters to a line. Description.- Country paper soinewhat thick, tough and white; Jaina Devanagari characters; big, quite legible, uniform and beautiful hand-writing; borders ruled in two lines and edges in one in red ink ; foll. numbered in the righthand margin ; fol. 1 blank; corners of each and every fol. gone ; condition on the whole tolerably good; complete; extent 1653 slokas; composed at Amlasthala. Age.- Not modern. Author.- Brhma-vimala. Is he Digambara? Subject.-A story of Campaka, an ibhya. It illustrates the prowess of " anukampa-dana". 25 30

Page #330
295 225.] The Svetambara Narratives Begins.- fol. " // ahN|| zreyaHsaMtatikatAra hatAraM sakalApadAM navA vIrajinaM vakSye caMpakebhyakathAnakaM 1 yataH .I0 abhayaM mupattadANaM aNukaMpAucikittidANaM ca duNNa vi mukkho bhaNio tiNNe vi bhogAIyaM diti 2 sattvAnAM karuNAdAnA(da) lakSmIH saMpadyate sadA poTA(DhA)yAH kukSisaMbhUtaH zreSThI caMpakavad drutaM 3 Ends.- fol. 17 anyacca zirasi sumanasaH khaMgAd vA(dhAryate taMtavo()pi hi te tu pAdena sRzyate paTeSu malasaMgatA 72 guNavajjanasaMsargAt yAti svalpo(5)pi gauravaM puSpamAlAnusaMgena sUtraM zirasi dhAryate 73 'mahAvideha kSetreSu samutpadya tataH punaH tajIvo vratamAdAya mokSaM gAmI bhavet sa te 74 zrI Amlasthala'cAturmAsikamadhyastha brahmavimalena zasi(zi )rasavANAgnya hne (1653 ) vihitAH zlokAH caritrasya 75 iti caMpakacaritramm(ma) li / kalyANasaubhAgyagaNinA zrIsUryapure zreyaHNeNayatutarAM Reference.-- For additional Mss. see Jinaratnakosa ( Vol. I, p. 121 para 3 ). Herein some Mss. of Jinakirti's Campakasresthikatha, too, are included. 20 1871-72. 25 jagaDUcarita Jaga ducarita No. 225 284. Size.-101 in, by 4 in. Extent.--- 13 folios; 16 lines to a page ; 40 letters to a line. Description.- Country paper thick, tough and white; Jaina Deva nagari characters; big, quite legible, unisorm and very good hand-writing; borders not ruled ; foll. numbered in the right. hand margin ; edges of the last fol. slightly gone; condition on the whole very good ; complete ; seven 30 Bone;

Page #331
IS 20 25 296 30 Jaina Literature and Philosophy [ 225. sargas (cantos) in all; the extent of each of them is as under: sarga 19 "9 "" 39 "" " I II III IV V VI VII foll. ja to " " 2) " " " 3 Begins. fol. 14 // 60 // OM namaH // parabrahmaNe // 4. 60 8a 12* "" rAkAbhidheya zucipakSavirAjamAnaM duH karmatApadalanaM kila ricaMdra "1 to Age - Not modern. Author.-- Sarvananda Suri, pupil of Dhanaprabha. Subject. - A biography of Jagadu, a very great donor. The famine in Gujarat dated V. S. 1312-15 is mentioned in VI, 67, and King Visaladeva is referred to in VI, 25. For further details see Short History of Jain Literature ( Vol. I, PP. 401-402). " " " " 3a 4 6b 8a 12a 13*. yanmUrddhi pannagaphaNAmaNidIpajAgraj jyotistamavijayi vighnapataMga medi AviSkaroti kRtinAmapavargamArge sa zreyase bhavatu pArzvajinAdhinAthaH 1 ajJAnapakanikaravyatiSaMganAzaM zazvatprasAdasalileNa (na) samujjvalena bAlasya me viracayAtizayAbhirAme ! mAtaH ! sarasvati ! jagajjanabaMdhaSAde ! 2 arhanmatArNava vilAsavidhAnavighnaM dAmahe paramadevadArabhacyA 3 tIvrApakArakaraNako ( 5 ) yi sarve durjanA jagati jAgratu nityameva yeSAM nitAMtabhayataH kvacanApi kAvyamArgAva skhalati kavayo na lasadvivekAH 4

Page #332
___ 297 225.] The Svetambara Narratives saMtaH pavitracaritA duritAbhimuktA rAjati te vidhuvibhAjayi sadguNodhAH svArtha vimucya satarAM hi parArthasArtha saMsAdhanAya dadhate nijamAnasaM ye 5 svargApavargapadavIsamavAptimeSa kalpadrumo na dadate dhruvamarthito(s)pi dharmaH svabhAvasaralastu vivekabhAjAM tA lIlayaiva dadate(7)pi gataspRhANAM 6 vizvatrayI hitakatA prakaTIkRto yaH zrInAmibhUpatanayana jinezvareNa dAvAdibhedakalitAya namo(5)stu tasmai dharmAya bhUtighRtikIrtimatipradAya 7 lakSmIstaraMgataralA pavanaprakaMpa. zrIrakSapatranibhamAyurihAMgabhAjAM tAruNyameva navazArada sAMdhyarAga prAyaM sthirA sukRtajA kila kIrtireSA 8 'gaMgA'taraMgavimalena yazobhareNa dAnodbhavena kila kalpazatasthireNa ekatrilokamakhilaM dhavalIcakAra dhikkArakat'kali ripojagavivekI 9 cetaH prasIdatitarAM bhavataH pavitrI kareM javAdapi ca gacchati sarvaduHkhaM harSaH parisphurati sAdhujanasya samya gaggAkarNite (5)tra jagacarite prazaste 10 - fol. 3' ityAcAryazrIdhanaprabhagurucaraNarAjIvacaMcarIkaziSya sarvANada- .. mUriviracite zrIjagaDUcarite mahAkAvye vIyadRdhu()prabhRtipUrvapuruSavyAvarNano nAma prathama srgH|| - fol. 4. ityAcArya etc. up to mahAkAvye followed by 'bhadrezvarapuravyAvarNano nAma dvitIyaH sargaH // - fol. b ityAcArya etc. up to mahAkAvye followed by ratnAkara- .. varadAnavyAvarNano nAma tRtIya srgH| cha / - fol. 6deg ityAcArya etc. up to mahAkAvye followed by bhadrasura darzano nAma caturthaH sargaH // 7 // - fol. 8. ityAcArya etc. up to mahAkAvye followed by pIThadeva. .. narapatidarpavidalano nAma paMcamaH sargaH / / 35

Page #333
298 Jaina Literature and Philosophy [225. - fol. 124 ityAcArya etc. up to mahAkAvye followed by sakalajana saMjIbano nAma SaSThaH srgH|| Ends. - fol. 13* manye mohamahIpatiH svamanasi prApa pramododayaM jAtaH prauDhatarapratApavibhavaH prollAsakArI 'kli'| AtaMka bisa(bha)rAMbabhUva sutarAM dharmaratu solAtmaje svargastrIjanacittasaMmadakRti proccairabhAgyAd bhuvaH 37 tadvAMdhavo(vau) rAjakapadmasaMjJau gurogirA zokabharaM vimucya / bhUyo(s)pi saddharmavidhau dhurINo babhUvaturTUpatimAnanIyo(po) 38 khacchAradapAvaNedukiraNastomAvadAtasphurat / ___ kIrtizrIbharanirmalIkRtabhuvau zrIsaMghamukhyAvimau zrISeNa'hvaya sarirAjacaraNadvaMdvaikasevAparau zrImaddhI(vI)salasatkulaM cirataraM saMzobhayAmAsatuH 39 ityAcArya zrIdhanaprabhagurucaraNarAjIvacaMcarIkaziSyazrIsarvANaMdamUriviracite zrIjagaDUcarite mahAkAvye triviSTapaprApaNo nAma saptamaH srgH|| cha / Reference.- Published by M. D. Thakkhar from Bombay in A. D. 1896. Its Gujarati translation, too, is published. The text edited by Umangavijaya Gani is published by " Atmananda Jaina Sabha," Ambala in A. D. 1925. No additional Ms. is noted in Jinaratnakosa ( Vol. I, p. 128 ). jambUkumAracaritra Jambukumaracaritra [ jambUkumAracatuSpadI] [ Jambukumaracatuspadi] ___1609 (a) No. 226 1891-95. Size.- 101 in. by 4g in. Extent.- fol. 48deg to fol. 540; 14 lines to a page ; 40 letters to a line. Description. - Country paper thin, tough and greyish; Jaina Devanagari characters ; sufficiently big, quite legible, uniform and good hand-writing; borders rnled in two pairs of lines in black ink; numbers for verses and their

Page #334
226.] The Svetambaru Narratives 299 dandas written in red ink ; foll. numbered in the righthand margin ; the first as 48 and the last as 54; edges of a few foll. slightly gone; condition on the .whole tolerably good; complete ; composed in Samvat 1522; this Ms. contains an additional werk viz. namaskAraphala (2) which begins 5 and ends on the same fol. 54deg; it ends abruptly. Age.- Pretty old. Author.- Depala. For his additional works see pp. 234-235. Subject.- A life-sketch of Jambukumara, a Vaisya and the succe ssor of Sudharman Ganadhara. He is the last person to 10 have attained omniscience followed by salvation so far as the present avasar pini of India is concerned. His five births are here described. Begins.- fol. 48deg 550 // goyamagaNaharapaya namI / ArAhisu arihaMta / hRdayaka mali ahi(hani)si ca(va)sai / bhavabhaMjaNa bhagavaMta // 1 // bhavabhaMjaNa bhagavaMta tujha / ANa apaMDa bahesa / sIlasiromaNi guNa nilu / jaMbukumara ca(va)raNesu // 2 // 'magadha' desa 'raajgrhiiN| samosariyA jgnaaii| suravara iMdra milI racai / samosaraNa siNi ThANi // 3 // etc. Ends. - fol. 54b ha(haM) mUraSa matihINa / bhArI karamau huM acchu e| e peSI vairAga / pratibUghA je ihA nahI e // 77 // saMvata panara baaviis(1522)| ravi AsoI pUnimihi / bhaNai guNai naranAri / tihA mani upasamarasa rama e // 78 // kAvyaM // zrIjaMbusvAmI siddhigAmI bhavaha paMca taNau crii| upagArakArai budhisArai raciu depada papa karI // je bhAvi bhaNisii anai suNisii rahasya jANI ehnaa| jiNa ANa dharisii kSamA karisai kAja sarisiiM tehanA // 79 // 10 iti zrIjaMbUsvAmicaupaI smaaptaa|| zubhaM bhavatu || sA zrIvaMtavAcanAya vA mahimatilakagaNinA(5)lekhi // Reference. -- For extracts and additional Mss. see Jaina Gurjara Kavio ( Vol. I, pp. 40-41 ).

Page #335
300 1246. 5 I0 1 Jaina Literature and Philosophy [227. jambUkumAracaritra Jainblikumaracaritra No. 227 1886-92. Size-104 in. by 4; in. Extent.-- s folios ; 15 lines to a page ; so letters to a line. Description.- Country paper thin, tough and greyish; Jaina Deva. nagari characters with occasional TEATTIS; sufficiently big, quite legible, uniform and good hand-writing; borders ruled in two pairs of lines in black ink ; space between the pairs coloured red ; red chalk used ; foll. numbered in the right-hand margin; unnumbered sides are decorated with a small spot in red colour in the centre; the numbered in each of the two margins, too; condition very good; complete. Age.- Samvat 1556. Begins. - fol. 1' 550 // zrIgautamAya namaH // [ gaya goyamagaNaharapaya namI / ArAhI arihaMta / hRdayakamali ahanizi vasai / bhavabhaMjana bhagavaMta / 1 bhavamaNa bhagavaMta tujha / ANa akhaMDa bahemu / ... zIlazaromaNi guNanilu / jaMbukumara varNavesa(su) 2retc. Ends.- fol. 56 ima peSIya virAga / pratibUdhau jau hUM sahI e / jANIu kAmavizeSa / bhavya jIvA prativajhavai e // 61 / / saMbata panara bAvIsa (1522 ) / racIu o( A )so pUnimi iNa / bhaNaha gaNai naranAri / teha mani upazama dhyAna rahai e // 62 // kAvyaM / jeha bhAvi bhaNi / jaMbUsvAmI siddhagAmI bhavaha paMca taNU crii| ___upakArakArI buddhi sArI raciuM deSa(pa)I [dha pa karI // jeha bhAghi bhaNisiI anai suNiisaI / rahasa jANI ehnaa| jina ANa dharasaI / kSamA karisaI kAja sirisaI tehanAM // 63 // iti zrIjaMbUsvAmipaMcama(bhava)varNanacaritraM samAptaM // saMvata 1556varSe catravadi 2 gurau laSitaM // gaNizrIamarahaMsagaNitasiSyagaNivijayahaMsapaThanAthe laSitaM / leSakasyAmadAsabhagatIdAsena / / iti zreyaH / / zrIrastu[:] // kalyANamastu[:] graMthAgraM // 275 / / iti zreyaH / / shrii|| N. B. - For further particulars see No. 226. 20 - - -

Page #336
228. ] The Svetambara Narratives 301 jambUkumArarAsa Jambukumararasa No. 228 783. 1895-1902. Size.- 9 in. by 4i in. Extent.- 31 folios ; 15 lines to a page ; 30 letters to a line. Description.- Country paper thin, rough, tough and white; Jaina Devanagari characters; big, quite legible, uniform and very good hand-writing; right-hand and left-hand borders ruled in three lines in black ink and the upper and the lower borders in two in red ink ; edges, in one line in black ink; dandas, some words and the last 6 lines written in red ink; the numbered and the unnumbered sides as well are decorated with a design in the centre in red colour ; foll. numbered artistically in the right-hand margin; there is a beautiful design decorating fol. 31; condition very good ; complete; composed in Samvat 1738 at 15 Thirapura ( Tharad ) in 35 dhalas. Age.-- Samvat 1786. Author.- Nayavimala, pupil of Dhiravimala. He was born in V. S. 1694. He became a Jaina monk in V. S. 1702. Hem was given the status of pandita' in V. S. 1727 and that of suri' in V. S. 1748 or 1749. From this date he was named as * Jnanavimala Suri'. He died in V. S. 1782. His life-sketch is given in Jaina Gurjara Kavio ( Vol. II, pp. 308-310). As regards his additional works three are noted by me in Vol. XVII, pt. 4 as Nos. 1230, 1268 and 1314 respectively. They are balavabodhas of three Bhasas. The rest written in Sanskrit are as under : (1) gauti ETATS ( 2 ) TETIETOTIET 30 (3) marzita V. S. 1745 (4) #araranasait

Page #337
302 V.S. 1774 Jaina Literature and Philosophy [228 The following works are in Gujarati : (a) rAsa (4) (1) azokacandra tathA rohiNI (2) Anandamandiracanda kevalI v. S. 1770 (3) bAra vrata grahaNa (TIpa) V. S. 1750 (4) raNasiMha rAjarSi (b) devavandana (3) (I) gaNadharastava (2) divALI (3) mauna ekAdazI (c) svAdhyAya dazavidha yatidharma narabhavadaza dRSTAnta svAdhyAyasaMgraha (d) prakIrSaka kalpavyAkhyAna kalyANamandirastotra-gIto covIsI tIrthamAlA V. S. 1755 'padasaMgraha pandaratithi-amAvAsyA-stuti (16) 'zAntijinastabanAdisaMgraha sAdhuvandanA V. S. 1728 (e) bAlAvabodha of :(1) adhyAtmakalpadruma v. S. 1770 (2) AnandaghanacovIsI V. S. 1769 ) dIpotsavIkalpa ) dRSTivicArasvAdhyAya yogadRSTinI sajjhAya (5) navatattva V. S. 1739 (6) pAkSikasUtra V. S. 1773 (7) praznadvAtriMzikAstotra (8) zramaNasUtra v. S. 1743 (9) sAhI traNa so gAthAtuM stavana (10) mImandharajinastavana 1 For published works included heroin see Jaina Garjara Kavio ( Vol. II, pp. 334-336), 2-4 In prAcInastavanaratnasaMgraha we come across several padas, stutis, stavanas and svadhyayas. 5Saptijinastavana is composed in V.8.1736. V.S.1763 35

Page #338
303 228.] The Svetambara Narratives Subject.-- Life of Jambusvamin written in Gujarati. For details ___see No. 226. Begins.- fol. I // 16 // zrIgurubhyo namaH / duhaa| praNam pAsa jiNaMdanA / caraNakamala suSakAra / jaMbusvAmi taNo (ka) / sarasa kathA adhikAra // 1 // sIlavrata pahilI dharI / karapIData(Na) jiNa kIgha / rAgaThAmi bayarAgI(u) kaha kahANI kIdhe // 2 // etc. Ends.- fol. 30b tasa anusAri prabhavano | paMca sayAMne saadhi(thi)| le gaNatAM ima mileM / jaMbusvAmine hAtha // 8 // varSa paMcyAsIne mileM / saMjama jaMbU pAsi / vIsa varasa pachI AdayoM re prabhavo mana ullAsa / / 9 // ima bahu graMthi ehanau / vistAra adhikAra / mahAvideza(ha)mA sIjhase / prabhavo eka avatAra // 10 // daal| rAga dhanyAsI // zAMti jiNesarane / bhAmaNe jAuM e deshii|| dhana dhana munivara jaMbugayA / hu praNamuM tasa pAyA meN| kaMcana koDi kAmanI choddii| saMjamasyu mana lyAyA re // 1 // dhana // zIlavaMtazira muguTa birAjaita / jaga jasa va vA)da gaThA(vA)yA be| sobhAgi guNavaMta mahAmuni / nAme nava nidhi pAyA be|2|| dhana0 // 'tapagacchanAyaka zivasuSadAyaka / zrIvijayaprabhasUrIrAyA beN| jasa ANA manavaMchita pUraNa kalpatarunI chAyA ve ||3||dh|| vAraja vijayaratnasUrIsara / munijanane suSadAyA beN| jasa pratibhAsaMhanAda suNIne / vAdI hAri manAyA be // 4 // dh0|| tasa gaccha zobhAkAraka jANo / zrIvinayavimala kavirAyA be| 'kali' yugamA pUrabamuniopamA / zamarasapUrita kAyA baiM // 5||dh0|| saMprati vijayamAna tasa sevaka / dhIravimala kavirAyA be| tasa sevaka nayavimaleM matisyUM / jaMbU gaNadhara gAyA be // 6||dh0 // pAMtrise DhAle karI racIo / rAsa sarasa adhikArA be| zrotA janane atisaSadAyaka / 'ghI thI)rapura napari majhArA be // 7 // 30 // vasu kRzAnu jaladhi zazI (1738) varSe / eha racyo supramANe be| mArgazirSa sita terasiM divaseM / zamisuta va(vAra ) vaSANI be ||8 ghaon ehane suNi dRDha zIla je dhyAveM / tAsa janama mupramAraNa be| bhaNatA suNatAM maMgalamAlA / nitu nitu koDi kalyANa be||9|| 25 30 35

Page #339
304 Jaina Literature and Philosophy [ 228. dhana dhana munivara jNbuuraayaa| iti zrIjaMbUkumArarAsa saMpUrNa / sakalapaMDitottamapaMDitazrIpazrIbhAvadhijayagaNiziSyapaMDitazrIpazrIrAmavijayagaNiziSyapaM rAjavijayagaNilaSitaM saMvat 1786 varSe zAke 1652 prarvatamAMne vaizASamAse suklapakSe 13 ravivAsare zrInavalapaprazAdAt zrI'dIva bNdire|| yAdRzaM pustakaM dRzvA tAsaM laSItaM myaa| yadi zudhamasudhaM vA mama doSo na dIyate // 1 // zubhaM bhavatuH zrepaM bhavatuH kalyANaM bhavatuH / iti zreyaH // Reference. - Published in "Dayavimalaji Granthamala" as No. II. For extracts and additional Mss. see Jaina Gurjara Kavio (Vol. II, pp. 315-318). 10 20 jambUkumArarAsa Jambukumararasa No. 229 30. 1877-78. IS Size.- Io in. by 4g in. Extent.- 37 folios ; 11 lines to a page ; 36 letters to a line. Description.- Country paper thick, tough and white; Jaina Deva nagari characters; big, perfectly legible, uniform and beautiful hand-writing ; borders ruled in two lines and edges in one in red ink ; almost the whole of the first line, dandas etc. written in red ink ; foll. numbered in the right-hand margin; fol. 1 blank ; so is fol. 379; condition very good ; complete. Age.- Sarivat I766. 25 Begins.- fol. 10 e6 // sakalabhaTTArakapuraMdarazrI108zrIjJAnavimalasUrIzvaragurubhyo namaH // duuhaa|| praNamI pAsa jiNaMdanA etc. as in No. 228. Ends.- fol. 360 tasa anusAraI prabhavana I etc. up to zazIsuta vAra vAMNi be | // 18 // dhana|| as in No. 228. This is followed by the lines as under :

Page #340
230.] The Svetambara Narratives 305 kuzalavijaya paMDita saMvegI / tAsa kahaNathI kIgho the| jaMbUsvAmi taNo lavalezai / e saMbaMdha prasIdho ve ||19||dh0|| yaha nisuNI dRDha zIla je thAvai / tAsa janama supramANa the| bhaNatAM suNatAM maMgalamAlA / niu nitu koDi kalyANa be||20|| dhana dhana jabU munivararAyA be|| iti zrIjaMbUkumArarAsa saMpUrNa / / saMvat 1763varSe / posavadi dvitIyA / / N. B.- For additional information see No. 228. jambUsvAmikathAnaka Jambusvamikathanaka No. 230 1608. 1891-95. 10 Size.- Iog in. by 4g in. Extent.-- 10 folios ; 15 lines to a page ; 40 letters to a line. Description.-- Country paper thin, tough and greyish ; Jaina Deva nagari characters with occasional geala ; sufficiently big, quite legible, uniform and very good hand-writing%3; tara borders ruled in two pairs of lines in black ink ; red chalk used ; foll. numbered in the right-hand margin; there is some space kept blank in the centre of the numbered and the unnumbered sides as well so that it forms as it were a pattern ; strips of paper pasted to some of the foll.; condi* 20 tion on the whole tolerably fair ; incomplete ; this Ms. ends with a portion of the seventh sub-story, the last com. pleted being vAnaravAnarIkathA. Age.--- Not modern. Author.- Not known as the work ends abruptly. 25 Subject.- A life-sketch of Jambukumara, the foremost disciple of Sudharman Gasadhara in Gujarati. This work begins with a verse in Sanskrit. Begins.- fol. ! | 60 // OM namo siddhaaN|| saprabhAvaM jinaM natvA / pAva sU(su)redravaditaM / liSite svopkaaraay| jaMbUsvAmikathAnakaM // 1 // trailokyanAyaka sakalasaukhyadAyaka / sarvapApakSayaMkara / cuvIsamu tIrthakaru / zrImahAvIra syAhAra karatA etc. 30

Page #341
306 Jaina Literature and Philosophy [230 Ends.- fol. 6deg e dhAta sAMbhalI rAjA rIsAbiu / rAjAijaNanai Adeza diidho| rANI putAra hAthI' / paravata vaDAvI DholI lASauM| etalai loke rANI putAranai jIvitavya divarAviuM / It ends thus abruptly. IO 5 jambUsvAmirAsa Jambusvamiraga No. 231 317. 1883-84. Size - 10 in by 4} in. Extent. -- 37 folios ; 17 lines to a page ; so letters to a line. Description.- Country paper thin, tough and greyish ; Jaina Deva nagari characters; small, quite legible, uniform and good hand-writing; borders ruled in two lines in black ink : numbers for verses, their dandas as well as some words and lines, too, written in red ink ; foll. numbered in both the margins 3; fol. 10 blank ; so is fol. 370; edges of several foll. partly gone ; the last fol. slightly torn; condition on the whole tolerably good ; complete ; composed in Samvat 1714 at Sara(?i)sa at the instance of Budaisaha; extent ISII slokas; in the left-hand margin the title is written as jaMbUcau0 20 Age.- Sarivat 1817. Author.- Padmacandra, pupil of Padmaranga. Subject. -- A narrative of Jambukumara based upon Parisistaparvan. Begins.- fol. 10 e0 zrIvItarAgAya namaH // dohaa|| sAradapaya praNatuM sadA / kavijana kerI mAta / mUrapaSI paMDita kre| kAlidAsa viSpAta // 1 // zrIjinakuzalasuriMda guru / simaro hau nisadIsa / duSa dohaga dUre hare / praNamatAM mujagISa // 2 // etc. _Ends.- fol. 360 30 jaMbUsvAmi taNo guNa gAthA ANI haraSa apAro re| jaMbanAma naba nidhi milai balI lahIye sivaraSa sAro re // 1 // . //

Page #342
23. The Svetambara Narratives 307 10 15 bAlabrahmacArI havo iNa sama aura na kohre|| nAma japaMtA ehano manabaMchati suSa hoi re // 2 // 0 // Aja divasa dhani mAhage Aja saphala avasAro re|| ciMtAmanI surataru phalyau mai guNa gAyA ika tAro re // 3 // 0 // pariziSTaparvartha(thI) Udhariu eha saha adhikAro re|| kevalagyAnIya iM bhASIyo ihAM kUDa nahI lagAro re // 4 // j0|| saradahijo sUdhai manai mata karijyo koi saMdeho re|| saMdeha karisai ja sahA (hI) te dUragati lahai nisadeho re // 5 // j0|| saMvatta satarisai caudhotare (1714) kAtI mAsa udAro re / / sukala pakSa terasi dine e kIyo carita suvicAro re // 6 // j0|| sarasA 'pATaNa' paragaDo jihA zrIAdijiNaMdo re|| teha taNe parasAdIM graMtha kIyo ANaMdA re / / 7 // j0|| zrI svarataragaccharAjIyo zrIjiNasiMhasuraMdo re // gaccha corAsI seharo hUyA jANi diNado re // 8 // 0 // pAtasAdi akabara rAjitai 'kAsamIra desa majhAro re / / amArI palAvI tihAM kaNai sarva jIvAM hitakAro re // 9 // ja0 // daM(de)sa caupaDe ravI smo| cAMpasI sutna siradAro re / / cAMpalade dhana janamiyo / puruSaratana gaNadhAro re // 10 // ja0 // tasu pATe surtrusmo| shriijinraajsuriisore|| sakalapATaprabhAkara diipto| jANe visavA vIso re // 11 // j0|| tasa laghu baMdhava dIpato / padamakIrati suSakAro re / / tAsu sIsa guNe vilau / AgamanA bhaMDAro re // 12 // j0|| cavada vidyA karI sobhatA / mahimA 'mera' samAno re|| padamaraMgaguru ciraMjIvo / jAM lagi dhru sasi bhAno re // 13 // j0|| padamaraMga munivara kehai / e sabaMdha rasAlo re / je naranArI sAMbhalai / tihAM gha(ra)ghari maMgalamAlo re // 14 // 0 // vartamAnagaccharAjIyo / zrIjiNacadariMdo re // kIrati mahIyala vistarI / praNamai naranA vRMdo re / / 15 / / 0 // teha teNe vAra karI | caupaI mohanabelo re|| caturAMgana mohaNa bhaNI / kIdhI mananI kelo re // 16 // j0|| bhaNajAM guNatAM pahane / lahIyai liilvilaasore|| sAMbhalatAM riddhi siddhi havai / saphala hove mana aasore||170|| naranArI bho(bhA)ve karI / je pragama nisadIso re|| iNi bhava jasa sobhA lahai / bali prabhave saMgha jagIso re // 18 // ja0 // 20 25

Page #343
5 10 IS 20 25 30 308 Jaina Literature and Philosophy [ 231. - fol. 372 vUDesAhanai Agraha karI / carita kIyAM subadAi re // suNatAM nai bali vAcatAM / riddhi vRddhi va (ba) hu thAi re // 19 // jaM0 // carama kevala ethayo / jANe sahu saMsAro re || padamacaMda munivara kahe / sayalasaMghaSakAro re // 20 // jaM0 // iti zrIjaMbUsvAmIcApai samAptaM // sarvagraMthAgraMtha // 1511 // saMpUrNa // saMvatta 1817 varSe phagaNavadI trodasI maMgalavAsire 'karma'thAnake / lipyattaM dAnIrAyajI aNagAra zrI zrI zrI pU (pu) jyajIrAmarAyajI praha (bha) NA artha || // zrI // 6 // zubhaM bhavatu // 6 // 6 // For extracts and additional Mss. see Jaina Gurjara Kavio (Vol. II, pp. 155-157 & Vol. III, pt. 2, p. 1203). Reference. jayantavijayakAvya No. 232 Size. 103 in. by 58 in. Extent. so folios; 16 lines to a page; 45 letters to a line. Description. Country paper thick, tough and white; Jaina Deva-nagari characters; sufficiently big, quite legible, uniform and very good hand-writing; borders ruled in three lines and edges in one in red ink; puspikas (post-colophons ) at the end of the sargas written in red ink; foll. numbered in both the margins; fol. 1 blank; so is fol. 5ob; in the lefthand margin the title is written as jayaMta kAvya; condition very good; complete; 19 sargas in all; the extent of each of them is as under : Sarga I foll. 1b II "" dw rd 13 33 "" 19 "} III IV V VI VII VIII IX "" dw "" r d "" dr 17 to foll. 3b 56 8* 10a 132 16 18b 22a 3 to 5b to 8. to 10a to 13* to 16a to 18b to 22a to rw "" "" dw dr " 31 >" 24 Jayantavijayakavya 1368. 1891-95.

Page #344
309 a " / IS 232.] The Svetambara Narratives Sarga x foll. 24deg to foll. 260 , XI , 26deg to , 280 ___XII , 29deg to , 30deg , XIII , 30deg to , 34. XIV , xv , 37deg to " 39deg ,, XVI , 39deg to , 420 , XVII , 42 to , 44b ,,XVIII , 44 to , 47* ,, XIX ,, 47*_to , 49. 10 Total extent 2200 slokas ; composed in Samvat 1278. Age.-- Not modern. Author.- Abhayadeva Suri, pupil of Padmendu, pupil of Jina sekhara. He does not say that he belongs to the Khara tara gaccha. Subject.- A life-sketch of Jayanta. Begins.- fol. b e 6 0 aI namaH // zreyAMsi vizrANayatAdajasraM nAbheyadevasya padAMbujaM vaH samastasaMpanmadhuraddharAgA yatra trilokI bhramarIva bhAti // 1 // zazvaccaturvargaphalaiH phalaMtI kalpadrumasyApi yadahibhaktiH saubhaagybhNgiimdhriikroti| zAMti ti) sa va zAMtijinastanotu // 2 // etc. - iol. 3' iti zvetAMvarazrImadabhayadevAcAryaviracite jayaMtavijayanAmni mahAkAvya 'bhI'zabdAMke prastAvanAdisvarUpaNaH prathamaH sarga // 7 // - fol. 5' iti zvetAMbarazrImadabhayadevAcAryaviracite jayaMtavijayanAmni mahAkAvye 'zrI'zabdAMke putraciMtAdisvarUpavirUpaNo nAma dvitIyaH srgH|| // 7 // 2 // 30 fol. 8. iti zvetAMbarazrImadabhayadevAcAryaviracite jayaMtavijayanAmni mahAkAvye 'zrI'zabdAMke namaskAraprabhAvavarNanastRtIyaH sargaH // 7 // 3 // - fol. 10' iti zvetAMbarazrImadabhayadevAcAryaviracite jayaMtavijayanAmni mahAkAvye 'zrI'zabdAMke 'surayogI(gI)dravijayazcaturthaH sargaH // 5 // 5 // 4 //

Page #345
30 Jaina Literature and Philosophy 232. 10 - fol. 13" iti zvetAMbara bhImadabhayadevAcAryaviracite jayaMtavijayanAmni mahAkAvye 'zrI'i.bdAMke yogIMdrasvarUpanirUpaNA paMcama sargaH // 7 // 5 // fol. 16- iti zvetAMbarazrImadabhayadevAcAryaviracite jayaMtavijayanAmni mahAkAvye ('zrI')zabdAMke putrajanmotsavaH SaSThaH sargaH // // 6 // fol. 18' iti zvetAMbarazrImadabhayadevAcAryaviracite jayaMtavijayanAmni mahAkAvye 'zrI'zabdAMke vasaMtavarNanaH saptamaH sarga // 7 // - fol. 22* iti zvetAMbarazrImadabhaya devAcAryaviracite jayaMtavijaya[tavijaya] nAmni mahAkAvye 'zrI'zabdAMke dolAvilAsapuSpAvaca jalakelimaryAstacaMdro dayo'STamaH sargAH // 8 // - fol. 240 iti zvetAMbarazrImadabhayadevAcAryaviracite jayaMta mahAkAvye 'zrI'zabdAMke dUtoktivarNano nAma navamaH sargaH // 7 // 9 // fol. 26deg iti zvetAMbara0 'zrI'zabdAMke harirAjaparAjayo mAma dazama(:) sargaH // // 10 // - fol. 28" iti zvetAMbara 'zrI'zabdAMke digvijayo nAma ekAdazaH sargaH // // // 11 // -- fol. 30deg iti zvetAMvarazrImadabhayadevAcAryaviracite jayaMtaviyanAmni mahAkAvye 'zrI'zabdAMke kumAradharmapratipattivarNano nAma dvAdazaH sargaH // 12 // -- fol. 34a iti zvetAMbarazrImadabhayadevAcAryaviracite 'zrI' zabdAMke vivAho sabavarNanastrayodazaH sargaH // 13 // -- fol. 37' iti zvetAMbarazrIma0 divyAstra(strA yudhavarNano nAma caturdazaH sargaH // 7 // 14 // -- fol. 39' iti zvetAMbarazrImadabhayadevAcAryaviracite nareMdrasamyaktra(ktva). pratipattivarNano nAma paMcadazaH sargaH // 7 // (15 // ) -- fol. 42deg iti zvetAMbarazrImadabhayadevAcArya 0 'zrI'zabdAMke svayaMvaravarNano nAma poDazaH sargaH // 7 // 16 // -- fol. 440 iti zvetAMbarazrImadabhayadevA0 'zrI'zabdAMke nareMdrapUrvabhavavarNano nAma saptadazaH sargaH // 7 // 17 // -- fol. 47* iti zvetAMbarazrImadabhayadevAcAryaviracite jayaMtavijayanAmni mahAkAvye 'zrI'zabdAMke RtutrayavarNano nAma aSTAdazaH sargaH // 5 // 18 // Ends.- fol. 490 trailokyaM lalitairyazobhi .... .... yat pUryate dehinAM / _____ kAyaH kAMta guNAnubaMdhamadhuraiH zvetAMzuzubhrerguNaiH / / yacca zrIjinazAsanonnatinaTInATyapramodairmana stanmanye zubhapAtradAnasakRtaprAgbhAravirarjitaM // 85 // 30

Page #346
232.] The Svetambara Narratives ____10 iM(i)tyaM(tthaM) naMdopaniSadudayAta svAnubhUtaprabhAvaM / ___stAva stApaM munidhitaraNaM bhaktisaMdarbhagarbha // sArasabai gururiva janaM tatra sotktthmuccaiH|| 'kurda(1) ubImabanitilaka zrIjayaMtaHprazAsti / 86 / / iti zvetAMvarabhImadabhayadevAcAryaviracite jayaMtavijayanAmni mahAkAvye 'zrI' zabdAMke nareMdrarAjyasthitivarNano nAma ekonaviMzA sargAH // 7 // 19 // graMthAgraMtha 2200 // 5 // e // 6 // AsIcaMdrakulAMbarAMbaramaNiH zrIvarddhamAnaprabhoH / pAdAbhoruhaci(ca)cirIkacaritazcAritriNAmagraNIH / / sa zrIsUiijanezvarastripathagApAya:(thaH)pravAhariva / . svaraM yasya yazobhatrijagataH pAvitryamAsUtritaM // 1 // abhavadabhayadeva mUrirasmAt sa yasya / prabhuramajata topa 'staMbhane' paarshvnaathH|| prakaTitadhika(TArthI saMghasAmrAjyavRddhaye / vyadhita nidhisamAnAM yazca vRtti nyaaNgyaaH||2|| tacchiSyau jinavallabhaH prabhurabhUt vizvaMbharAbhAminI____mAsyadbhAlalalAmakomalaya zastomaH shmaaraambhuuH|| yasya bhInaravarmabhUpatizirakoTIraratnAMkura jyotirjAlajalerapuNyata sadA paadaarviNddvyii[:]||3|| 'kazmIrAnapahAya saMtahimavyAsaMgavairAgyataH / pronmIlaguNasaMpadA paricite ysyaagypNkeruhe|| sAMdrAmodataraMgitA bhagavatI vAgade(di)vatA tasthuSI / 'bhArA'lAmalamadhyakAvyaracanAvyAjAdanRtyazciraM // 4 // bhaMgastadaMDikamale jinshessraatH| pUristapaHprazamammitakAyayASTiH // jigye jagatra(gha)yajayaprayato()pi yena / vIravana kalayatA ratijIviteza : // 5 // bairAgyaM yAti rAge bhajati vidhuratAM krodhayodhe vimaane| ___ mAne naSTAmimAne kapaTapa(da)bhaTe kSobhamApte ca lobhe / / paMceSo kuMciteSau samiti nijAmati prekSya sainya sadainyaM / mukanyA yeSAM jayAzAM nibhRtamapasRtaM moharAjena dUraM // 6 // praguNitakaruNaH kSamayA virAjita zvAruvigrahastadanu / ajati vazIkRtaviSayagrAmaH pAdamunirAjaH // 7 // 1 The correct reading is : kurvamI0 .

Page #347
5 10 IS 20 25 312 jayantavijayakAvya No. 233 Jaina Literature and Philosophy utphullumallIpratimallakAMtiH / kIrtti ()maMta bhuvaneSu yasya // zriyA samaM sauhRdakAMcaitra / muSNAti viSNorapi kRSNabhAvaM // 8 // vibhvatra (a) prathi(ta) kIrttilatasya tasya / ziSTAH prazastha mahimA (S) bhayadevasUriH // kAvyaM jayaMtavijaya racayacikAra / Reference.- Published in Kavyamala as No. 75 in A. D. 1902 and also by the Jaina Dharma Prasaraka Sabha. In Jinaratnakosa ( Vol. I, p. 133 ) it is said that this poem consists of 21 Here additional Mss. are noted. cantos. sArasvataprasRmarapratibhAvilAsaH // 9 // vikkarikula giridinakara (1278) parimitavikramanarezvarasamAyAM / dvAviMzatizatamAnaM zAstramidaM nirmma (mmi) taM jayatu // 10 // jayaMta (vijaya) kAvyaM paripUrNa // [232. 1 Instead of 21 it ought to be 19. Size.-- rog in, by 4 in. Extent.--- 73 folios ; 13 lines to a page ; 35 letters to a line. Description.- Country paper thick, tough and white ; Jaina Devanagari characters; big, perfectly legible, uniform and very good hand-writing; borders of only a few foll, ruled in three lines and their edges in one in red ink; foll. numbered in both the margins; fol. 1 blank; so is fol. 73deg; in the left-hand margin the title is mentioned as zrI ja0 kA0, zrIjayaMtakAo etc. ; edges of the last two foll slightly gone ; condition on the whole very good; complete ; 19 sargas Jayantavijayakavya 1248. 1886-92.

Page #348
233. ] The Svetambara Narratives 313 in all ; the extent of each of them is as under :-- Sarga I Verses 72 foll. 10 to 46 Ilu 52 , 46 to 7 III >> 102 ,, ga to 10b IV 69 106 10 14" ,, V ,, . 73 , 14to 170 VI ,, 103 17a to 226 VII 78 226 VIII 76 IX , byby bybybybyby :00 bybybybyby bys to 38 XI 389 XII XIII ,, XIV ,, UI XV S4 to XVI XVII XVIII 68 >> 64 XIX 86 688 Age.- Samvat 1949. Begins.- sol. 1140 I STEFA: zile la atingaiqaj etc. as in No. 232. Ends. fol. 72 hari ini tirh etc. up to si tja: gira as in 25 No. 232. This is followed by the lines as under :-- prati zvetAMbarazrImadabhayadevAcAryaviracite jayaMtavijayanAmni mahAkAvye 'zrI'zabdAMke nareMdrarAjyasthitivarNano nAma ekonaviMzaH sargaH // 7 // graMthAnaM R?? ! Then we have : r azpzigratafo: etc. up to STIETIA CAMPAR HOTI ? 1180 11 as in No. 232. This is followed by the lines as under :40 (J, L. P.) 30

Page #349
5 15 20 25 30 314 Jaina Literature and Philosophy 7 // jayaMtakAvyaM paripUrNamiti bhadram || 6 || saMvat 1488 varSe azvini zudi 5 paMcamyAM budhavAsare'yeha zrI ' pattana'vAstavya lekhaka pRthvIdhareNa jayaMtakAvyaM likhitamiti bhadram // // zrI // zubham // lIpIkRta laI prIroyata punamacaMda rAmakIsanajI bhA(vA) sI 'nAgoranA 'amadAbAda' madhA saMmatta 1949 rA // N. B. For other details see No. 232. Size-- rog in by 4g in. 10 Extent. 17 folios; 15 lines to a page; 32 letters to a line. Description.- Country paper thick, rough and white; Jaina Devanagari characters; big, quite legible, uniform and good hand-writing; borders ruled in three lines and edges in one in red ink; numbers for verses and dandas written in red ink; foll. numbered in the right-hand margin; fol. 17 blank; edges of the first fol. slightly gone; condition on the whole good; yellow pigment used for making corrections; white pigment, too; complete. jaya vijayakathA No. 234 Age.--- Pretty old. Author -- Not known. Begins. fol. r* Subject. A story of Jaya and Vijaya. It points out the prowess of the right faith. atrAbhUd 'bharate' bhUribhUtibhirbhArite bhitaH // svaspaddhiRddhibhirvizvAnaMdi 'naMdipura' puraM // 1 // Ends.- fol. 17" [233. Jayavijayakatha 1249. 1886-92. dathye daurbhAgya durbhikSadukkhakkhayabhayAdayaH // sarva saMpatpade yatra | sTyAdiSveSa jajJire // 2 // etc. prapUrNa varSa lakSAyuvira mukhya vihArataH / so (S) dhyAsta siddhi sArddha taiH sadarzanaphalAm hoH // 71 //

Page #350
235.] The Svetambara Narratives 315 ArAdhane(5)tha dRDhatA viSaye phalasya prAptAbapIti vijayasya jayasya coccaiH / / zrutvA sudarzananidarzanamadbhutaM bhaaH| ___bhavyA ! sudarzanavidhI vivivad yatadhvaM // 472 // iti samyakta ktva viSaye jayavijayakathAnaka samAptAH // 31. 10 jayavijayarAsa Jayavijayarasa No. 235 1877-78. Size.--9 in by 4, in. Extent.-- 30 folios; 14 lines to a page ; 26 letters to a line. Description.- Country paper somewhat thick, tough and white ; Jaina Devanagari characters; big, quite legible, uniform and very good hand-writing ; borders ruled in three lines and edges in one in red ink ; foll. numbered in the righthand margin ; fol. 1 blank; dandas written in red ink; Is condition very good ; complete; composed in Sarivat 1734 at Dasada ; the entire work is divided into four adhikaras; the extent of each of them is as under:-- Adhikara I foil. b to 8 II , 8 , 140 , III ,, 14b, 22 , IV , 220 ,, 30'. Age.- Sarivat 1744. Author.- Jinavijaya, devotee of Kirtivijaya. Subject.- A life-sketch of Jaya and Vijaya in Gujarati in verse. 25 It is based upon a commentary on Pratikramanasutra. Begins.- fol. 10 // 60 / / sakalapaDitazrIvIrasaubhAgyagaNigurubhyo namaH // dUhA / / Adi AdijiNesarupaya praNamI suvilAsa / / yugalAdharma nivArinaiM / kIdho dharmaprakAsa // 1 // suSakara sAhiba shaaNtijii| praNamI puNyaaMkUra // nAma japaMtA jehanaM / bhaya nAsai savi dUra // 2 // etc. 20

Page #351
316 Jaina Literature and Philosophy [235. - fol. 8 iti zrIsamyaktvAdhikAre jayavijayakuMaraprabaMdhe nijagahAnirgamana - vijayarAjyAptivarNano nAma prathamo'dhikAraH // - fol. 14" iti up to prabandhe followed by gatavastutryaprAptivarNano | nAma dvitIyo(dhikAra(:) - fol. 22' iti up to prabandhe followed by bAMdhavadvayamilananijagRhAgamana (kha)DatrayasAdhano nAma tRtIyo(s)dhikAraH sNpuunnnn(:)||3|| Ends.-- fol. 30* zrIpaDikamAsUtranI vRttimA e adhikAra vaSyANyo re tihAMthI joIni mai saghalA IhAM e saMbadha ANyo re 4 sa. jIbha taNaI vasio banu adhikauM je mhaiM ihAM bhASyure zrIsaMghasArSi teha taNo hu~ micchA mi dokvaDaM bhASNu re 5 saM0 graMthAgara anumAne kIdho sAta sayA pacavIso (725) re / laSI lapAcI sAdhu suzrAvaka suNatAM adhika jagIso re // 6 // saM0 saMvata satara cotarIsA (2734 ) varase nayara 'dasADA' mAhiM re| rAsa racyo maI samakita upari zrIzAMtinAthasupasAI re / / 7 // saM0 'tapa'gacchanAyaka sariziromaNi zrIvijayaprabhasUrirAyo re / puNyapratApI jasa jagi vyApI sakalamUrisavAyo re ||8||sN. zrIkalyANavijayavAcakanA sevaka zrIdhara vijaya uvajjhAyo re| tasa bAMdhava zrIvimalavijaya budha nAmaI nava nidhi thAyo re / / 9 // saM0 tasa sIsa pAData mAhi sohaI kIttivijaya bugharAyo re / tasa sevaka iNI pari bolaI e suNatAM saMpada thAyo re ||10||sN0 bhaNaiM gaNaI jeha sAMbhalai nabi nidhi hoi tasa gehiM re| jinavijaya kahiM sAMbhalo e adhikAra sanehiM re // 11 // iti zrIsamyaktvAdhikAre jayavijayakuMAraprabadhe upasahanasiddhigamano nAma caturthoM(5)dhIkAra saMpUrNaH graMthAgraMtha 725 saMvat 1774 varSe Aso mudi 13 guruvAre mahopAdhyAyazrI185zrIiMdrasaubhAgyagaNiziSyapaMDitazrI5zrI. vIrasaubhAgyagaNiziSya munipremasAMbhAgyena likhitA(s)sti zrI suhAlA grAme Reference. -- For extracts and additional Mss. see Jaina Gurjara Kavio ( Vol. II, pp. 297-299 & Vol. III, pt. 2, p. 1289).

Page #352
10 is 236.) The Svetambara Narratives 317 jayAnandacaritra Jayanandacaritra 32. No. 236 1877-78. Size.-- 9in. by the in. Extent.- 71 folios ; 11 lines to a page ; 32 letters to a line. Description.- Country paper thick, tough, and white ; Jaina Deva nagari characters with occasional qarIS ; big, quite legible, uniform and very good hand-writing; borders ruled in two pairs of lines in black ink; red chalk used; foll. numbered in the right-hand margin ; fol. a blank; so is fol. 710; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; yellow pigment used while making corrections ; edges of a few foll. slightly gone; condition on the whole good ; complete ; composed in Samvat 1632 at Bareja; the entire work is divided into five ulla as; the extent of each of them is as under:Ullasa I foll. 10 to 166 I 166 ,, 322 o 329 , 4765 IV 470 624 >> 624 71*. Age. - Samvat 1686. Author.-- Vana Kavi, a Jaina layman and a devotee of Vijaya nanda Suri. Subject.- A life-skeich of Jayananda Rajarsi in verse in Gujarati. There are substories. Begins. --- fol. 1b yQ011 agnetyhillaTAFETT AA: 11 ata! zAMti jinavara zAMti jinavara namIya bahubhatti ! zrIsArada samarI sadA karuM caritra mani raMga ANIya jayAnaMdaguNa varNa, zrIvijayAnaMdaguru lahIya vANIya / tAsaM(sa) taNai supasAulai huu mani ulhaas| sarasa kathA suNayo sahu jima mani puhacAi Asa // 1 // 20 25 30

Page #353
5 10 IS 20 25 30 318 Jaina Literature and Philosophy cUhA // brahmANI u ( tuja ) banavu / Ape mati tuM mAya ! || mujha mana AnaMda Upano / gAMuM jayAnaMdarAya || 2 // etc. - fol. 162 iti zrIvAnAkaviviracite zrIjayAnaMdarAjarSirAsaprabaMdhe aNibhavacaritravarNana dharmaprAptisomabhI makathAnaka videsagamana haMsa kAkanidarzana 'vizAlapurI' kalA grahaNakanyApariNayanamahAsenacaMDa senapallI jayasiMghasAramocana tathA saMgharAjyasthApana / netraniSkAsana giriDAkiNI devIpratibodhanavIna netraprApti' hemapurA gamanadyUtajayarAjaputrIpariNayanaprathamolhAsaH samAptaH // za - fol. 31deg iti zrIvAnAkaviviracite zrIjayAnaMdarAsa prbNdhe| naravIrahariarratra | kSetrapAlapratibodha auSadhIpaMcaprApti 'padmapura' gamana bhI lavesakaraNavaizramaNaveSadhAraNanATikakaraNakanyAcyArapANigrahaNavarNano dvitayollAsaH [236 samAptaH / / 6 / / 270 // fol. 47deg iti zrIvAnAkaviviracite / zrIjayAnaMdakecalIrA saprabaMdhe strIcarivopari madanadhanadakathAnaka kamalaprabhapadmarathayuddhAdhikArapadmarathapratibodhanakamalasuMdarIpANigrahaNa | 'lakSmIpurikanyAtrikapariNayana / saMghasArarAjyasthApana | rAjAzrIdIkSAgrahaNamokSaprApti / triSaMDasAdhanaM / vijaya suMdarI - caritrAdivarNano tRtIyollAsaH samAptaH // 284 // 6 // fol. 61 iti vAnAkaviracite / zrIjayAnaMdakevalIrAsa prabaMdhe / vajravega mocana | caMdravegavanitAvAlanaM / desalakosalacaritraM / bhogasuMdara vajrasuMdarIkaragrahaNaM / cakrasuMdarI apaharaNaM / saMgrAmavarNano nAma caturthollAsaH samAptaH // 244 // 6 // Ends.- fol. 71* tiNai guru graMthaja kIdhA ghaNA / kahatAM pAra na Avai teha taNA / zrI jayanadanuM caritaja sAra / kIdhuM zAsananai hitakAra // 54 // ATha sahasate kI balI / te vAcai sahudda mani rulI / paTi eksaTTimai udau bhANa / zrIvijayANa guru guNanI SANi / / 55 / / tasa mukhakamalathIe lahI bANi / maI rAsa kyoM sahI jANi / 'bArejA' vara nagara majhAri / alpabuddhi kyoM guruAcAri // 56 muraSa mAtra huM jANaM nhiiN| sahaguruvacane zakti jathaI // bhAi guNai tasa navai nighAna / harSa dharI kavi bolai vAna // 57 // jihAM mahIali dharai valI 'mera' / numaMDala cAlai nahIM sera | jihAM lagaI tArA nai ravi caMda | tihAM lagi rAsa karo AnaMda // 58 //

Page #354
237.] The Svetambara Narratives 319 vastu pAMca cupaI kahuM valI / nava saI paMcyotari (905) mananI rulii| dUhA bisaI satAvIsa joi / bArasaI sAta te pUrA hoi // 59 // e kIdho maI mananaI koDi / saraSAsaraSI joyo joddi| vidhudha paro karejyo sahI / kara joDInaiM vANI kahI // 60 / / saMvata 16 sola vyAsIi (1682) jANi | posa sudi terasi caDhiu5 / ghamANa vAra gurau sarvAkajasAra / bhaNai guNai tasa jaya jayakAra // 61 // iti zrIjayAnaMdacaritre rAsaprabaMdhe / vAnAkaviviracite / cakrAyudhadIkSAgrahaNamokSaprAptizrIjayAnaMdarAjyapAlanadIkSAgrahaNanirvANagamano paMcamolAsaH samAptaH // ullAsa 5||pr0248 dvi0 270 tri0 284 ca0 244 10 paM0 161 evaM sarvoke 1287 // zubhaM bhavatu lekhakapAThakayoH // Reference.- Published in Ananda Kavya Mahodadhi ( Vol. III, pp. 106-210 ) in A. D. 1914. Extracts from this very Ms, are given in Jaina Gurjara Kavio (Vol. I, pp. 542-544). Here, on p. 548 it is said that this Ms. seems to be written 15 by the author himseli. 20 25 jAmbuvatIcaritra Jambuvaticaritra No. 237 696. 1892-95. Size.- 10 in. by 41 in. Extent. - Is folios u lines to a page ; 26 letters to a line. Description.- Country paper thick, rough and greyish ; Jaina Devanagari characters; big, quite legible, uniform and very good hand-writing ; side-borders ruled in three lines, upper and lower borders in two lines and edges in one in red ink ; numbers for the verses, dandas etc. written in red ink; foll. numbered in the right-hand margin; fol. 1* blank; so is fol. 15b; a bit of white paper pasted to fol. 1b; condition on the whole very good ; complete. Age.- Samvat 1835. Author.- Surasigara alias Suraji of the Ancala gaccha. He is the author of Liladhara rasa. Subject.- A narrative of Jambuvati, one of the queens of Lord Krsna in Gujarati in verse. 30

Page #355
to 15 25 320 Begins fol. rb 60 // zrIsadagurubhyo namaH // Ends. -- fol. 14b Jaina Literature and Philosophy pahilI DhAla vadhAvaNu / jAMmotI adhikAra // jama rAjArI kumarI: / sIlavatI suSamAla // 1 // sIlasarovara suMdarIH / rUpe adhika rasAla // te jAMbotI jAMNIye | uparaNe kisana murAra // 2 // etc. jAba DikathA No. 238 jAMbhavatIjA gayA / kaliMmai rahyA zrIdInadayAlaka | sUro (ra) sAgara ima bhaNe / mhe guNa gAyA rAvale parasAdaka || 57 hu0 // iti zrIjaMbavatIrI copaI saMpUraNaM // saMvat 1835 varSe mAsottamapoSamA se zuklapakSe 2 titho zanivAre liSataM mAhAraSa kisoracaMdajI - celA tilAkacada || zrIrastuH // kalyANamastuH // zrI // suzrAvakAM punyaprabhAvikadevagRrubhaktakArakAdharamamUratavahaMjImenAMjIpaTanAthaiH // zrI // for pAthI premasuH munirAja hitakAraH / muSajayaNAkara vAcasyoM tA karasyo para opagAraH // 1 // Reference. For extracts and additional Mss. see Jaina Gurjara Kavio ( Vol. llI, pt. 2, p. 1217 ). Extent.-- fol. 12b to fol. 144. 20 Description.- Complete. For other details see No. Author.-- Jayananda Suuri. Subject.- A story of Javadi. Begins. fol. 12deg // 960 // Ends. fol. 14" [ 237. zrI ' kaMDUla' pure rAjA | paramArAbhidho ( 1 ) bhavat / zreSThI ca jinadattAkhyo / nemadattasutaH sudhI // 1 // etc. iti prAraMbha praNAyai narottamA / te jIvaDivadvIpa | atrAmutra sukhAraphadaM // 5 // iti jAvaDikathA | zrIjayAnadasUrikRtAH // 6 // Javadikatha 1310 (14) 1886-92. 1310 (a). 1886-92.

Page #356
240.] The Svetambara Narratives 321 'jinaguNasampattikathA No. 239 . Jinagunasampattikatha 1074 (b). 1884-87. Extent.- fol. 6deg to fol. 9". Description.- Complete. For additional information see s No. 1074 (a). 1884-87. Author.- Not mentioned. Subject.- A story throwing light on the excellences of the Tir thankira. 10 Begins. - fol. 6deg jiNaguNasaMpattikathA kathyate / jinAdhIza namaskRtya karmana mokSadaM / jineMdraguNasaMpatti vakSya mmaastH| 1 // iha 'ja'dvIpe 'bharata kSetre 'magadha'daze 'rAjagRha'nagare etc. Ends.- fol. 9' tadanaMtaAditIrthakarasamavamaraNe dIkSAmAdAya ghAtikarmacatuSTayaM / / nirmUlya kevalajJAnamutpAdya viharati lokamadhe dharma prakAiya preSakarmakSayaM vidhAya mokSaM gataH / evaM yaH strI puruSo vA karoti sa manuSya saukhya bhusyA pazcAt kevalaM jJAnamutpAdya mokSasaukhyaM prApnAti / iti jineMdraguNasaMpattivrataM samAptaM // 20 1882-83. jinadattasUricaritra Jinadattasuricaritra .. 426. No. 240 Size.- 103 in. by 4g in. Extert.- 23 folios ; IS lines to a page ; 52 letters to a line. - Description.- Country paper thin, rough and white; Devanagari characters with occasional gears; small, legible and good hand-writing; borders ruled in four lines in black ink; yellow pigment used ; foll. numbered in both the margins; fol. !" blank; so is fol. 230; edges of this last fol. slightly worn out; condition on the whole very good ; complete. 1 Is thisa Digambara work?

Page #357
322 Jaina Literature and Philosophy [240 Age.- Pretty old. Author.- Not mentioned. Subject.- Life of Jinadatta Suri. It is based upon Sumati Gani's commentary on Ganadharasardhasataka. s Begins.- fol. 1 // 6 // zrImadyogIdrayugapradhAnazrIjinadattamarikRtasya zrI gaNadharasArddhazataprakaraNasya zrIjinapatisariziSyapaM sumatigaNindhAyA vRhdvtyaaH|| // atra cAyaM vAcanAcArya pUrNadevagaNimukhyavRddhasaMpradAyaH / / 'aMbhohara deze jinacaMdrAcAryoM devagRhanivAsI caturazItisthAvalakanAyaka AsIt / tasya ca vyAkaraNatarkachaMdo(5)laMkAravizAradA zAradacaMdracaMdrikA. vadAtanirmalacetAH varddhamAnanAmA ziSyo )bhUt tasya ca pravacanasArAdigraMthaM vAcayatazcaturazItirAzAtanA AyAtAH taashvemaaH| tathAhi khelaM 1 keli 2 kAdi 84 AsAyaNA u bhavabhamaNakAraNaM ia vibhAbi jinno| maliNa ti na jiNamaMdiraMmi nivasaMti ia smo||1|| etAzca paribhASayatastasyeyaM manasi bhAvanA samajani etc. Ends.- fol. 220 zrAvakA athAho na saMdaramiti jAtAH svissaadaaH| tataH proktaM jJAnadivAkaraH bhIjinadattamUribhibhoM kimevaM vimanaskA yUyaM yatheSa kRSNabhujaMgena rajjAbaddha eva manye(5)pi ye kecanAsmahaSTAsteSAM baMdhanaM patiSyatIti prerayatA'. tIba saMdaraM zakunametata punaramato gacchatAM duSTairekA kRttanAmikA dunimittavidhAnA preSitA sA cAgrataH sthitA dRSTA pujyapAdelpitA ca yathA AI bhallI tatastayA juSTaraMDayA dattaM prativacaH yathA bhallai dhANukkA mukkI punaruktA kiMcid vihasya sapratibhaiH pUjyaH / yathA pakkhAharA teNa tuha TinA / tataH sA gayavilakkha uttaranikhuTTA ityanekAzcaryanidhAnAnAM niraMtaraM kiMkariva maraiH sarvadopAsyamAnapAdAnAM karuNAsamudrANAM 'dhArApurI gaNapadrAdisthAneSupratiSThitavIrapArzvazAMtyajinAditIrthakAdvaMbadevagRhazikharANAM svajJAnabaladRSTanijapaTToddhArakArirAsalAMgaruhANAM bhAskarabada vibodhitabhuvanamaMDalabhajyAMbhoruhaNAmetacchAmrakArANAM zrIjinadattasUrINAM caritalezaH pratipAditaH iti vRddhaparaMparayA zrutaH pUrvAcAryAmnAyaH samarthitaH / zubhaM bhavatu / / kalyANamastu / / miiH||

Page #358
241.] The Svetambara Narratives 333 jainakumArasambhava Jainakumarasambhava No. 241 701. 1892-95. Size.- 10} in. by 4, in. Extent.-28 folios ; IS lines to a page; 52 letters to a line. Description.- Country paper thin, rough and white; Devanagari characters with occasional qersis ; small, clear and good hand-writing ; borders ruled in three lines in red ink; red chalk, white paste and yellow pigment used; foll. numbered as usual; foll. 1 and 28deg blank ; marginal notes on 10 foll. 10 and 2a; edges of the first and the last two foll. slightly worn out; foll. 16-22 somewhat worm-eaten; condition tolerably good; complete ; 11 sargas in all; 1225 slokus in extent. Age.- Samvat 1548. Author.- Jayasekhara Suri, pupil of Mahendraprabha Suri of the Ancala gaccha. For his additional works etc. see Vol. XVIII, pr. I, pp. 247-248 and 309 & Vol. XIX, sec. I, pt. I, p. 2. Subject.- This is a poem embodying the life of Lord Rsabha up to 10 the birth of a son named as Bharata. This poem is composed in imitation of Kalidasa's Kumarasambhava. Begins.- fol. 3' OM namo zrIjineMdrAya / / atyuttarasyAM dizi 'kozale ti ___purI parItA paramarddhilokaH // nivezayAmAsa puraH priyAyAH . svasyA vayasyAmiva yAM dhneshH||1|| etc. Ends.- fol. 27 jagadbharturvAcA prathamamatha jamArivacasA rasAdhikyAt tRpti samadhigatAmapyanupamA / surAyAMtarbhakSya(:) zucibhuvi nivezyAsanavare balAdAlIpAlI caghaTanayA bhojayadimAm // 40 //

Page #359
324 Jaina Literature and Philosophy [ 241fol. 28 sUriH zrIjayazekharaH kavighaTAkoTIrahIra chavi millaadimhaakvitvklnaakloliniiniirdhiH| vANIdattavarazcira vijayate tena svayaM nimmite - sarargA jainakumAra(saM)bhavamahAkAvye (5) yamekAdaza() // 71 // - iti zrIzrIjayazekharamariviracite jainIkumArasaMbhavamahAkAvye sUryodaya zakasamAgamavarNano nAma ekAdazaH sargaH / / chaH // graMthAnaM 112 / / samasta graMthAnaM 1225 // cha / // // ||ch|| // zubhaM bhavatu // kalyANaM bhUyAt / / chH|| ||shriiH // ||chH|| saMvat 15483 popamAse kri(?) kRSNapakSe amAvAsyAyAM tithau zukravAra graMtha lakSataM / cha / udayabaMtu ijyo 'acalaM gacchanAyakaH // lekhakanA AzrIvAda thikuH // 7 // pin jatUMnI udAra utyaM nuH(?, // chaH // Reference.-- Published by Bhimsi Manek in A. D. 1900 along with its Gujarati translation by Hiralal V. Hamsaraj. For additional Mss. see Jinaratnakosa ( Vol. I. p. 94)... jainakumArasambhava Jainakumarasambhava No. 242 152. 1872-73. Size.- 118in. by 4 in. Extent.-- 20 folios ; 19 lines to a page ; 60 letters to a line. Description.- Country paper thin, rough and greyish ; Devanagari characters with pRSThamAtrAs; big, clear, slant and elegant hand writing ; some of the foll. darkish ; borders ruled in four lines in black ink; red chalk used; marginal notes added here and there ; foll. numbered as usual ; edges of the first fol. tadly worn out; those of foll. 2 and 20 slightly dama. ged; foll. 1-20 worm-eaten to a smaller or greater degree; condition fair ; complete ; the 11th canto is lacking in the 20

Page #360
243.] The Svetambara Narratives 325 71th verse; extent 1200 Slokas. Sarga I fol. 1 to 101. >> II a o ceny III sa to op IV 78 too ,, V ,, gato >> , VI >> 11a , VII ., VIII , IX , X 170 to 198 >> XI 199 to 206. Age.-- Fairly old. Begins.-- fol. 12 11 8011 BEL 37 Fifefni etc. as in No. 241. Ends.- fol. 206 Angjait etc. up to haul ai as in No. 241. This is followed by the lines as under : iti zrIjayazekharasUriviracite jainakumArasaMbhavamahAkAvye sUryodayaJFFATTATUVAT AJA TEIEs: Arn: 13 WTOT 8200 mt: 11 20 FEHTER inzi il gul N. B.-- For other details see No. 241. - 21. 25 jainakumArasambhava Jainakumarasambhava No. 243 1877-78. Siza.- 10in. by 48 in. Extent. - 28 folios ; 15 lines to a page ; 54 letters to a line. Description.- Country paper thin, rough and white; Devanagari characters with occasional qehrars; big, clear and good

Page #361
326 Jaina Literature and Philosophy (243. hand-writing ; borders ruled in four lines in black ink ; red chalk used ; white paste, too ; foll, numbered as usual ; almost all the foll. more or less worm-eaten ; condition very fair; marginal notes added at times ; complete ; extent 1321 slokas, Age. - Samvat 1519. Begins. - fol. ja 11 11 39Ffgarroi icist etc, as in No. 241. Ends. fol. 286 jagadbharvAcA etc. up to bhojapadimA 70 as in No. 241. Then the 71th verse is missing. Thereafter we have __ iti zrIjayazekharasUrikate etc. up to ekAdaza sargaH as in No. 241. This is followed by the lines as under -- samAptamidaM zrIjainakumArasaMbhavAbhidhAnaM mahAkAvya // sarvagraMthAnaM 1321 saMvat 1519 varSe kArtikazudi 12 budhe zrIjayasuMdarasUriziSya dharmanidhimuninA alekhi / zreyo bhUyAt paThatAM pAThayitaNAM / / N. B.-- For further particulars see No. 241. 20 jainakumArasambhava Jainakumarasambhava vivRti sahita with vivrti 1370. No. 244 1887-91. Size.- 114 in. by 44 in. Extent.- 69+1-1=69 folios ; 17 lines to a page ; 75 letters to a line. Description. - Country paper thin and white ; Devanagari chara cters with genia ; small, legible and good hand-writing; borders ruled in four lines in black ink ; red chalk and yellow pigment used; soil, numbered as usual; fol. r' blank except that the title is written there ; the 34th fol. partly damaged perhaps owing to its being exposed to fire ; condition tolerably good ; fol. 35 repeated, fol. 39 lacking; practically complete; this Ms. contains both the text and its

Page #362
244.] The Svetambara Narratives 327 15 commentary ; the latter composed in Sanvat 14823; corre. cted by Manikyasundara Suri ; its extent 5300 slokas. Age.- Not modern. Author of the commentary.-- Dharmasekhara Suri, pupil of Jaya. ___sekhara Suri (the author of Kumarasambhava ). Subject.-- The text along with its elucidation. Begins - (text ) fol. 16 ___ atyuttarasyAM dizi kozaleti etc. as in No. 241. " - ( com. ) fol. 10 dhyAtvA zrIzAradA devIM natvA shriisdguruupi| kumArasaMbhavasyeyaM vivRtilikhyate mayA // 1 // etc. Ends.-- (text ) fol. 692 jagadbhaturvAcA etc. as in No. 241. The 71th verse is not there. , -( com.) fol. 69 samadhigatAmapi prApitAmapi / / cha // 7 // iti zrI aMcala' gacche kavicakravartizrIjayazekharasUriviracitabhIjainakumArasaMbhavavasya tacchiSyazrIdharmazekharasUrikRtAyAM TIkAyAM zrImANikyasaMdarasUrizodhitAyAM ekAdazasargavyAkhyA // cha | graMthAnaM // evaM sarvanathazloka 5300 // suraasurnraadhiishsevymaanpdaaNbujaa| nAbhirAjAgajo nityaM zrIyugAdijino mune // 1 // zrImadacalaM gacche jayazekharasUrayaH / catvArAstermahAgraMthAH kvishrvinirmitaaH||2|| prabodhazcopadezazca citAmaNikRtottaro / ' kumArasaMbhavaM kAvyaM caritraM dhami(mmilasya ca // 3 // teSAM gurUNAM guNabaMdhugaNAM ___ziSyeNa dhammottarazekhareNa zrIjainakaumArakasaMbhavIyaM sukhAya bodhAya teti TIkA // 4 // deze 'sapAdalakSa sukhalakSye padyareH purprvre| 30 nayanavasubArddhicaMdre 1482 varSe harSeNa nirmimatA seyaM // 5 // 1 prabodhacintAmANi & upadezacintAmANi.

Page #363
328 Jaina Literature and Philosophy [244. vidvatpanavikAzAna dinakarAH sUrIzvarA bhAsvarA mANikyottarasudarAH kavivarA rutvA prasAdaM prN|| bhaktA zrIjayazekhare nijagurau zuddhAmakAdhurmadA bhImajanakumArasabhavamahAkAvyasya TIkAmimAM // 6 // yAvanmaru mahIpITha sthiratAM bhajate bhRzaM / vAca(cya)mAnA janastApaTTIkA(5)sA nNdnaa(taa)cirN|| paMDitadevacadaziSyagaNivijayasAgarayogyaM // This last line seems to be written in a different hand writing. Reference.- For additional Mss. of this commentary ___kosa (Vol. I, p. 94). ___N. B.-- For further particulars see No. 241. 10 jainakumArasambhavavikRti Jainakumarasambhuvavivrti No. 245 231. 1573-74 IS Size..- 12 in. by 4g in. Extent.- 53 folios ; 17 lines to a page ; 62 letters to a line. Description.- Country paper thin, tough and white; Jaina Deva nagari characters with frequent gels; small, quite legible, uniform and good hand-writing : borders ruled in two pairs of lines in black ink ; red chalk used ; foll, numbered in the right-hand margin ; fol. 1 blank; marginal portions of each and every fol. more or less gone ; condition on the whole tolerably fair ; there is some space kept blank in the centre of the numbered and the unnumbered sides as well ; only the sales of the text seem to be given ; complete ; extent 3488 Slokas: a green piece of paper is pasted to fol. 1*; the work is divided into 11 sections as under :Section I fol. b to fol. 8. II 84 , , 13 III , Ib , , 18b ..... - IV. 18. , , 232 v 23 , 28*

Page #364
246.J Section " "" " N. B.- 19 " Age. - Pretty old. Begins. fol. 1 550 // The Svetambara Narratives VI fol. 28b VII 336 VIII 366 IX X XI ") " 42 J. L. P.1 "1 " "} 402 44 50' to fol. 33b 366 " dr "} dr " zrIzAradAM devIM natvA zrIsadgurUnapi / kumArasaMbhavasyeyaM vivRtirlikhyate mayA // 1 // yasmai kAvya yugapradAnavAdA zrIzAradA devatA " "" " " " 40' 44b 50a 53. yaH zrIjainakumArasaMbhavamahAkAvyAdikarttA kalau || Ends. fol. 53deg zrI RSabhadevasya vacanena atha jaMbhAvicasA iMdrasya vANyA rasAdhikyAt anupamAM tRptiM samAdhigamitAmapi prApitAmapi // 70 // siddhAMtodadhicaMdramAH sahRdaya zreNI ziraH zekharaH zo'yaM zrI jayazekharAkhya (su) gurujIMyAjjaganmaMgalaM // 2 // atrAyaM kila saMpradAyaH / laukika kAvyAnusAreNa astyuttarasyAM dizIti 15 tAkSarANi varttata iti na jJAtavyaM etc. iti / zrImadaMcala' gacche kavicakravakti (rtti) zrIjaya zekharasUriviracitazrIjenakumArasaMbhavasya tacchiSya zrI dharmazekharo (ra) sUrikRtAyAM TIkAyAM zrImANikyasuMdara(ra) sUrizodhitAyAM ekAdazasargavyAkhyA // cha // atha graMthAgraM 267 akSara 28 evaM sarvagraMtha zloka 3488 cha / surAsuranarAdhIza etc. up to harSeNa nimmitA seyaM 5 as in No.244. For additional information see No. 244. 329 'DhAlasAgaraddarivaMzaprabandha No. 246 Size.-- to in. by 4g in. This work is named as Dhalasagara in Jaina Gurjara Kavio (Vol. 1, p. 497). 30 Dhalasagaraharivarsaprabandha 5 1615. 1891-95. 10 20 25

Page #365
ro 330 Jaina Literature and Philosophy [246. Extent.- 176 folios ; 14 lines to a page ; 34 letters to a line. Description.~Country paper thin and greyish; Devanagari chara cters; big, clear and very fair hand-writing ; borders ruled in two lines in red ink; foll. numbered as usual; foll. !' and 176deg blank; a piece of paper of the size of a fol. pasted to fol. !"; same is the case with fol. 1760; strips of paper pasted to fol. 2'; condition on the whole good ; red chalk used; complete ; composed as Kurkutesvara in Samvat 1676 in 9 adhikaras in ISI dhalas. Age.- Sarivat I750. Author.- Gunasagara Suri, pupil of Padmasagara Suri of Vijaya gaccha. He is the author of the following additional works : (1) kayavannA( kRtapuNya )rAsa V. S. 1676. (2) zAntinAthacanda (3) zAntijinAvinatirUpa stavana. Subject- The origin of Harivamsa narrated in verse in Gujarati. In this work lives ot Neminatha, Pandavas etc. are describ ed. Begins,- fol. 1deg zrIvItarAgAya nmH|| zrIjina AdijinesarUM / Adi taNo karatAra // yugalIdharama nivAraNo / varatAvaNa vighahAra // 1 // etc. utapati zrI haribaMzanI / haladhara kRSNa narasa / / nemi madanayuga pAMDavAM / carita bhaNuM suvisesa // 18 // etc. 25 - fol. 20deg iti zrIDhAlasAgaraharivaMzaprabaMdhe prathamo'dhikAraH // 1 // etc. __Ends.- fol. 1760 gaccha svaccha praNAmasU re / vijayavaMta visesa / zrI vijaya gcchraajiiyaa| kAI dIpai re guru dharmanaresa ki // 95 // vijaya RSi vidyAbalI re| dharmadAsa munIza / kSimAsAgarakSemajI / kAI jehanI re jaga mAMhiM jagIsa ki // 96 // gA. padmasAgara sUrijI re / suyazayasabhara pUri /

Page #366
247.] The Svetambara Narratives 331 pAya praNamI prabhu taNAM / kAI bhaNe re guNasAgarasUri ke // 97 // gA. saMbacchara (sola) chahattarai (1676) re / mAsa sAvaNa suddha / tIja soma samuttarA / kAMi vAsara re vArU aviruddha ki // 98|| gA. 'kurkuTesvara nagarameM re / pAsasAmipasAya / saMghane ujakapaNe / kAI racio re maI carita subhAya ki / / 99 // gA. DhAlasAgaro nAma / zrI hari'vaMsano vistAra / suddha bhAve sAMbhalaI / kAMi pAMmaha re suSa saMpati sAra ki gaa0||3000|| eka sau ekAdhanai re / DhAlano sobhAga / Adito 'AsAvarI' / kAI aMtai re 'dhanyAsI rAga ki // 1 // gA. jaba lagi giri 'merujI re / sakala giravara Isa / 10 taba lagi 'harivaMsa e| kAi ghA(thA)jyo re thira visvA vIsa ki // 2 // gA. kalasa 'harivaMza gAyau suyaza pAyo jJAnabuddhiprakAzanau / ___ pApa bATho gayo nAThau punya Ayau Asanau // karaNa putra kalatra kamalA pahata sunata suhaamnno| pUjya zrIguNasUri japa saMgharaMgi vaghAmaNau / / zrIharivaMzaprabaMdhe dAlasAgare zrIguNasAgarasUrikRtaM samAptaM / liSitaM zrIlIlasAgareNa zrI bahitahaDa'madhye / saMvat varSe 1750 vaizASamAse kRSNapakSe ekAdazItithau bhRguvAsare sAdhvIlakSmIvRddhiziSyaNIvAInAMhIyAcanArtha zrIrastu kalyANamastu vAcyamAnazciraM naMdatAta zrIzramaNasaMghasya zreyaH // 20 Reference.- For extracts and additional Mss. see Jaina Gurjara Kavio ( Vol. I, pp. 497-500). dAlasAgaraharivaMzaprabandha Dhalasagaraharivamsaprabandha 1616. No. 247 1891-95. Size. -- 10 in, by 44 in. Extent.- 98 folios ; 18 lines to a page ; 43 letters to a line. Description:- Country paper tough, rough and greyish; Deva nagari characters; small, clear and fair hand-writing ; bor.

Page #367
332 Jaina Literature and Philosophy [ 247 ders ruled in two lines and edges in one in red ink; num. bers for foll. entered twice as usual; fol. 2 decorated with a beautiful design ; white paste used ; complete ; condition very good. s Age.-- Samvat 1856. Begins. fol. 16 HAFEIT PIATEETITIETITA 577 : Er I FIAT TIT 11 NIHA B iH etc. as in No. 246. 10 Ends.-- fol. 986 gitast sol etc. up to IAT as in No. 246. This is followed by the lines as under : iti zrIzrIpUjyazrIguNasAgarasUriviracite DhAlasAgara zrIharibaMsaprabaMdhe navamo adhikAra sNpurnn|| 15 ___ saMvat a 18 sa 56ko virase kAtege suddhi nomi budvAre le| N. B.- For other details see No. 246. 577. 20 'DholAmArucatuSpadI Dhola--Maru.catuspadi (TIGRIGT193) (Dhola-Maru-copai) No. 248 1895-98, Size.-10 in. by 44 in. Extent.-- 24 folios; 15 lines to a page ; 36 letters to a line. Description.- Country paper thin, rough and white; Devanagari characters; small, clear and fair hand-writing ; borders ruled in three lines in black ink; soll. numbered as usual ; foll. ja and 246 blank; strips of paper pasted to fol. 1 etc. ; condition very fair ; complete; extent 772 Slokas, composed in Samvat 1617 at Jesalmer to excite curiosity, Age.-- Not quite modern. TE " in Jaina Gurjara Kavio 1 This work is named as "FTE GIOIT (Vol. I, p. 212 ). 30

Page #368
249.] The Svetambara Narratives 333 Author.- Kusalalabha ; pupil of Abhayadharma, For his additional works see pp. 1-2. Subject. Lite of Dhola Maru in Gujarati in Copai metre. Mara - vani is a daughter of King Pingala and Salha is a son of Nalaraya. Begins. fol. b sakalasurArasAMminI suNi mAtA sarasatI / vinaya karenai vInasaM (buM) muja yo avirala mati // 1 // etc. 'naravara'nayara niraMdo nalarAu sAlha kuara varI / piMgalarAIsa A vanitA mAravaNI varNatrIsuM // 5 // etc. Ends. -- fol. 248 gAhAsAThI sAtasaha eha pramANa / dUhA nai coyaI varSANa / jAdava rAula zrIharirAji / joDI tAsa katohalakAji // 68 // je iNI pari kavi suSa sAMbhalI / tiNa pari joDI mananI ralI / duhA ghaNA purAMNA achai copaI / baMdha kIu maha pachaI || / / 69 / / adhika chai je joDyo bahu / sukadhI te sAMsahajyo sahu / paDI valI jihAM yAMtaro / teha vicArI karajyo paro // 70 // saMvat 16 sola satottarai (17) ASA bIja divasa mani parai joDI 'jesalameru' majAri vAMcyAM suSa pAMmai saMsAra // 71 // sAMbhali zravaNa catura gahagahaI / bAcaka kusalalAbha Ima kahI / ridha vRdha suSa saMpati sadA / sAMbhalatA pAMmaI saMpadA // 72 // iti zrI DholAmArunI copaI saMpUrNa graMthAgraMtha 772 // lipataM 'avaraMgAbAda'madhye | jasarAjajI AtmArtha / #1 Reference. For extracts and additional Mss. see Jaina Gurjara Kavio ( Vol. I, pp. 212-214 ). DholA mAru catuSpadI No. 249 Size.-- 94 in. by 42 in Extent. - 18 folios; 19 lines to a page; so letters to a line. Dholamarucatuspadi 1617. 1891-95. 5 10 IS 20 25 30

Page #369
S 10 IS 20 25 Jaina Literature and Philosophy [249. Description. Country paper tough and greyish; Devanagari characters; small, clear and good hand-writing; borders ruled in two lines in red ink ; red chalk used; toll num - bered as usual; edges of the first few foll. and those of the last slightly worn out; strips of paper pasted to the edges of foll. 14, 1deg etc.; a piece of paper pasted to fol. 188; condition fair ; complete. 334 Age.--- Not quite modern. Begins. - fol. 14 goDIpArzvanAthAya namaH // atha DolArI copaI liSyate 3...0 surapAya namI saMNa mAtA sarasati / bIna karaneM vinavuM mujha yoM avarala mati // 1 // etc. 'nalavara' nayara nariMdo nalarAya tasa sAhala kumAroM / piMgalarAya tasu dhuA vanitA mAru varaNavaMsA / / 6 / / etc. Ends. - fol. 184 ..BD jo iNa pare kaviSa sAMbhalI / tiNa para me joDI mana rulI / hA ghaNA pUrANa acheM 'caupaI' baMdha kIyoM meM pache || 775 // etc. saMvata sola satotare (1617) ASA tIjaha dIvasa ja pare / I joDI 'jaisalame (Se) 2' majhAra vAMcyA suSa pAMme saMsAra // 777 || ..... ( illegible ) vaizAkha 0 2 dine / zrIpUjyAcArya zrI zrIbhAgacaMdajI tadaziSya RSikisanadAsa tatbhrAtA dISavijA tatbhrAtA RSivAlacaMda tatbhrAtA RSirUpacaMda saparIkarAn / zrIrastu liSataM RSivijerAja 'vAvagrAma'madhye lipIkRtaM liSAvataM punyAsaSuspAlavijeM celA gaNesapaThanArtha / zubhaM bhavatu | kalyANamastu // N. B. - For further particulars see No. 248. **** 1 Letters are gone as the corresponding portion of the fol, is worn out.

Page #370
25.] The Svetambara Narratives 335 5 tArAkathA Tarakatha No. 250 1310 (27). 1886-92, Extent.- fol. 290 to fol. 30deg. Description.- Complete. For other details sce No. 1310 (1). . 1886-92. Author.- Not known. Subject.-- A story of Tara in connection with sila ( chastity ). Begins.-- fol. 290 ___ rakSati vimalaM zIlaM / vyasanasthA apIhaye / / janA bhavadvaye zreyastArAvat te ayaMti hi // 1 // etc. Ends.- fol. 30 sUpo virakto(s)dha(tha) eroH samIpe jagrAha dIkSAM kuladevyakArSIt // caMdraM nRpaM tnndRssttcittaa|| dharma sa kanvA pa divaM sabhAryaH / / 60 // iti zIle tArAkakathA // 20 tilakamabharI Tilakamanjari No. 251 ___791. 1895-1902. Size.-- 10g in. by 4s in. Extent.-- 181+3-1 =183 folios; as lines to a page ; so letters ___ to a line. Description.- Country paper tough and white; Devanagari chara cters; big, legible and good hand-writing ; borders of most of the foll. ruled in three lines and edges in one in red ink; numbers for most of the foll. entered twice as usual ; fol. 1. blank; foll. 46, 65 & 76 repeated ; fol. 48 lacking; fol. 7 wrongly numbered as 67: perhaps '6' left out to be struck off ; fol. 117 numbered once only : so are the foll. 119, 173 and 176; complete ; condition very good. Age.- Not quite modern, 30

Page #371
5 Subject. A narrative of King Meghavahana along with the life of Lord Rsabha. TO 15 20 25 336 Jaina Literature and Philosophy [asi. Author.-- Dhanapala, an elder brother of Sobhana Muni. For details about him see "A History of the Sanskrit Literature of the Jainas" ( Vol. I, pp. 109 111, 115, 128, 199 & 270). 30 Begins. - fol 1 || 6 || OM namaH sarvajJAya // sabaH pAtu jinaH kRtsnamIkSate yaH pratikSaNaM / rUpairanaM terekaikajaM toyaptaM jagattrayaM // 1 // prAjyaprabhAvaH prabhavo dharmasyAstarajastamAH / dadatAM nirvRtAtmAna Ayo (S) nye (S) pi mudaM janAH // 2 // etc. Ends. -- fol. 180deg dizi dizi vyamacAriNamaNinimAnanivahena vicarataH pRthivyAmanudinamupaciyamAnapaiauru ( pa ) pratApakIrterAbaskaMdaparamAM vRddhimAnaMda iti / TIla gotrAvAptapratiSThe'smin suzAkhe parvazAlini / zrAddhaH 'zrImAla'vaMze'bhU lakSmaNe naramauktikaM // 1 // aircare yasya nirmalAzayazAlinI / '... suvarNavRttabhAvAyavallabhA lIlAM // 2 // samajaniSata vIsalabholigajasahDadhavalavIranAra / mAna: adhyayasya paMca naMdanavarA kasmAta surataruzrIkAH // 3 // zrIcakrezvara gaNadhara padamUle saMghavasatikAyAM yaH / gRhidharmma sakuTuMbo'graddId vasan peTalApe (pa) dra (dre ) || 4 // tatputro dhavalaH zreSThI yazodhavalaputrikAM / rukmiNIM samupAyaMsta lakSmIkukSisamudbhavAM // 5 // (a) dvacaHsahaMsI rukmiNI gurudezanAM / zrutvA saMjAtasaMvegA satI samitamaMDanaM // 6 // nijatanaya vinayaparISatha tribhuvanapAla kuse / vA jagRhe pustakamAtmabhire'rthaM tilakamaMjaryAH // 7 // atha tilakamaMjarimimAM ziSTA bhavaNavatamatAM netuM / zrI sumatisiMhagaNadhara guruNamarpayAmAsa // 8 // 1 Some letters seem to be missing in the Ms.

Page #372
281 The Svetambara Narratives 337 sUryAcandramasAveto(to) vyomniikrnnkuNddle| yAvad visphuratastAvannaMdatAdeSa pustakaH // 9 // etc. saM0 1255 varSe maMTavAdyAM(TyAM) rukmiNIzrAvikayA tilakamaMjarIpustakaM zrIsumatisiMhamUriNImarpitaM / / iti zrItilakamaMjarIestaka saMpUrNa // zrIgaNezAya namaH // Reference.- Published in the Kavyamala in A. D. 1903. Portions of the text along with Santi Suri's gloss and Paraga, the Sanskrit commentary by Vijayalavanya Suri are published in three parts (pp. 1-160, 161-332 & 1-200) by "zrIvijayalAvaNya sUrIzvarajJAnamandira" in V.S. 2008, 2010 and 2014 respec-10 lively. Parts II & III contain a partial summary of Tilakamanjari in Sanskrit and in Gujarati. An article by C. Sivaramamurti entitled as " Art notes from Dhanapala's Tilakamanjari" is published in " Indian Culture" ( Vol. II, No. 2, October 1935 ). This Tilakamanjari is quoted by Namisadhu in his tippana on Kavyalankara (v. 163). Some of the words etc. occurring in Tilakamanjari are referred to by Handiqui in his notes to his edition of Naisadhacarita. Of them I may note the following as 20 under :Tilakamanjari Naisadhacarita kalAda VIII, 99 caNDAtaka XVI, 8 catuSka XV, 19 nagnAcArya XIX, 41 pratolikA VI, 58 bhogAvalI x, tos. For additional Mss. see Jinaratnakosa (Vol. I, p. 159). - 43 11.L.P.1

Page #373
10 15 20 25 338 30 tilakamaJjarIprabandha No. 252 5 Description. Country paper tough and white; Devanagari characters with gears; big, legible and good hand-writing; borders ruled in four lines in black ink; red chalk used; foll. numbered as usual; strips of paper pasted to foll. 29-30; foll. 32-67 worm-eaten ; edges of fol. 67 slightly worn out; condition tolerably good; foll. 1, 3-4 and 12-18 lacking; otherwise complete ; extent 2200 Slokas* Age. - Samvat 1645. Jaina Literature and Philosophy Size.-- 97 in. by 44 in. Extent.-- 67-10=57 folios; 13 lines to a page ; 40 letters to a line. Tilakamanjariprabandha Subject.- An epitome of Tilakamanjari ( No. 251 ). Begins (abruptly )-- fol. 2a Ends.- fol. 67" Author.-- Pandit Padmasagara, pupil of Dharmasagara For his additional works see Vol. XVIII, pt. 1, p. 28. Silaprakasa, too, is his work. [ 252. prItyA nRtyati nyAyavarhiNaH // 16 // 'jAhnavI' sarayU 'raMgataraMgadhvanisaMgamaH / nRttyA yatra pAvitryazriyA zrayati tAlatAM // 17 // sevara nimeSAkSa (:) vIkSyamANamukhAMbujaH / tasyAmabhUnmahImeghavAhano meghavAhanaH // 18 // etc. 71. 1898-99. mithyAdarzana mUladurgaticatuH zAkhA sukhAlIphala duH karma khaMDa khaMDanalA durmatta ' ... daMbalAH / bhavyaprANi zivaprANapaTahadhvAnairvacobhirjagat / 1 Some letters are missing in the Ms. prINitvA harivAhanaprabhRtayaH svazreyasaM zizriyaH // 97 // bAcakAgresarazrImaddharmasAgara ziSyakaiH / nirmito'yaM kathAgraMthaH paMDitaiH padmasAgaraiH // 98 //

Page #374
253.] The Svetambara Narratives iti zrI tilakamaMjarIprabaMdhaH saMpUrNaH samAptAni // yadakSarapadabhraSTaM svavyaMjanavivarjitaM / 13 tithI bhomavAsare | munigovyaMdalaSitaM / graMthAgra saMkhyA 2200 / zrIvItarAgAya namaH || zrI guNezAya namaH // cha // zrI // sarva devi ! prasIda paramezvarI ! || 1 || yAdRzaM pustakaM dRSTaM tAdRzaM likhitaM mayA / yadi zuddhamazuddhaM vA mama doSo na dIyate // 2 // saMvat 1645 varSe zAke 1501 [1] pravartamAne phAlgunamAse zuklapakSe Reference. Published in the Sri Hemacandracarya Granthavali. Even the Gujarati translation is published. For additional Mss. see Jinaratnakosa (Vol. I, p. 160). tribhuvanadIpaka prabandha No. 253 339 Tribhuvanadipakaprabandha 1482. 1887-91. Age. Pretty old. Author. Jayasekhara Suri, author of Prabodhacintamani. For other details see No. 241. Size. 113 in. by 31 in.. Extent. 24-1-23 folios; 10 lines to a page; 45 letters to a line. Description. Country paper thin, rough and greyish; Jaina Devanagari characters with occasional gas; sufficiently big, legible, uniform and very good hand-writing; borders ruled in two pairs of lines in black ink; space between these pairs coloured red; red chalk used; foll. numbered in the right-hand margin : once as 2, 3 etc. and once as 892, 893 etc.; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; unnumbered sides are decorated with a spot in red colour in the centre whereas the numbered, in each of the two margins, too; fol. I missing; so the work commences abruptly; it however goes up to the end. 25 S 10 15 20 30

Page #375
5 10 15 20 25 340 Jaina Literature and Philosophy [ 253. Subject. This is practically a Gujarati versified presentation of an allegorical work named as Prabodbacintamani, a refutation of Prabodhacandrodaya. Begins. fol. 24 Ends. anAdi anaMtu / kSaNi amaramaNi kSaNi pAyAli / itthAM vilasa hi kAli // 10 // vAghiu dI putri muni mAi / lAnDau kuMthau zarIri samAr3a / dIpati diNavaru koDiha jisau / jihAM jouM tihAM dekhauM tisau // 11 // etc. fol. 24b kalpahuma kAmadhenu e hoI / ciMtAmaNi eDa avaru na koI | huji siddhipurI paMthu / ehu ji jIvana (nu) savihuM graMtha // 15 // mUlamaMtramaNi e mani mAni / tapa japaDaM phalu ehanaiM dhyAni / iNi savi saMpada AvaI pUri / ima bolai / jayazekharasUri // // 16 (416) // 6 // iti tribhuvanadIpakaprabaMdhaH saMpUrNaH samAptaH // zrI // 66 // 1 // Then in a different hand we have : punyaraMga 'pATaNa'mA dharmarAjAH moharAjano rAsa ke Athako : sopaI acalagacchanAyaka jayazeSarasUri katA che || Reference.- Edited with an introduction by L. B. Gandhi and published in "Jaina dharmabhyudaya Granthamala", Bhavnagar in V. S. 1977. For extracts and an additional Ms. see Jaina Gurjara Kavio ( Vol. I, pp. 1 24-25 ). For other additional Mss. see Jinaratnakosa ( Vol. I, p. 162 ) and Jaina Gurjara Kavio (Vol. III, pt. 1, p. 2425 ). 1. Here this work is named as Paramahansaprabandha, too. 2_Here this work is named as pracodhacintAmaNicopaDa, 100.

Page #376
S 10 255.) The Svetambara Narratives 347 tribhuvanadIpakaprabandha Tribhuvanadipakaprabandha 153. No. 254 1872-73. Size. -- 91 in. by 4 in. Extent.-- 24-1= 23 folios ; 12 lines to a page ; 38 letters to a line. Description. - Country paper thin, rough and greyish ; Jaina Deva nagari characters with frequent WA15S ; big, quite legible, unitorm and very good hand-writing; borders neatly ruled in two pairs of lines in black ink; red chalk used; foll. numbered as usual; there is some space kept blank in the centre of the numbered and unnumbered sides as well; there is a hole in this central space ; condition very good; fol. i missing ; so the work begins abruptly but it, however, goes up to the end ; extent 680 slokas ; yellow pigment used for making corrections. Age.- Pretty old. Begins.- fol. 24 Haa! 377 H83 Sale saa etc. Ends. - fol. 246 FETUE FIAT etc. up to sayqaciqaqala: ll x 11 as in No. 253. This is followed by the lines as under : SITAT "2 3 " OS" SITUEEOT & CO 11 iti zrIjayazakharamUriviracitribhuvanadIpakaprabadha || zrI // 5 // shrii|| N. B.- For other details see No. 253. 20 25 la Tiet#1959aita Trisastisala kapurusacaritra (ga 8-80 ) ( Parvans 1-X) No. 255 47 (&). 1874-75 Size.- 10 in by 44 in. Extent.- 715-8;=628 folios; 15 lines to a page ; 5+ letters to a line. 30

Page #377
342 Jaina Literature and Philosophy [255. 10 Description. - Country paper thin, tough and white; Jaina Deva. nagari characters with occasional geria; small, quite legible, uniform and very good hand-writing ; borders ruled in two pairs of lines in black ink; red chalk rarely used; foll. numbered in the right-hand margin ; there is some space kept blank in the centre of the numbered and the unnumbered sides as well so that it forms a design ; foll, 1-87 missing : so this Ms. begins abruptly with the portion of the fifth sarga of the first parvan ;' it however, goes up to the end of the 13th canto of the roth parvan ; the numbers of the sargas in each of the ten parvans are as under : 6, 6, 8, 7, S, 8, 13, 12, 4 & 13. In all there are 82 cantos, 15 This Ms. contains an additional work viz. aitistega which begins on fol. 6468 and ends on fol. 715. Extents of the first and the last parvans are 5017 & 5250 slokas respectively. Age.- Not modern. 2Author.- 'Kalikalasarvajna' Hemacandra Suri. For a list of his works see B. B. R. A. S. (Vols. III-IV p. 438 ) and DCGCM ( Vol. XVII, pt. 4, pp. 154-156 ). Subject.- A biography of 163 towering personalities : 124 Tirthan. karas, 12 Sovereigns ( Cakravartins ), 9 Vasudevas, 9 Balaramas and 9 Prativasudevas. The contents of the ten parvans are as under : Parvan I Life of Rsabha and that of Bharata. ,, II Ajita , , , Sagara. >> III Lives of Sambhava to Sitala i, e. to say those of 8 Tirtharkaras : >> IV Lives of s Tirthankaras, 2 Cakravartins, s Vasudevas and 5 Balaramas. 30 1 The first parvan is lacking in the first four sargas and a portion of the fifth. 1 2 Tirthankara: 16-18 are Cakravartine, too. They are counted separately; otherwise the dumber will be 60. 35

Page #378
255.1 The Svetambara Narratives 343 Parvan V Life of Santi both as a Tirthankara and a Cakravartin. , VI Lives of 4 Tirtharkars (two of them being Cakravartins), two additional Cakravartins, two Vasudevas, two 5 Balaramas and two Prativasudevas. VII Lives of Nemi, two Cakravartins, Laksmana ( Vasudeva), Rama-andra ( Balarama) and Ravana ( Prativasudeva ). VIII_Lives of Nemi, Krsna ( Vasudeva ), Bala- ro bhadra ( Balarama) and Jarasandha ( Prativasudeva ). ,, IX Lives of Parsva and Brahmadatta (the 12th Cakravartin ). X Life of Mahavira. Begins ( abruptly ) -- fol. 886 taM ca dhik mayi daMDA(pa)dhe cakrAdAnaM yad 'bharate zitaH // 12 // samakSaM gusaMmadotsottamayuddhapratizravaM / / dhigaho bAlakasyeva saMvyAnAdAnIvaza // 13 // etc. - fol. 89deg ityAcAryazrIhemacaMdraviracite triSaSTizalAkApuruSara(ca). ci(ri)te mahAkAvye prathame parvaNi bAhubalisaMgrAmadIkSAkevalajJAna saMkIrtano nAma paMcamaH sargaH // 5 // - fol. ros' ityAcArya etc. marIcibhatrabhAvizalAkApuruSabhagavanirvANa bharatanirvANavarNano nAma SaSTaH(4) sargaH samAptaH // 7 // ___samAptaM ca zrIRSabhasvAmimaratacakravartipratibaddhaM prathamaM parva // 5 // graMthAna 5017 zubhaM bhavatu // Ends.- fol. 645 tasminneva pure etc. up to trayodaza sargaH // as in 20 25 No. 1260. 30 NO. 1886-92.. This is followed by the lines as under : samAptaH // 5 // 13 // // samAptaM cedaM dazamaM parvaNI paripUrNamidaM triSaSTizalAkApuruSacaritaM mahAkAvyamiti // 7 //

Page #379
5 IO IS 3 20 25 344 No. Jaina Literature and Philosophy [255. ziSyo jaMbumahAmuneH etc. up to ghaDiyAM // 21 // as in Then we have graMthAgra 5250 Reference. Published by the Jaina Dharma Prasaraka Sabha in six parts in V. S. 1961, 1961, 1962, 1963, 1964 and 1965 respectively. The first parvan is once more published in " zrIjaina AtmAnandazatAbdigranthamAlA" as No. 7 in A. D. 1936. The seventh parvan is separately published as "Jaina Ramayana" from Calcutta in A. D. 1873 and from Poona in A. D. 1890 and by zrIsiddhacakra sAhityapracAraka samiti" in A.D. 1961. The English translation by Miss Helen Johnson along with notes etc. is published in the Gaekwad's Oriental Series in six Vols, as Nos. 51, 77, 108, 125, 139 & 140 in A. D. 1931, 1937, 1949, 1954, 1962 & 1962 respectively. The Gujarati translation of the entire work (parvans I-X) is published by the Jaina Dharmaprasaraka Sabha in four Vols. in A. D. 1904 etc. Some of these Volumes are published more than once. --- 250. 1873-74. << Extracts collected from this Mahakavya are presented as two separate works named as jaina dezanAsaGgraha and hema vacanAmRta. Details about them are given by me in my book "A History of the Sanskrit Literature of the Jainas " (Vol. II) on pp. 42 and 46-47 respectively. For additional Mss. for each of the 10 parvans see Jinaratnakosa (Vol. I, p. 164 ). 1 According to this publication the numbers of verses in the parvans are respectively as under : 5043, 3080, 1582, 2649, 2043, 1433, 3891, 4698, 1597 & 5166. The total No. 31182,

Page #380
10 is 256. ) The Svetambara Narratives 345 triSaSTizalAkApuruSacaritra Trisastisalakapurusacaritra (gaz) ( Parvan 2) [ Stiatualia) | Ajitanathacaritra ] No, 256 1291. 1887-91 Size -104 in. by 44 in. Extent.- 69 folios ; 15 lines to a page ; 54 letters to a line. Description.-- Country paper thick, tough and whitish ; Jaina Devanagari characters with frequent quasi; small, quite legible, uniform and very good hand-writing; borders ruled in two pairs of lines in black ink : foll. numbered in the right-hand margin ; fol. ja blank; so is practically fol. 696 except that the title etc. written on it ; there is some space kept blank in the centre of the numbered and the unnumbered sides as well ; in the left-hand margins the title is variously written e. g. 2mzi O, BATO, 3 0 etc. ; condition very good ; complete ; there are in all six sargas of this second parvan; the extent of each of them is as under: Sarga I fol. 10 to fol. 86 II 1, 2b 216 ' , 42" ,, IV >> Vis 694. Age.-- Pretty old. Author.--'Kalikalasarvajna' Hemacandra Suri. For details see p. 342. Subject. - Life of Lord Ajita (the second Tirthank ira of the Jainas) and that of Sagara ( the second cakravartin ) written in verse in Sanskrit. It is a part of Eraseror#18595fa. Begins. - fol. 16 v0 jayaMtyajitanAthasya jitazoNamaNizriyaH / nameMdravadanAdarzAH pAdapadmadvayInakhAH // 1 kAhipAzani za jAMgulI'maMtrasannibhaM / STIFTAFAITHT pita aig 112 etc. 44 IJL. P.1 20 8b III 428 50* 549 son VI 30 TET.

Page #381
346 Jaina Literature and Philosophy [356. Ends.-- fol. 69* sagaranRpacaritreNAMtarasthena kAma __sara iSa rasapUrNa pApaNDena hayaM caritamajitanAthasyaihi[:]kAsuSmikANi praSitaratu sukhAni zrotRsAmAjikAnAM / / 702 // ityAcAryazrIhemacaMdraviracite triSaSTizalAkApuruSacarite (ma)hAkAvye dvitiyaparvaNi ajitasvAmisagaradIkSAnirvANavarNanA nAma paSTaH sargaH // 5 // samAptaM cedamajitasvAmisagarava(ca)kravartipratibaddhaM ti(da)tIyaM parveti // graM0 30800 (1) // 7 // - fol. 69deg saMskRtatriSaSTizalAkApuruSacaritrAMtargataajinAthacaritraM / ajitanAthasvAmica(ri)tram / kartA hemcNdrH| Reference.-- Published by the Jaina Dharma Prasaraka Sabha, Bhavanagar as Part 2 in V.S. 1961. Its English transla. tion by Miss Helen Johnson along with notes etc. is published in GOS as No. 77 in A. D. 1937. For additional Mss. see Jinaratnakosa ( Vol. I, p. 2). 10 20 triSaSTizalAkApuruSacaritra Trisastisalakapurugacaritra (parva 7-8) (Parvans VII-VIII) 432. No.257 1882-83 Size.- 10, in, by 4.3 in. Extent. -- 113+124=237 folios; 14 to 15 lines to a page; 40 letters to a line. Description.- Country paper thin, tough and white; Jaina Deva nagari characters with frequent galgis; big, quite legible, uniform and very good hand-writing ; borders mostly ruled in two pairs of lines in black ink; space between these pairs coloured red; red chalk used; foll, numbered in the right-hand margin as I to 113 and thereafter again as I to 124; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; yellow pigment used for making corrections; fol. 1 blank ; so is fol. !" of the second set; a thick piece of paper pasted to 25 30

Page #382
257. ) The Svetambara Narratives 347 it; on fol. 1245 a piece of white paper is pasted ; this fol. is blank; several foll. are smutty or spoiled by some oily substance or so; condition on the whole good ; foll. I to 113 of the first set deal with the 7th parvan which is divided into 13 sargas; the extent of each of them is as under :Sarga I fol. 16 to fol. 6 II III 5 lo VI VII 760 876 962 VIII IX 969 1026 15 020 10gb XI >> 1096 >> >> 1125 XII U12b >> 1135 , XIII fol. 1136 This 13th canto is incomplete. Then we have 12 sargas of the eighth parvan ; the extent of each of them is as under :Sarga I fol. to fol. 20 316 III 599 IV 60deg 71" VI VII 964 VIII 986 30 IX 1o8b 116 206 XI 1166 XII 1206 124

Page #383
348 Jaina Literature and Philosophy [257. Age.- Samvat 1655. Author.-'Kalikalasarvajna 'Hemacandra Suri. For details see p.342. Subject. - The Jaina version of Ramayana and that of Mahabha ___rata. For other details see p. 343. Begins ( set I ).- fol. tb // ahe / / OM namaH sarvajJApaH / / atha zrIsuvratasvAmi etc. as in No. 261. - fol. 650 ityAcAryazrIhemacaMdaviracite triSaSTizi(za)lAkApuruSAMca. (ca)rite mahAkAvya saptamaparvaNi sItAharaNo nAma paMcamasargaH // ___-- fol. 76% ityAcArya etc. sItApravRtyAnayano nAma SaSTasargaH / / -- fol. 87deg ityAcArya etc. rAvaNavadho nAma saptamaH / sargaH / / - fol. 96% ityAcArya etc. sItAparityAgo nAmASTamasargaH / / -- fol. 102' ityAcArya etc. sItAzuddhivratagrahaNe nAma navamasarga / - fol. 109" ityAcArya etc. rAmanirvANagamano nAma dazamasarga / - fol. 112deg irAcArya etc. neminAthacaritavarNano nAmaikAdazaH sargaH // Ends ( set I ). - fol. 113 cakrabhRtve punaru( raTau sahasrANi zatASTakaM / paMcAsana(ca) vratakAla punaH sa zate trayaM // 31 varSAyutAyuH paripAlya samyaka tIvravrata ghAtita ghAtika utkevalajJAna iyAya nitya zuSaM padaM tad dhariSeNa cakrI // 32 ityAcAryazrIhemacaMdravirAcita tripaSTa(STi)zalAkApuruSacatrI(ri)te mA(ma hAkAvye saptamaparvaNi hariSeNacakravarti caritavarNano nAma dvAdazasargaH / Then follow 17 verses and a portion of the 18th. -- fol. 1136 the ist verse :-- nAme bhagavatastIrthe samutpannasya cakri yaa| jayasya jayinaH puNyacaritramadamucyate // 1 // etc. fol. 1136 the last verse :tatazcAsAdhayisidhurAja ibApuraH / 'vaitATyAdrikumAraM ca suraM suravaropamA / / 17 / / spe' 20 ___30

Page #384
258.] The Svetambaru Narratives 349 Begins ( set II ). - fol. 10 e60 // / unamA vizvanAthAya etc. as in No. 262. Ends ( set II ). -- fol. 124 ___ Arya sadgumzucI etc. up to vismayAya trilokamAM // 130 / / as in No. 262. This is followed by the lines as under :- S ityAcArya zrIhemacaMdrabicio triSaSTizalAkApuruSacarite mahAsAye'STamapagi baladevasvargagamananeninirvANAMDavanirvANa varNano nAma dvAdazaH sargaH // // 12 // samAptamida aSTama pry| // iti zrInAmacaritaM saMpUrNa // zrInRpavikramasaMvat 16 1 varSa / bhAdrapadakapaSTIdine rakho likhitamidaM udaya- 10 bhaMDanena / zrIrastu / / zubhaM bhavatu lekhakapAThasyoH / / Reference - Published by the Jaina Dharma Prasaraka Sabha as Parts 4 & 5 of TSIC. This Sabha has also published its Gujarati translatious. Sce No. 255. The English translation of these two parvaas ( VII & VIII by Miss Helene Johnson is published in GOS as Nos. 125 & 139 in A.D. 1954 and 1962 respectively. As regards Parvau VII see A History of Indian Literature ( Vol. II, p. 404). For additional Mss. of these two parvans see Jinaratna- 20 kosa ( Vol. I, p. 164). 1884-87. 25 triSaSTizalAkApuruSacaritra Trisastisalakapurusecaritra (parva 7, sa. 113) ( Parvan VII, cantos 1-13) [jaina rAmAyaNa ] [ Jaina Ramayana ] 1286. No, 258 Size.-- 102 in. by 4.1 in. Extent.-- 190 folios; 1; lines to a page ; 44 letters to a line. Description. -. Country paper thin, somewhat tough and white; Jaina Devanagari characters with occasional quainis ; big,, perfectly legible, uniform and beautiful hand-writing 30 .30 so far as foll. 19 to the end are concerned whereas the first 18 foll. written in bigger hand-writing ; borders of

Page #385
350 Jaina Literature and Philosophy [ 258. most of the foll, ruled in two lines and those of some in four lines in black ink; red chalk used to mark out the numbering for verses ; foll, numbered in the right-hand margin in two sets: (1) 82, 83 etc., and ( 2 ) 1, 2, 3 etc.; the unnumbered sides have a spot in red colour in the centre whereas the numbered in each of the two margins ; the central portion in their case is quite blank; bits of paper pasted to a few foll.; condition on the whole tolerably good; complete, 13 sargas in all; the extent of each of them is as under :Sarga I foll. 10 to ge II 8 III 286 VI 986 >> 1056 VII VIII 836 92 IX kh XI 1086 XII >> 1086 >> 110 XIII , 110 , 1904. On fol. 1. we have diger and some other lines subsequently written. On fol. not a puspika seems to be written. An extra blank fol, at the end : both the sides blank, Age.- Samvat 1454. Author.- Kalikalasarvajna Hemacandra Suri. For details see p. 342. Subject.-- The Jaina Ramayana. Begins.- fol. 15 CON FA: FETT 11 379 mxaafarhrauni etc. as in No. 261. Ends.- fol. 190 TE HURT FIAT Gratiuni saat sadeva maulitve'bdazataM murakulAM jye| 27 ekonaviMzatizatI varSANAM caakrsNthdi| Ane rufe FraiFag(:) # RC 33

Page #386
258.] The Svetambara Narratives 351 samAsahasnatrayamAyurAtmanaH sapta rayitvA paripAlya ca vrataM / ghAtikSayAviSkRta kevalo yayau kevalyamakSINasukhAspadaM jayaH // 29 ityAcAryazrIhemacaMdraviracite triSaSTizalAkApuruSacarite mahAkAvye saptamapaNi jaya(cakravarticaritavarNano nAma trayodazaH sarga // 7 // samAtyaM cedaM saptamaM parva // 7 // rAmalakSmaNadazAnanA nami stIrthakaJca hariSeNacakrabhRt / cakrabhacca jaya ityamutra Sad varNiNatAH zrutisukhAya saMtu vH||ch / thAyaM 1888 // // janarAmAyaNagraMtho narmadena liSApitaH AtmIyazreya se puNyapreyase naMdatAccire 1 saMvat 1454 varSe mAisudi govalalekhakena liSitaM / / zubhaM bhavatu zrIsaMgha- 15 leSakayoH // cha / Then in a different have we have: paMDitadharmaratnagaNiyaribhogyapustikA / / Begins.-- fol. !" paMceMdIyasaMgharaNo navavihabaMbhaceragatidharo caughihakaSAvamuko iya aTArasaguNehi sNjutto||1|| paMcamahabdhayajutto paMcavihAyArapAlaNAsamanyo / paMcasamaIttigutto chattIsaguNo guru hoi // 2 majjane maMthane caiva / daMtadhAvanamaithune maraNe pAraNe caiSa / tithistAt kilikA bhavet // devakArya tithihaSA(yA) yasyAM mUlAdito raviH / pitRkArye tu sA jJeyA yasyApastAmato ravaiH // 2 Ends.- fol. 190" 5 605 saMvata 1593varSe poSe zudi trayodazI some IlaprakAre zrIAdinAthacaityAlaye zrI'kASThA saMdhe 'naMdItaTa'madhye vidyApuNe bhaTTArakazrIrAmasenAnvaye / tatya bhaTTArakazrIdharmasena tApaTTe bhaTTArakazrIsomakItiH / devA tatpaTTe bhaTTArakIvimalasenadevA tatpaTTe bhaTTArakanIvizAlakIrti devA tapaTTe bhaTTArakazrIvizvasenA tAtsappabhAcAryazrIvinayakIti 30

Page #387
352 Jaina Literature and Philosophy [258. AcAryazrIvijayakIti brahmamAMIAbramhanAkArabrahmajasadhArabrahmavIrapAla ja...veNA // bAI devamatI bAI dharmamatI...ti namatI / bAI ratnamatI ...'siMhapurA' jJAtIyasmA...gotre sAhalakhA / bhAryA 2...karmA bAI prAvikA lAlI traya putrA .....sAhasa...sAsmAmala sAzonA mA. sammabhAryA hAMsalade...sAmalabhAryA zriyAda sA. sonAbharyA sgunnaade||| sAhasala jAnAvarNakarmakSayA brahmacAraveNApustaka gamAiNa likSASi...50 thAvara prazastalakSataM // Reference. Published by the Jaina Dharma Prasaraka Sabha as Part 4 of TSPC. This Sablia has published its Gujarati translation, too. Its English translation is published in GOS as No. 125 in A. D. 1954. N. B.- For further particulars see No. 257. Is 20 triSaSTizalAkApuruSacaritra Trisastisalakapurusacaritra (parva 7, sarga 1-10) (Parran VII, cantos 1-10) 1257. No. 259 1886-92. Size.- 98 in. by 43 in. Extent.-:35 folios ; II lines to a page ; 36 letters to a line. Description.--- Country paper somewhat thick, tough and white; Jaina Devanagari characters with frequent geniars; big, perfectly legible, uniform and beautiful hand-writing ; borders ruled in two pairs of lines in black ink; foll. numbered in the right-hand inargin ; fol, a blank ; so is fol. 135deg except the title etc. written on it; on fol. 350 in the left--hand margin cy : is written ; complete so far as to sargas are concerned ; the extent of each of them is as under :Sarga foll. 10 tob 50 , 320 326 ,, 43 VI VII

Page #388
260.1 The Svetambara Narratives 353 X Sarga vill foll. 1061 to 1176 IX 117 , 1250 , 1250 , 135. Extent 3794 slokas.. Age.- Samvat 1661. Begins.- fol. i || 60 // 3 namaH zrIsarvajJAya // atha zrIsuvratasvAmi etc. as in No. 261. Ends.- fol. 1340 gacchannatho 'devakura'pradeze nirIkSya bhAmaMDalarAjajIvaM prAsnehayogAt pratibodhya samyam nija sa sIteMdra iyAya kalpaM 61 utpanne sati kevale sa zaradAM paMcAdhikAM viMzatiM medinyAM bhadhikAn prabodhya bhagavAna zrIrAmabhaTTAraka: Ayuzvadyatiladhya paMcadaza cAmdAnAM sahabhAna kRtI zailezI pratiSadya zAzvatamukhAnaMdaM prapede padaM 62 ityAcArya zrI hemacadraviracite triSaSTizalAkApuruSacarite mahAkAvye saptame parvaNi rAmanirvANagamano nAma dazamaH sargaH cha / / yAvanmo('nme )ro sugeghaH suragaNasahitaH kADati prauDhaharSa yAvat kallolalAle jaladhijalatale ratnarAzizvakArita yAvat vyomAgaNe(5)smin zazadharatapano bhrAmyato dhiSTayayuktI tAvannabAda gharo(5)yaM satatamiha budhaiH pustakaH paThyamAnaH 1 cha graMthAgraM sarvasaMkhyA 3794 saMbata 1661 vaSe() mAghasadi 15 garU laSataM / / chaH // // cha / zrI / / bhI / / zrI ||ch / N. B.- For further particulars see No. 257. 20 triSaSTizalAkApuruSacaritra Trisastisalakapurusacaritra (parva 7, sarga 1-8) ( Parvan VII, cantos 1-8) 1319. No. 260 1887-91. Size.-10 in. by 41 in. Extent.-- 27 folios ; 28 lines to a page ; 68 letters to a line. 30

Page #389
354 Jaina Literature and Philosophy [260. Description.- Country paper thin, rough, tough and white ; Jaina Devanagari characters ; very small, quite legible, uniform and very good hand-writing ; borders ruled in two lines in black ink; red chalk used to mark the numbering for the verses ; foll. numbered in both the margins; in the left-hand margins the title is written sometimes as padmacari and at times as padmacaritra ; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; fol. !' blank ; condition very good ; complete so far as 7 sargas are concerned ; the last (8th) incomplete ; the extent of each of them is as under :Sarga I foll. 1 to 3. II , 3 , 9" III IV ____v VI VII VIII , 27 , 27deg. 20 Age.-- Not modern. Begins.-- fol. 1 // // sakalAhatpratiSTA(SThA)namadhiSTA(STA)naM zivabhiyaH bhUrbhuvaHsvastu(stra)yIzAnamAhatyaM praNidadhmahe // 1 nAmAkRtidravyabhAvaiH punatAstrijagajjanaM kSetre kAle ca sarvasminnarhataH samupAsmahe // 2 // atha zrIsuvratasvAmI etc. in as No. 261. Ends.- fol. 270 ityAgraha para rAmaM jJAtvA ca soghA(?)vacana yAvat saumitriNA tAvasthApya dhArapANinA // 3 bharataM ca tathA yAtaM vratAya kRtanizcayaM jJAtvA sItA visalyAcAstavAjagmuH sasaMbamaH // 4 (104) This Ms. ends thus. N. B. - For further particulars see No. 258. 1 These first two verses accur in the beginning of TSPO (parranI, eanto1). 35

Page #390
261.] The Svetambara Narratives 355 triSaSTizalAkApuruSacaritra Trisastisalakapurusacaritra (parva 7, sarga 1-4) ( Parvan VII, cantos 1-1) 1258. No. 261 1886-92. Size.- Ios in. by 4g in. Extent.- 32 folios ; 16 to 18 lines to a page; 40 to so letters to a line. Description.- Country paper thin, tough and whitish; Jaina Deva nagari characters with occasional praSTamAtrAs: small. fairly legible, uniform and tolerably good hand-writing; 10 borders ruled in two to three lines in black ink ; foll. numbered in both the margins ; in the left-hand margin the title is written as zrIjanarAmAyaNa; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; fol. 1 blank; a portion on the right-hand side of fol. r" is kept blank probably with a view to decorating it with some illustration ; yellow pigment used for making corrections; complete so far as the four sargas are concerned; the extent oi each of them is as under :: ... Sarga I .. foll. 10 to 5 30 " II , 5 , 170 , 17 , 230 IV 23deg , 32deg. Black lines have been drawn on fol. 32 probably with the . intention of continuing this work. Age.-- Pretty old. Begins.- fol. 1deg 5 6 // aI bhatha bhIsuvatasvAmijidrasyAMjanAH 'harivaMzamRgAMkasya / tIrthe saMjAtajanmanaH / 1 / baladevasya padmasya viSNornArAyaNasya ca / prativiSNo rAvaNasya / caritaM parikIrtyate / 2 / etc. - fol. 3" ityAcAryazrIhemacaMdraviracite triSaSTizalAkApuruSacarite mahAkAve saptame parvaNi 'rAkSasa'vaMzopanirAvaNavarNano nAma prathamaH svaas)rgH|| cha / - fol. 17deg inyAcArya etc. digvijayo nAma dvitIyaH sargaH // cha / - fol. 23" ityAcArya etc. hanumadutpatti varuNasAdhano nAma tutIyaH sargaH // cha / 19

Page #391
5 10 15 20 25 30 356 Ends. fol. 32b bhrAtuvanavAsena | bharataH zalpito hRdi ajagAtuat(s)egg uod alikwangu): 11 20 saumitrimithilatAsahito ( ( ) tha rAmo gacchannatItya girimadhvani 'citrakUTa' / AsAiyata katipayairditra se rati dezaikadezamatra nisthita deva dezyaH || 28 (528) // la ityAcAryazrIhemacaMdraviracite triSaSTizalAkA puruSarAmacaMdra lakSmaNo caritre mahAkAvye saptamaparvaNi rAmalakSmaNotpattipariNayanagamano nAma caturtho sva ( sa ) vargaH // cha : zrIH N. B. For other details see No. 258. triSaSTizalAkA puruSacaritra ( parva 8, sarga 1 - 12 ) No. 262 jaina Literature and Philosophy "" Size. 10 in by 4 in. Extent. 122 folios; 13 lines to a page; 52 letters to a line. Description. Country paper thin, tough and greyish; Jaina Devanagari characters with occasional arts; small, quite legible, unitorm and good hand-writing; borders ruled in four lines in black ink; red chalk used; foll. numbered in the right-hand margin; fol. 1' blank; so is fol. 122; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; yellow pigment used for making corrections; corners and edges of some of the foll. gone; condition on the whole tolerably good; extent 4990 slokas; complete; this 8th parvan is divided into 12 sargas as under : Sarga I foll. jb to II III IV V 39 21 "2 >> ;; " 22 Trisastisalaka purusacaritra (Parvan VIII, cantos 1-12) 222. 1902-1907. 15a 306 58a 596 .. "" ** 11 15" 30b [261. 580 596 706

Page #392
262.] Sarga 31 "" 39 33 wr " Age. -- Fairly old. Author. The Svetambara Narratives VI foll. VII VIII IX X XI XII "3 "} " "" "" " 70b 833 94 97 1071 114b 118b to 19 " " " 15 "" 83" 945 97" 107" 114b 118h 122". P. 342. Subject. The Life of Lord Nemi and those of Pandavas. Begins. fol. 1 || GO || aI namaH || OM namo vizvanAthAya janmato brahmacAriNe / kalInacchedane'riSTanemaye // 1 zrInararhataH kRSNaviSNo rAmasya sIriNaH / jarAsaMgha pratiharezvaritaM kIrttayiSyate 2 'jaMbUdvIpe (5) caitra kSetrevAsti 'bhArate' / acalAyAH ziroralaM nAmnA (1) balapu. . puraM / 3 / tatrAbhUd vikramadhanAbhidhAno vasudhAdhavaH / yathArthanAmA samare vikramAkrAMtazAtratraH / 4 etc. Kalikalasarvajna Hemacandra Suri. For details see 357 fol. 15" ityAcAryazrIhemacaMdra viracite triSaSTizalAka ( kA) puruSacarite mahAkAvye aSTamaparvaNi zrI ariSTanemipUrvabhavarNano nAma prathamaH sargaH // 1 // fol. 30deg ityAcArya etc. zyAmAdimu (ma) ko salAMtamAnuSIvidyAdharIpariNayano nAma dvitIyaH sargaH // // cha // 586 fol. 83' itya!cArthaM etc. rukmiNyAdipariNayana pAMDavadraupadI svayaMvarapradyuma caritravarNano nAma SaSTaH sargaH // // 6 // fol: 97* ityAcArya etc. sAgaracaMdropAkhyAne uSAharaNabANavacano nAma bhaSTamaH sargaH // 8 // 5 25 fol. 58* ityAcArya etc. natratIpariNayanatatpUrva bhava varNano nAma tRtIyaH sargaH // // 3 // fol. 5)* ityAcArya etc. vasudeva hiMDirNanA nAma caturthaH sargaH // 4 // fol. 704 ityAcArya etc. rAmakRSNa ariSTanemi janma kaMsavadhadvArakAnivezakarttano nAma paMcamaH sargaH // 5 // Io 15 fol. 97deg ityAcArya etc. sAMvapradyumnavivAha jarAsaMdhatradhakIrttano nA[ nA ]ma saptamaH sargaH // 30 20

Page #393
358 Jaina Literature and Philosophy [262. -- tol. 107 inyAcArya etc.ariSTanemikaumArakrIDAdIkSAkevalotpattivarNano nAma nabamaH sargaH // 9 // -- fol. 114deg ityAcArya etc. draupadIpratyAharaNagajasukumArAdicaritavarNano nAma dazaH sargaH // 10 // - fol. 118' ityAcArya etc. 'dvArakAdAyakRSNoSasAta kIrtano nAma ekAdazaH sargaH // // 11 // Ends..- fol. 1220 AkarNya tadguruzuvo vimalAmIyuH / pAMDoH sutA vidadhire(5)nazanaM ca tatra / / utkevalAH zivamazuddaSadAtmana' nu sA brahmalokamagamat prmrdhidhaam(m)| 27 // dAvizo(5)hannatha ghacatavamaH zArDabhRcchIrapANi stadverIvetyatulamahasatkIrtitAH parvaNIha catvAro(5)pi pravacanadizaM samyaguThIkSya yeSA ke ko(5)pi zrutiSazya gato vismayAya trilokyaM // 128 / / ityAcAryazrI hemacaMdraviracite triSaSTizalAkApuruSacarita mahAkAvye aSTamaparSANi baladevasvargagamananeminirmA(vA)NapAMDavanirmA( )NavarNano nAma dvAdazaH sargaH / / samApta cedamapTama parva // graMthAnaM // 4990 0 // cha / ch|| etc. Reference.- Published by the Jaina Dharma Prasaraka Sabha as Part V of TSIC. Its Gujarati translation, too is published by this Sabha. Its English translation by Miss Helen Jolinson is published in GOS as No. 139 in A. D. 1962. .. triSaSTizalAkApuruSacaritra Trisa stisalikapurusacaritra (parva 8, sarga:-12) ( Parvan VIII, cantos 1-12) No. 263 353. 1871-72. Size.- 9% in. by 4t in. Extent.- 106 folios ; 17 lines to a page : 40 letters to a line. Description.- Country paper thick, tough and white; Jaina Deva nagari characters; small, quite legible, unilorm ard very good hand-writing ; borders ruled in two lines and edges 30

Page #394
263.] The Svetambara Narratives 359 27. 524 621 93. 1020 in one in red ink ; red chalk used ; foll. numbered in the right-hand margin ; fol. ! blank ; yellow pigment used for making corrections; condition very good ; extent sooo Sickas ; complete; in all there are 12 sargas of the 8th parvan; the extent of each of them is as under : Sarga I foll. 1 to 4' , II , 14 , III , 27 // IV , 51 v , 52 , , VI , 62 , 73 , VII , 73 , 820 VIII , 83 , 85" IX , 8 , ___x , 93 , 99 ,, XI , 992 , XII , 1030 , Age.- Not modern. Begins.- fol. 1 // 6 // // namaH zrIneminAthAyaH OM namo vizvanAthAya etc. as in No. 262. Ends.- fol. 106. __ Aka vyaM taduruzuco etc. up to vismayAya trilokyaM 128 cha as in No. 262. This is followed by the lines as under: ityAcAryazrIhemacaMdrasUriviracite triSaSTizalAkApuruSacarite mahAkAvye'STamaparvaNi baladevasvargagamano nAma nirvANapAMDavanirvANavarNano 25 nAma dvAdazamaH sva(sargaH 12 // ch|| . sa(saM)vvanmunIrAmASTacandra(1837)mite ()de azvinasitanavamyAM tithI bhRguvAsare zrInemicaritraM saMpUrNatAmagamat / 1 // zrImanmahopAdhyAyajIzrIkalyANasuMdaragaNigajendrAna tacchiSyapaMzrIlabdhisundarajidUgaNivarA 3 tacchiSyapaMzrISusyAlasundarajI tacchiSya 30 paMmvaSatsuMdareNa lipIkRta zrI puSpadaMtI'madhye caturmAsikasthitena // bhIrastu / zrIkalyANamastu / / zubhaM bhavatu // leSakapAThakayoH zubhaM bhayAstAM // bhIH // graMthAgraMtha / paMcasahasaH 5000)pramitA // 1 // 1060.

Page #395
S 10 15 20 25 30 360 Jaina Literature and Philosophy udakAnala caireibhyo mUSikebhyo tathaiva ca rakSaNIyaH prayatnena yataH kaSTena likhyate 1 yAva' meruH pavitro jinavarajanana snAnasaMbhUto ye aig fer famraftviariaguei fafzurum fagr yAvaleokaprakAzaM sakalajana hitaM jaina siddhAMta stra vidvadbhivAcyamAnazviramatra nitale pustakastAvadAstA // 2 // zrIrastu || kalyANamastu N. B. For additional information see No. 262. triSaSTizalAkA puruSa caritra ( parva 8, sarga 1 - 12 ) No. 264 Size.9 in. by 41 in. Extent. 108 folios; 15 lines to a page; 45 letters to a line. Description. Country paper thin, rough and greyish; Jaina Devanagari characters with frequent garais; sufficiently big, quite legible, uniform and beautiful hand-writing; borders ruled in two pairs of lines in black ink; red chalk used to mark the numbering of the verses; foll. numbered in the right-hand margin; fol. 1 blank; so is fol. 108b; there is some space kept blank in the centre of the num bered and the unnumbered sides as well; it is so kept that it forms a design; edges of the last fol. slightly gone; complete; it contains 12 sargas; the extent of each of them is as under : Sarga I II III IV V VI VII VIII IX 19 "} rd " dr 3 d. " fol. Ib "" 31 "} Trisastisalakapurusacaritra (Parvan VIII, cantos 1-12) 159. 1872-73. 21 "> 13 "" "" 13b 4 - 109nytsaa 27* 522 62a 72b 83a 85* to fol. 13 27 51* : 8 "1 dw "3 " " =====*** [263. 52 624 726 832 85* 94*

Page #396
265.] Sarga "" dr Ends. fol. 108a The Svetambara Narratives X XI XII fol. 94 101 105* "" triSaSTizalAkApuruSacaritra ( parva 8, sarga 1 - 12 ) No. 265 dr to fol. 101* 91 105a 108 Age. Samvat 1576. e Begins.-- fol. 1h 0 // OM namo vItarAgAya | a || f1 etc. as in No. 162. wr dr AkarNya etc. up to vismayA trilokyaM / / 128 practically as in No. 262. This is followed by the lines as under: "} ityAcAryazrI hema caMdra viracite triSaSTizi (za) lAkya (kA) puruSacarite mahAkAvye | aSTamaparvvaNi baladevasvargagamanazrI nominiNavarNano nAma dvAdazaH sargaH samAptaM // cha saMpUNI ceda (daM) zrInemicaritraM / grathAgraM sahazrva 60 [ 2 ] 90 madhikA || cha / saMvat 1576 varSe cetre badi 7 bhuma // cha // 361 N. B. For additional Mss. see Jinaratnakosa (Vol. I, p. 217) - and for further particulars see No. 262. Trisastisalakapurusacaritra (Parvan VIII, cantos 1-12) 352. 1871-72. 10 Size. 10 in. by 43 in. Extent. 103 folios; 17 lines to a page; 50 letters to a line. Description. Country paper thin, tough and white; Jaina Devanagari characters with occasional garars; small, fairly legible, uniform and tolerably good hand-writing; borders of most of the foll. ruled in two pairs of lines; in some cases, in three lines in red ink; red chalk used to mark the numbering of the verses; foll. numbered in both the margins; fol. 1 blank; so is fol. 103; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; some of the foll. have stuck 30 together probably due to the presence of gum in the ink used; some body has made a careless attempt to separate 48 J. L. P.] 15 20 25

Page #397
362 Jaina Literature and Philosophy [265. IV them and that has damaged the Ms; condition on the whole tolerably fair ; complete ; there are all the 12 sargas of the eighth purvan ; the extent of each of them is as under :Sarga I foll. 10 to 14a , 4 , 27" , III 270 , 521 52453 ,, , 64 , VI , 64 , 74 (?) , VII , 74 (8) , 834 ,, VIII , 83 , 85 , IX , 8 , 92* ,, X , 9: , 97" ,, XI , 97b , 100deg ,, XII , 100 , 103". Anusvaras are presented in an ornamental way. Vide foll. 26 and 27a; in the left-hand margin the title is written as zrInAmecaritraM. 20 Age.- Samvat 1704. Begins.- fol. 10 // 6 // ! zrIgurubhyo namaH / zrInijAya namaH / / OM namo vizvanAthAya etc. as in No. 262. Ends.- fol. 103* AkarNya tadguruzuco etc. up to vismayAya trilokyo 128 as in No. 262. This is followed by the lines as under : ityAcAryazrIhemacaMdraviracite triSaSTizi(za)lAkApuruSacarite mahAkAvye'STamaparvaNi baladevasvargagamananeminivA( )NapAMDavanirdhANato nAma dvAdazaH sargaH samAptaH // zubhaM bhavatu zrIrastu saMvat 1704varSe posavadi 13 budhe / sA(sa)kala mRvihitasAdhusiromaNigaNibhajeMdraga zrIvadharma saubhAgya ziSyapaM.vijaya ... nA lepI AtmArthe vinaM paropakArAya zubhaM bhavatu // zrI // cha / zrI / / N. B.- For further particulars see No. 262. 30

Page #398
266.] triSaSTizalAkApuruSa caritra ( parva 8, sarga 1 - 12 ) No. 266 Size. 10 in. by 43 in. Extent. 142 folios; 13 lines to a page; 42 letters to a line. Description. Country paper somewhat thick, tough and white; foll. 46 onwards are on a thin paper; Jaina Devanagari characters with occasional gears; big, quite legible, fairly uniform and tolerably good hand-writing; borders 10 ruled in two pairs of lines in black ink; space between these pairs coloured red; red chalk used to mainly mark out the numbering of the verses; foll. numbered in the right-hand margin; unnumbered sides have a spot in red colour in the centre and the numbered, in each of the two margins, too; fol. 1 blank; condition very good; complete there are 12 sargas in all; the extent of each of them is as under : Sarga 39 dw I foll. 1b to 17b II III 36a IV 67b V 69b VI 83a VII 98a VIII [[12 IX 1142 X 1252 XI 1336 XII 1386 Yellow pigment used at times; some of the foll. have stuck together owing to the presence of gum in the ink used. dr 39 dw "} dr "" dr The Svetambara Narratives ". dr Age. Not modern. 256 dr 35 .. 21 "" 19 23 33 "" Trisastigalakapurusacaritra (Parvan VIII, cantos 1-12) 17b .. dr : 37 d. " dw .. 13 dr >1 >> 708. 1892-95. 364 363 676 6yb 83* 98a Tija 114 125a 1336 138b 1426. 15 20 25 30

Page #399
S 10 15 20 25 30 364 Jaina Literature and Philosophy Begins. - fol b e50 // OM namo zrIvItarAgAyaH // // 1 etc. as in No. 262. Ends. fol. 1420 AkarNya tadguruzuco etc. up to vismayAya trilokyAM // 128 as in No. 262. This is followed by the lines as under :ityAcAryazrI hema caMdraviracite triSaSTizalAkApuruSacarite mahAared aSTarvaNi baladeva svargagamana (na) ne minirvANavarNano nAma dvAdazaH sargaH // // cha || cha || zubhaM bhavatu // 11 N. B. For other details see No. 262. -- triSaSTizalA kApuruSa caritra ( parva 8, sarga 1 - 12 ) No. 267 Size. 10 in. by 32 in. Extent. 120 folios; 13 lines to a page; 46 letters to a line. Description. Country paper thin, tough and white; Jaina Devanagari characters with frequent ggarars; small, quite legible, uniform and very good hand-writing; borders ruled in three lines in black ink; red chalk used to mark out the numbering of the verses; several foll. numbered in both the margins; fol. 1 blank; so is fol. 120b; yellow pigment occasionally used for making corrections; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; edges of the first fol. slightly gone; condition on the whole very good; complete; 12 sargas in all; the extent of each of them is as under : Sarga dr 6:6: dr I foll. 11 III IV V VI 22 dr wr "" "" Trisastisalakapurusacaritra (Parvan VIII, cantos 1-12) 707. 1892-95. b 14b 29b 566 58a 686 to * * dr "" dr 14b 29b 566 [266. 58* 68b 8:

Page #400
IX 105 1126 1160 10 268.] The Svetambara Narratives 365 Sarga VII foll. 816 936 VIII , 930 , 96deg 96deg ,, x , 10 , 1123 XI , XII , 17 , 120'. Fol. 22deg is blank but the continuity is not disturbed. White paste is rarely used to make the portion illegible. On fol. 120' we have nemicaritraM in a corner of this fol. Age.- Pretty old. Begins.- fol. 1deg 5 6 // // zrIsAradAyai namaH OM namo vizvanAthAya etc. as in No. 262. Ends.-- fol. 120* AkarNya tadguruzuco etc. up to vismayAya trilokyAM / / 128 // cha | as in No. 262. This is followed by the lines as under :___ ityAcAryazrIhemacaMdraviracite triSaSTizi(za)lAkApuruSacarite mahAkAvye aSTamaparvaNi baladevasvArgagamananominirvANavarNano nAma dvAdazaH srgH|| samAptaH // zrI // aSTama parva samAptamiti / / 1 graMthAgaM aSTamazatAbhyaghikacatvA(ri) sahasrANi (4800) saMkhyAkaM // cha // zrI / / yAdRzaM pustake dRSTaM / ta(tAdRzaM likhitaM mayA yadi zuddhamazuddhaM vA / mama doSo na dIyate // 6 // zrIrastu | kalyANamastu / / / / zubhaM bhUyAt / 1 // Then in a different hand we have : ___ munisaumyasAgarasyedaM pustakaM graMthAna cyAra hajAraH // N. B. - For further particulars see No. 262. 15 20 25 1259. triSaSTizalAkApuruSacaritra Trisastisalakapurusacaritra (parva 8, sarga 1-12) ( Parvan VIII, cantos 1-12) No. 268 1886-92. Size.- 134 in. by s4 in. Extent.- 9t folios ; IS lines to a page ; 58 letters to a line. 30

Page #401
366 Jaina Literature and Philosophy [ 268. Description. - Country paper thin, rough and grey; Jaina Deva nagari characters with frequent TEATTIS; small, quite legible, uniform and very good hand-writing ; borders ruled in two pairs of lines in black ink; yellow pigment profusely used in many a place for making corrections; red chalk used; foll. nuinbered in the right-hand margin ; sol, 1. blank ; there is some space kept blank in the centre of the numbered and the unnumbered sides as well ; strips of white paper pasted to fol. 1a; some foll. are smutty ; some slightly worm-eaten; condition on the whole tolerably fair; complete ; 12 sargas in all: the extent of each of them is as under : Sarga I foll. to 12a IX , 86a 800 X fol. XI foll. 86a ,, 892 XII ,, 899 916. A few lines at the end are written in a different hand writing. Age.--- Samvat 1299. Begins.- fol. 14 & 011 Bell A la garatg etc, as in No. 262. Ends -- fol. gib 3190f agraat etc. up to its #f: gara: Il gas in No. 262. This is followed by the lines as under : ANS AET3f1: 11 naMdanaMdaravi(1299)varSe zrIvikamamahIpate / ASADhazuklapaMcamyAM lileva guravAsare // 1 // 30 35

Page #402
269.] The Svetambara Narraratives 367 Then in a different hand we have : 'rAjadhanapura vAstavyazreSoSAsutanAthAnetAnAnabhiH // svapuNyArtha zrI. neminAthacarita munivimalagaNInAM vAcanArtha samarpitaM // vAcyamAnaM ciraM naMdata // zrIH / / zrIvijayadAnasUrIzvaraziSyAH khyAtacArukIrtibharAH / zrIvimalaharSavAcakamukhyA Asan jaganmAnyAH / 1 / tacchiSyamAlimANibhiH / mmgrvaackpurNdrainihitaa| zrImunivimalamunIMdrezcitkAze pratiriyaM jayatAta // 2 // N. B... For additional information see No. 262. triSaSTizalAkApuruSacaritra Trisastisalakapurusicaritra 10 (parva, sarga 4-12) (Parvan VIII, cantos 4-12) 1306. No. 269 1887-91. Size.-- 104 in. by 41 in. Extent.- 60 to 14+ 10=65 folios ; I lines to a page ; 35 to 45 15 letters to a line. Description.-- Country paper thin, tough and greyish, Jaina Deva nagari characters with frequent Aras; small, quite legible, fairly uniform and good hand-writing ; borders ruled in two pairs of lines in black ink ; red chalk used ; 20 foll. numbered in the right-hand margin starting from 60 and going up to 114 and then i to 10 ; these last 10 foll. are written in a bigger hand-writing and perhaps on a different sort of paper; condition very good; this Ms. starts with the fourth sarga and goes up to the 12th; the extent of these sargas is as under :Sarga IV foll. 602 ___to 616 623 720 VI ___72 , 8 VII 86 VIII ". . 98deg " . 107 " 96 970 IX 992

Page #403
368 Jaina Literature and Philosophy [269. Sarga X foll 1082 to 1146 __ _XI , XII , Total extent 4750 slokas. 5 Age.- Pretty old. Begins.- fol. 60deg 5 6 // sUrpakeNA(s)nyadA saptaH / sa jahe(s)dha pramodabhAk / jaghAna sUrpakaM muSTayA / sUpparkastaM mumoca ca // 1 'godA'yAM patitaH zauristIvA 'kollApure' yayau / SadmazriyaM padmaratharAjaputrIM vyuvAha ca // 2 etc. __Ends.-- fol. 9( 2nd set ) AkarNya etc. up to vismayAya trilokyo 128 as in No. 262. This is followed by the lines as under : ityAcAryazrIhemacaMdraviracite triSaSTizi(za)lAkApuruSacarite mahAkAvye aSTamaparvaNi baladevasvargagamano(na)neminirvANapAMDavanirvANavarNano nAma dvAdazaH sargaH 12 samAptaM cedaM zrImadariSTanemijinacAratraM // zrI. rastuH / / kalyANamastuH / sarvagraMthAyaM 4750 N. B.- For additional information see No. 262. 10 20 triSaSTizalAkApuruSacaritra Trisastisalakapurusacaritra (parva 10, sarga 1-13) ( Parvan X, cantos 1-13) 250.. No. 270 1873-74. Size.- 12 in. by sa in. Extent. 143 folios ; 12 lines to a page ; 45 letters to a line. Description.- Country paper somewhat thick, tough and white; Jaina Devanagari characters; small, fairly legible, uniform and very good hand-writing ; borders ruled in three lines and edges in two in red ink ; foll. numbered in the righthand margin; fol. la blank ; so is fol. 1486; yellow pig. ment used for making corrections; condition very good; complete ; 13 sargas in all; their extents are as under : 20

Page #404
270.] The Svetambara Narratives 369 Sarga I foll. 1 , II , 10deg 17 , , 17' 36* IV 15 , 5 , 61 VI , 616 , 74deg ____VII , 74 , ____VIII , 84 ,, IX , 99 " 107" x , 107deg ,, 120 ___XI , I120 , 128 ____XII , 128 , 139 XIII , 139 , 146. Age. - Sarivat 1937. Author.---'Kalikalasarvajna 'Hemacandra Suri. For details see p. 342. Subject.- Life of Lord Mahavira. Begins.- fol. 10 60 // zrIgaNezAya namaH / / namo durvArarAgAdivairivAranivAraNe etc. as in No. 271. Ends. - fol. 1466 tasminneva pure etc. up to trayodazo sargaH 13 as in No. 271. This is followed by the lines as under :ziSyo jaMbU(bu)mahAmuneH prabhava ityAsIdamuSyApi ca / ' zrIzayyaMbhava ityamuSya ca yazobhadrAbhidhAno muniH saMbhUto munibhadrabAhuriti ca dvau tasya ziSyottamA saMbhUtasya ca pAdapadmamadhuliT zrIsthUlabhadrAyaH 1 vaMzakramAgatacaturdazapUrvaratna___kosa(za)sya tasya dazapUrvadharo maharSi(:) nAmnA mahAgiririti / sthiratAgirIMdro jyeSTA(To)tiSat samajaniSTa viziSTalabdhiH 2 ziSyo'nyo dazapUrvabhRnsuniSo nAmnA suhastItyabhUd yaSAdAMbujasevanAt samuditaprAjyaprabodhe(dha)dikaH 47 1J.L. P.1 20 vo. 77 30

Page #405
370 Jaina Literature and Philosophy [270. cake saMpratipArthivaH pratipurazrA(yA)mAkaraM 'bhArate'___'sminnaH jinacaityamaMDitamilApRSTaM(STaM) samaMtAdapi [5]3 ajani susthitasupratibuddha i tyabhidhA(dhayA'')ryasuhastimahAmuneH zamadhano dazapUrvadharoM(5)tiSad __bhavamahAtarubhaMjanakuMjaraH4 maharSisaMsevitapAdasannidheH pracArabhAgAlavaNodasAgara mahAna gaNaH 'koTika' ityabhUt tato 'gaMgA'prabAho 'himavad 'gireriba 5 tasmin gaNe katipayeSvapi jAtavatsu sAdhUttameSu caramo dazapUrvadhArI uddAma tuMba(va)napattana'vajJa(ja)khAne bajjha(jaM) mahAmunirajAyata vajramUriH 6 durbhikSe samupasthite pralayavad bhImanva(tva)bhAjyanyadA bhItaM nyasya maharSisaMghamabhito vidyAvadAtaH paTe yo'bhyuddhatya karAMbujena nabhasA puryAmanaiSInmahA puryo maMca sabhikSadhAmani tapodhAmnAmasImnAM nidhiH 7 tasmAt 'vajrA'bhidhA zApA(5)bhUt 'koTi(ka)gaNadra(8)me 'uccanAgarikAmakhyazASAvitaSasodarA 8 tasyAM ca 'vana 'zAkhAyAM nilInamuniSaya(Tpa)vaH puSpagucchAyito gaccha' bhaMdra' ityAkhyayA(s)bhavat 9 dharmadhyAnasudhAsudhAMzuramalagraMthArtharatnAkaro __ bhavyAMbhoruhabhAskaraH smarakariponmArtha(? tha )kaMThIravaH gacche tatra babhUSa saMyamadhanaH kAruNyarAziyazo bhadraH sUrirapUri yena bhuvanaM sa(zu)bhairyazobhirnijaiH 10 zrImannemijineMdrapAvitazirasya dro sa saMlekhanAM kRtvA( 5 )do pratipanya(na)vAnanazanaM prAMte su(zu)madhyAnabhAk tiSThan zAMtamanAstrayodaza dinAnyAzcaryamutpAdaya nnuccaiH pUrvamaharSisaMyamakathA(:) satyApayAmAsivAna 11 bhImAna pradyumna sUriH zamasamajanitAnekabhavya prabodha staciGgaSyo vizvavizvaprathitaguNagaNaH prADaMmodakalpa:

Page #406
170.] The Svetimbara Narratives prINAti smAkhi( la )mA pravaca(na)jaladheru(n)terarthanIre - ___ rAtatya sthAnakAni zrutaviSayasudhAsArasadvayaM(dhyaM)ci viSvaka 12 sarvagraMtharahasyaratnamukuraH kallayANavallItaruH kAruNyAmRta sAgaraH pravacanavyomAgaNe bhAskaraH cAritrAdikaratnarohaNagiri(:) mAM pAvayan dharmarAH senAnIrguNasenasarirabhavacchikhya(pya)stadIyastataH 13 ziSyastasya ca tIrthamekamavaneH pAvidhya kRjaMgamaM syAdvAdavidazApagAhimagirividhi)zvaprabodhAryamA kRtvA sthAnakavRttizAMticarite prApta prasiddhi parAM sUri ritapaHprabhAvavasatiH zrIdevacaMdro(s)bhavat 14 AcAryoM hemacaMdro(s)bhUt tatpAdAMbujaSaTpadaH tAprA(pra)sAdAdadhigatajJAnasaMpanmahodayaH 15 jiSNuzvedidazArNamAlavamahArASTrApA(pa)gaMtAMkurUna siMdhUnanyatamAMzca dugra(ga)viSayAna do vIrya zaktayA hariH caulukAH paramAIto vinayavAna zrImUlarAjAnvayI taM natveti kumArapAlapRthivIpAlo(5)bavIvekadA 16 pAparddhiAtamadyaprabhRti kimapi yannArakAyunimittaM tat sarva ninimikSe (no)pakRtikRtadhiyAM prApya yuSmAkamAjJA svAmiyo niSiddhaM dhanamasutamRtasyAtha muktaM tathAI caityairutaM taM)sitA bhurabhavAmiti za(ma)maH saMprate. saMpratIha 17, 20 asmatpUrvajasiddharAjanRpaterbhaktirapRzA(zo) yAccha(zca)yA sAMgaM vyAkaraNaM savRttisugamaM carmavata(taH) purA maddhatoratha yogazAstramamalaM lokAya ca dvacAzrayaM chaMdo(Da)laMkRtinAmasaMgrahamukhAnyanyAni zAstrANyapi 10 lokopakArakaraNe svayameva yUyaM [de] sajjAH stha yadyapi tathApyahamarthaye(5)da: mAdRgR(ga)janasya paribodhakRte zalAkA puMsAM prakAza(ya)ta(ti) vRttamapi viSaSTeH 19 tasyoparodhAditi hemacaMdrA cArya(:) zalAkApura(ru)tivRttaM dhammopadeza(ze)kaphalapadhAnyaM nyavIci (vi)zaccArugirAM prapaMce 20 'jaMbU'dvIpAraviMde kanaka'girirasAvastu(inu)te kANekAvaM yAvayyA(dU yA)vaJca dhatte jalanidhiravaneraMtarIyatvAce(6)

Page #407
10 15 20 25 30 372 Jaina Literature and Philosophy araq darq(x)Pii(ur) aciogaui graaza1qzaa kAvyaM nAmnA zalAkApuruSacaritamityastu jaitraM dharitryAM 21 iti SaSTizalAkA caritavarNana mahAkAvyagatazrImat mahAvIracaritraM samAptamiti zubhamastu saMvat 1137 prathama ASADha vadI 14 li. vyAsa navalA 'jayazIla meru' madhye samastu cha cha Reference. Published by the Jaina Dharma Prasaraka Sabha in V. S. 1965. This Sabha has published its Gujarati translation, too. Its English translation along with notes etc., by Miss Helen Johnson is published in GOS as No. 140 in A. D. 1962. For additional Mss. see Jinaratnakosa (Vol. I, p. 306). N. B. For further particulars see p. 344. triSaSTizalAkA puruSacaritra ( parva 10, sarga 1 - 13 ) No. 271 Size. 103 in by 4 in. Extent. Description. [ 270. Trisastisalakapurusacaritra (Parvan X, cantos 1-13) 1260. 1886-92. 107-2105 folios; 15 lines to a page; 54 letters to a line. Country paper somewhat thick, tough and white; Jaina Devanagari characters with occasional IRIS; small, quite legible, uniform and beautiful hand-writing; borders ruled in three lines in red ink; numbers for the verses and their dandas and the last two lines written in red ink; foll. numbered in both the margins; in the left-hand margins the title is indicated in various ways such as mahAvIrava, mahAvIracari and mahAvIracaritra ; yellow pigment used for making corrections; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; fol. 1 blank except that the title fafEIG59at is written on it; bits of paper pasted to fol. 1a; condition on the whole good; complete; 13 sargas in all; the extent of each of them is as under :

Page #408
7.] The S vetambara Narratives .33 to Sarga " , , I II II IV foll. " , , 7* 11 23 I 23 , , , , 40 , VI VII VIII IX X ., , , " , , , 57 69* 75 , XI " 17 920 101b XII , XIII , 101 , 107". Foll. 28 and 30 are missing. Age.-- Pretty old. Begins.- fol. b 5 60 // namaH siddha // zrIgurubhyo namaH / / namo durvArarAgAdivairA(ri)vAranivAra(ra)Ne / arhate yoginAthAya / mahAvIrAya tAyine // 1 // athAsya devadevasya / devAsuranirAcitaM / caritaM kIrtayiSyAmi / puNyavArisarovaraM / / 2 // asyaiva 'jabUdvIpasya pratyaga videh'bhuussnne| vijaye(5)sti 'mahAya' / 'jayaMtI' nAmataH purI // 3 // -- tol. 7* ityaacaaryshriihemcNdrvirti(cite)| triSaSTizi(za)lAkApuruSacarite ____ mahAkAvye dazamaparvaNi / zrImahAvIrapUrvavarNano nAma prathamaH sargaH // 7 // - fol. 11* ityAcArya etc. zrImahAvIrajanmapravrajyAvarNano nAma dvitIyaH sargaH // , -- fol. 23deg ityAcArya etc. zrImahAvIraprathamaSaTvarSachadmasthavihAravarNano nAma tRtIyaH sabhaH - fol. 40" ityAcArya etc. zrImahAvIra kevalajJAnacaturvidhasaMghotpattivarNano nAma paMcamaH sargaH

Page #409
10 374. Jaina Literature and Philosophy tat. - fol. 50* ityAcArya etc. zreNikasamyaktvalAbhamakumAranAMdeSeNapravrajyAvarNano nAma SaSThaH sargaH // 7 // - fol. 57' ityAcArya etc. vve(ce)llA(la)NAyogyaekAtaMbhaprAsAdanirmANAmraphalA paharaNazreNikavidyAgrahaNaduggaMdhakathA / AdrakakumAravarNano nAma saptamaH svrg:|| - fol. 63' ityAcArya etc. RSabhadattadevAnaMdApravrajyAjamAligozAlakAvipatti bhagavadArogyavarNano nAmASTamaH sargaH // - fol. 75deg ityAcArya etc. hAlikaprasannacaMdradadurAMkadevazreNikabhAvitIrtha karatva / saalmhaasaal|gautmaassttaapdrohnn amma(mba)la(Da)sulasAcarita. varNano nAma navamaH sargaH // - fol. 79deg ityAcArya etc. dazArNabhadrazAlibhadradhanyakacaritavarNano nAma dazamaH svargaH fol. 92b ityAcArya etc. rohiNeyaabhayakumArApahAraudAyanacaritapradyota. baMdhaudAyanApravrajyAvarNano nAma ekAdazaH svargaH - fol. 101 ityAcArya etc. bhAvikumArapAladevacaritaabhayapravrajyAkUNikacarita udAyirAjyazrImahAvIrakevalIvihAravarNano nAma dvAdazaH svargaH // Ends.- fol. 107 tasminneva pure sudharmagaNa (ta) kSINASTakarmA kramAt / turyadhyAnadharo punarbhavamagAdadvaitasaukhyaM padaM / pazcAdaMtimakevalI kSititale zrIvIramArgAgraNI ghamma bhavyajanAna prabodhya suciraM jaMbUprabhuzcAnyadA / / 84 // trailokye(5)pi hi sAtvikaSvanavadheH prArajanmamokSAvadhiH / zrImadavArajinezvarasya caritaM ko vaktumIzo'khilaM ? / / astAghasya tathApi hi pravacanAMbhodhegRhItvA lavaM / kiMcit ki(kI)rtitamIdRzaM nanu mayA svAnyopakArecchayA / 285 ' ityAcAryazrIhemacaMdraviracite triSaSTiAza(za)lAkApuruSacarite mahAkAvya dazamaparvaNi zrImahAvIranirvANagamano nAga trayodazaH sargaH // 6 // samApta cedaM dazama parva / paripUrNamidaM triSaSTizi(za)lApuruSacaritaM mahAkAmyamiti // zubhaM bhavatu // kalyANamastuH / / 20

Page #410
372.] The Svetambara Narratives 375 Then in a different hand we have : raMgavijaya paM / zrIvijayaharSaga / zi / ga / raMgavijayanI prati bhaMDAri {kI // pra10 N. B.-- For further particulars see No. 270. s 10 15 triSaSTizalAkApuruSacaritra Trisastisalakapurusacaritra (parva 10, sa. 6-7) ( Parvan x, cantos 6-7) 246. No. 272 1873-74. Size.- 10 in. by 4g in. Extent.- 36 folios ; 15 lines to a page ; 34 letters to a line. Description.- Country paper thin, rough and white; Jaina Deva nagari characters ; small, quite legible, uniform and very good hand-writing ; borders ruled in three lines and edges in two in red ink; red chalk used; most of the foll, numbered in both the margins; in the left-hand margin the title is written as zreNikacaritra; fol. !' blank ; so is fol. 360; yellow pigment used while making corrections ; condition very good; complete so far as sargas 6 107 of the loth ( last) parvan are concerned ; the extent of each of them is as under :___Sarga V I foll. 10 to 13 VII , 13 , 36. Age.- Samvat 1876. Begins.- fol.ri || 60 // arhataH prathayanu maMgalamamI zrRMgArayaMtaH sadA pAdAMbhojarajaHkaNaiH kSitibaddhU kAzmIralezairiva / tatvAthai kavidA suvarNaracanAmAkarNya yeSAM mukhAta tattadbhAvanayA rasena labhate kalyANakoTiM jnH1|| ciMtAtItaphalapradaH sa dizatu zreyo yugAdiprabhu bhaijurjanmani yasya kalpataravaH sarve(s)pyugAdAnatA netthaM cet kathamanyathA basumatamasminnalaM kurvati / trailokyekagurau na gocaramamI jagmurjagaccakSuSAM // 2 // 20 30

Page #411
376 Jaina Literature and Philosophy [272. - fol. 13" ityAcAryazrIhemacaMdraviracite triSaSTizalAkApuruSacarite mahAkAvve dazamaparvaNi zreNikasya samyakatvalAbhameghakumAranAMdiSaNapravadyA( jyA). varNino nAma SaSThaH srgH|| Ends.-- fol. 350 zrIvIrasvAmino dharmadezanAmamRtopamA AcamyAcamya sa sudhIrAtmAnaM paryapAlayan(ta) 36 caturyutAzItisahasravarSI ratnaprabhAyA niyataM nayitvA zrIzreNikaH kSAyikadarzanAnu ___ bhAvena bhAvI kila tIrthamAthaH 837 ityAcAryazrIhemacaMdraviracite triSaSTizalAkApuruSacarite mahAkAmye dazamaparvaNi zreNikakUNikaparalokagamanavarNano nAma saptamaH sargaH samAptaM zreNikacaritraM / saMvat 1876 varSe mitI vaizASa vada 5 paMcamItithau liSatAM zrI'vRhatparatara gacche zrIjinakuzalasarazApAyAM kSemakIrta(ti)saMtA. nIyopAdhyAyazrIrAjasomajIgaNi tatsiSyaprazrItatvavallabhajI muni tatsiSya vA zrIprItavilAsa gANi tatsiSya paM pra zrIdharmasuMdarajI muni tasidhyapaMprIamRtasumudrajI muni tatbhrAtapaMprazrIlAbhasamudrajI muni ziSya paM bAlacaMda liSatAM guruprasAdena // N.B.-- For other details see No. 270. 20 dazArNamadrarAjarSirAsa Dasarnabhadrarajarsirasa 1483. No. 273 1887-91.. Size.-- 101 in. by 48 in. Extent.- 5 folios ; [4 lines to a page ; 32 letters to a line. Description.- Country paper tough and white; Devanagari chara cters; bold, big, legible and tolerably good hand-writing; borders ruled in two lines and edges in one in red ink; red chalk and yellow pigment used ; numbers for foll. entered twice as usual ; fol. 1a blank; complete ; composed in Samvat 1757 in Medata ; condition very good. 25

Page #412
377 2735 The Svetambara Narratives Age.- Not quite modern. Author.- Dharmasimha, alias Dharmavardhana, pupil of Vijaya harsa Vacaka of the Kharatara gaccha. His additional works are as under : (a) gIta (29) RSabhanAthagIta covIsa jinanAM covIsa gIta nemi-rAjImatI-gIta (4) - (b) copai (4) amarasena-verasena-copaDa V.S. 1724 dambhakriyA-copaDa V. S. 1744 zanizcara-vikrama-copada zreNika-copa V. S. 1719 (c) bAvanI (2) dharmabAvanI V. S. 1725 prAstAvika chappaya bAvanI V.S. 1753 (d) rAsa (2) amarakumAra surasundarI-rAsa v. S. 1736 zIlarAsa (e) stavana (11) aTTAvIsa-labdhi-stavana V.S. 1722 AloyaNA-stavana V. S. 1754 caudaguNasthAna-stavana V. S. 1729 cauryAsI-AzAtanA-stavana cauvIsadaNDakavicAragarbhita-stavana V. S. 1729 pArzvajinastavana (2) pistALIsaAgamastavana vAmAnandanastavana bIsaviharamANajina-stavana V. S. 1729 samavasaraNavicAragarmita-stavana Besides he has composed the following works :covIsI V. S. 1771 prAstAvika kuNDaliyA V.S. 1734 sajjJAya - savA so zIkha 48 1J. L.P.] 30

Page #413
378 Jaina Literature and Philosophy [273. His Sanskrit works are as under :bIrabhaktAmara ___V.S 1736 vIrabhaktAmaravRtti SaDbhASAmayapArzvajinastavana Subject. The life of king Dasarnabhadra narrated in verse in ___Gujarati. Begins.- fol. 1deg zrIgurubhyo nama | s vIra jinesara baMdinai | praNamuM gotamAya / ehanau sAsana Aja e / sahuM jIvA sukhadAya // 1 // etc. madaharasuti zivadharama mai / yo tiNa pramatAva / dasAraNabhadrA kIdha diDa / bhagavaMta Upari bhAva // 4 // etc. Ends.- fol.st saMvat satare me satAvane ( 1757) 'mehatai' nagara mahA(jhA)ra / caumAme gaNadhara zrIjiNacaMdajI sujasa kAla)hai saMsAra / / 5 // koha. bhaTTArakIyA 'svaratara' gacha bhalA / sASAM jinabhadrasUra vAcaka vijayaharaSa vapatA dharu / parasigha puNyapaDUra / / 6 // koi0 tehane ziSya munivara tavyo / zrIpAThaka dhru(dha)masiMha / zrIjinadharama tiko zrIsaMghane dyo mukha daulata dIha // 7 // koha. iti dasAraNabhadrarAjarSicatuHpadI saMpUrNa / liSataM jaikIsana 'pATTaNa nagaramadhye // shrii| shrii| Reference.- For extracts and additional Mss. see Jaina Gurjara Kavio (Vol. ll, p. 344 and Vol. III, pt. 2, p. 1317). In " rAjasthAna" a quarterly ( Vol. II, No. 2, pp. 1-22) the following article of Agarchand Nahta is published: - "rAjasthAnI sAhitya aura jaina kavi dharmavardhana". 20 dAnakalpadruma Danakalpadruma [dhanyacaritra] [ Dhanyacaritra ] No. 274 279. A. 1882-83. Size.- 104 in. by 4g in. Extent.- 27 folios ; IS lines to a page; 56 letters to a line.

Page #414
274.] The Sretambara Narratives 319 S 10 15 Description.- Country paper thin and greyish ; Devanagari chara cters with occasional Teas; borders ruled in four lines in black ink ; red chalk used ; several foll. slightly wormeaten ; edges of the first few foll. partly worn out; corners of the last four foll, somewhat gone; condition on the whole fair; foll. numbered as usual; fol. 270 blank; com plete ; exient about 1292 slokas. Age.- Samvat 1497. Author.- Jinakirti Suri, pupil of Somasundara Suri of the Tapa gaccha. For his another work see No. 65. For reference to him see Peterson Reports ( IV, p. 101 ). Subject.-- The text divided into nine chapters named as pallavas explains the importance of dana (charity ) by narrating the story of Dhanya in verse. The prose version of this was composed by a pupil of Mahopadhyaya Jnanasagara Gani. See B. B. R. A. S. ( Vols. III-IV, p. 439). Begins.-- fol. 1 || I 0. sa zreyastrijagaddhyeyaH zrInAbheyastanotu vaH yadupajJaM jayatyeSA dharmakarmavyavasthitiH / / sarvajJopakramaM dharmaH paramaM maMgalaM mavet / amo(so) caturdA tatrApi pUrve dAnaM prazasyate // 2 etc. - fol. 4' iti zrI'tapAgacchanAyakazrIparamaguruzrIsomasaMdarasUsivanayazrIjina kIrtiviracite zrIdhanyacaritrazAlini zrIdAnakalpadrume svarNalopArjano nAma prathamaH pallavaH / / - fol. 6" iti lakSadvayArjano nAma dvitIyaH pallavaH / - fol. 8deg iti 0 SaTSaSTikoTidravyAnayano nAma tRtIyaH plluvH|| - fol. II" iti suvarNasiddhividezaprasthAnavarNano nAma caturthaH pallayaH - fol. 13deg iti0 kanyAtrayapariNayo nAma paMcamaH pallavaH // -- fol. 18deg iti0 saubhAgyamajarIpariNayasvajanasamAgamavarNano nAma SaSThaH pallavaH // - fol. 21' iti* kanyAcatuSTayapariNayana rAjagRha pravezavarNano nAma saptamaH pllvH|| - fol. 24deg iti0 bAMdhavaprItiprAgbhavavarNano nAmASTamaH pallavaH / 20 30

Page #415
380 , Jaina Literature and Philosophy [274. Ends.- fol. 27 yasyaitAni phalAni dinyavibhavodAmAni zarmANyaho / mAnuSye bhunanAdbhutAni bubhuje shriidhnyshaaliidyii| devatve punariMdukuMdavizadAH sarvArthasiddheH shriyH|| mo'yaM zrIjinakAtito 'vijayate zrIdAnakalpadrumaH // 127 graMthAgraM zloka 1292 a. 17. iti zrIdhanyazAli sarvArthasiddhi prAptivarNano nAma navamaH pallavaH // saMpUrNo'yaM zrIdAnakalpadrumanAmA navapallavI. graMthaH / saMvat 1497 varSe mAgharvAda 8 bhUme maM. sAMgA likhitaM Then in a different hand we have : muniharSavijayena muktA prtiH| Reference.- Published in the D. L. J. P. F. Series as No. 9 in A. D. 1919. For additional Mss. see Jinaratnakosa (Vol. I, p. 172). 10 dAnakalpadruma Danakalpadruma No. 275 200.. . 1871-72 Size.- Iog in. by 4g in. Extent. - 29 folios; 15 lines to a page ; so letters to a line. Description.- Country paper thin and greyish ; Devanagari chara cters with pRSThamAtrAs: small, clear and good hand-writing: borders ruled in four lines in black ink ; space between the pairs coloured red ; red chalk used ; white paste, too; foll. numbered as usual ; complete up to the end; condition very good. Age.- Not modern. Begins. - fol. !" 5 6 // sa zreyanija(ga)dhyeyaH zrInAbheyastanotu vH| yadupajJaM jayatyeSA dharmakarmavyavasthiti // 9 // sarvajJopakrama dharmaH paramaM maMgalaM bhavat / asau 'caturdhA tatrApi pUrva dAnaM prazasyate // 2 // etc. Ends.- fol. 290 ... dAnasya vizvAtizape'pi hi dvayoH / .. stabImi dhanyaH svishessmetyoH| 2. a

Page #416
276.] The Svetambara Narratives priyASTakAyAM yugapat parityajan / babhUva zAlerapi sattvavRddhiH // 21 // AsaMvaMdrakule pUrve zrIjagaccaMdrasUrayaH / 'tapA'khyA(s)vApi yairyAvajjIvAcAmAmlakAribhiH // 22 // tadanvaye jagakhyAtavizuddhacaraNakriyAH / Asana guNAbdhayaH zrImadeva suMdarasUrayaH / / 23 // tatpaTTe vijayaMte zrIsomasuMdarasUrayaH / bhAgyaM guNAH kriyA yeSAM revAprAptA nijAgrabhiH (1) // 24 // tatpAdAMbuja geNa sUrizrIjinakIrtinA ayaM dhanyakathAzAlo dAnakalpadrumaH kRtaH // 25 // eSA sadoSA(upakRtiH svajAtau / paktiM prapede vizaderavAyAM / snAtvA ciraM paMDitasiMhadeva dhIdevanadyAM zritazuddhilakSmIH // 26 // yasyaitAni phalAni dijyavibhavo dAnAni zarmANya ho / ___ mAnuSye bhuvanAgutAni bubhuje zrIdhanyazAlIdayI / devarave punariMdukuMdavizadA 'sarvArthasiddheH' zriyaH / ___ so'yaM zrIjinakIrtito vijayate zrIdAnakalpadrumaH // 27 // graMthAyaM 1292 a. 17 iti zrI'tapAgacchAdhirAjazrIparamaguruzrIsomasuMdarasUri 'sarvArthasiddhi'prAptivarNano navamaH pallavaH / / N. B.- For further particulars see No. 274. 20 dAnakalpadruma Danakalpacruma sArtha with artha 1191, No. 276 1891-95. Size.- 11 in. by st in. Extent.- (text) 78 folios ; 6 lines to a page; 48 letters to a line. , - (com.) ,, ,, ; 1210 14 lines to a page; 6o letters to a line. Description.- Country paper tough and white; Devanagari chara. cters; big, legible and elegant hand-writing ; borders ruled in two lines and edges in one in red ink; red chalk and "

Page #417
5 to 15 20 25 30 382 Age. -- Samvat 1850. Author of the com. -- Not known. Subject. The text along with its explanation in Gujarati. Begins.- ( text ) fol. 1 // 60 // zrIgoDIjI satya hai // sa zreya trijagadRdhyeyaH zrInAbheyastanobhu ( tu ) va: yadu jayatyeSA dharmakarmavyavasthitiH // 1 // etc. 15 Jaina Literature and Philosophy [276. yellow pigment used; a piece of paper of the size of a fol. pasted to fol. 1* ; numbers for foll. entered twice as usual ; foll, 1(c) & 78b blank ; a strip of paper pasted to fol, 78b; both the text and its Gujarati explanation complete; condition very good. datte lakSmInidAnaM yo dAnamAnaMdataH kRtI | sa dhanya iva dhanyAtmA saMpadA jAyate padaM // 4 // etc. ( com. ) fol 1 e 50 zrIparamAtmane namaH etc. zrIrani dear che kalyANakArI che triNa jagatanA jIvane dhyAvA yoga cheM etc. --- --fol. 134 iti zrI' tapAgacchanAyaka zrI parama guru zrI somasuMdara sUrivineyazrIjinakIrtisUriviracite zrIdhanyacAritrazAlini zrIdAnakalpadruma svarNalakSopArjano nAma Apa lakSmI mUla evaM dAna prateM je DAhyo AnaMda thakI te dhannAnI pareM dhanya che AtmA jehano eho etc. prathamaH pallavaH // fol. 184 iti lakSadvayArjano nAma dvitIyaH pallavaH // etc. 0 " Ends. -- ( text ) fol. 774 ( text ) - AsaM 'caMdra' kule pUrva zrI jagaccaMdravarayaH / 'tapa' yAtrASi tadancayai jagatkhyAtavizuddhacaraNakriyA / vijvIvAcA mAmlakAribhiH // 22 // Asana guNAbdhayaH zrImadradeva suMdarasUrayaH || 23 || tatpaTTe vijayaMta zrI somasuMdarasUrayaH / bhAgyaM guNAH kriyA yeSAM reSAprAptAni jAgrati // 24 // tatpadAMbuja bhRMgeNa sUribhIjinakIrtinA / ayaM dhanyakathAzAlI dAnakalpadrumaH kRtaH // 25 // etc.

Page #418
bhA.] The Svetambara Narratives 383 iti zrIdhanyazAlibhadra' sarvArthasiddhi prAptavarNano nAma navama pallavaM samAptaM // iti zrIdhanAcaritraM s.||aN. 1292 akSara 17 // paM. zrI. 5 zrI. mohanavijayagaNi paM. zrI 5 nayasatka // tacchiSya paM. zrI5 rAjAvajayagaNi ta0 paM. zrI 5 rUpavijayagaNi liSitAM saMvat 1850 varSe caitrasudi5 dine zrI vArAhi nagare AtmAtheM liSitAM zrIdharmanAthazAMtinAthaprasAdAt / yAdRzaM etc. Ends.-- (com.) fol. 77' iti zrIdhanAcaritra adhikAra samAptaM / arthano graMthAgraMtha be (ha)jAra base chaha / sarve malIne sUtrArtha 3900 saMkhyA cha / saM0 1850 varSe caitra badi 5 dine paM. rUpavijayaga zrI vairATa'nagare / Reference.-- For a Ms. of the prose version in Sanskrit of this 10 ____metrical work see B. B. R. A. S. ( Vols. III-IV, p. 439). N. B.-- For further particulars see No. 274. 15 20 dAnaphalakathA Danaphalakatha (dANaphalakahA) ( Danaphalakaba ) No. 277 597 (a). 1884-86. Size.-- 104 in. by 4in. Extent.- 34 folios ; I4 lines to a page ; 42 letters to a line. Description.- Country paper rough and greyish ; Devanagari characters with occasional pRSThamAtrAs; big, clear and very fair hand-writing; borders ruled differently at different times; red chalk and yellow pigment used; condition very good; foll. nnmbered as usual ; complete. This Ms. contains an additional work viz. Astaprakarapujakatha commencing on fol. 3deg and ending on fol. 34deg. Age.- Samvat 1618. Author.- Not known. Subject.-Jirnapurna-sresthi-katha illustrating the efficacy of pAtradAna ( fol. 10-fol. 20 ) & Candanabalakatha ( fol. 26-fol. 3') on chapAtradAna.

Page #419
10 paDhamaM abhayavayANaM aNukaMpA dANamaha bhave bIyaM / tayaM ca nANadAnaM catthayaM mattadANaM ca // 1 // tatrAbhayaM pradAtuH paraloke tAvat svargApavargasaukhya nibaMdhanatvam etc. S Ends. fol. 3 tAM rudatIM dRSTvA ThaThA rAdhaya ( ? ) gatAH / itazva zrIvIraH SaNmAsa pAraNe AgAta kulmASAn caramadekA prathama sAdhvA // cha // 15 384 Begins.- fol 1 60 // digvijaya mahAkAvya No. 278 Size. -- ro in. by 44 in. -- Extent. - 48 folios; 16 lines to a page ; 48 letters to a line. Description.-- Country paper thin, brittle and greyish; Devanagari characters; small, clear and good hand-writing ; borders unruled; red chalk used; foll. numbered as usual; edges of the first two foll. slightly damaged; marginal notes on foll. 78, 82, 180, 19 4, 190 & 20; foll. 7, 88, 94, 9deg and 10 blackish ; foll. 10 & 11 partly worn out in the body; fol. 18 badly damaged at the corner; so is the case with foll. 42 & 43; a strip of paper pasted to fol. 48b; condition fair; complete. 20 Age. - Pretty old. Author. 25 30 Jaina Literature and Philosophy arhadgItA = tattvagItA udayadIpikA kirAta samasyApUrti [ 277. Mahopadhyaya Meghavijaya Gani, pupil of Krpavijaya Gani. His additional works are as under : candraprabhA = - hamakomurI Digvijayamahakavya 796. 1895-1902. digvijayaTippaNaka devAnanda mahAkAvya V. S. 1757 bohanAya (yuktiprabodhanATaka ) saTIka Not earlier than V. S. 1750 V. S. 1752 V. S. 1727

Page #420
278.] The Sv.timbara Narratives 385 10 dharmamaJjUSA pazcatIrthastuti saTIka sbaahaan praznasuMdarI brahmavodha bhaktAmarastotraTIkA bhaviSyadattakathA Not earlier than V. S. 17,0 mAtRkAprasAda V.S. 747 meghadUtasamasyAlekha Not earlier than V.S. 1727 ramalazAstra laghutriSaSTizalAmApuruSacaritra varSaprabodha = meghamahodaya Not earlier than V. S. 1732 vijayadevamAhAtmyavivaraNa Latest V. S. 1709 vIsAyantravidhi zAntinAthacaritra = naiSadhIya samasyA Not earlier than v.S. 171015 saptasandhAnamahAkAvya V. S. 1760 hastasaJjIvana = siddhajJAna hastasajavana TIkA haimazabdacAndrakA hamazabdaprAkriyA Over and above these works he lias composed some works in Gujarati. Subject.- This is a mahakavya consisting of 13 cantos with 'udayazrA' as the sanketa. This poem narrates the life of Vijayaprabha Suri. Begins --fol. 1. aiM hI zrI klI 8 zrI'vazvapArzvaparamezvarAya jagadeka dhIrAya namaH // // mvasti zrIsurAsurakSitibhRtAM vAllabhyamabhyasyati yatpAdabijasevanAparicayAdunnItapItayutiH tAruNAtizaya jagattrayajayaM rUpeNa ladhyA svayaM kAruNyAd bhagavAn ta nAbhitanayaH puSNAtu puNyodayaM 1 etc. - fol. " iti zrIdigvijayanAni mahAkAvye mahopAdhyAyazrI meghavijayagaNi viracite 'jaMbU'dvAyavarNano nAma prathamaH margaH 1 - fol. 6 iti zrI viracite zrIbharatavarNano nAma dvitIyaH sargaH 2 49 1J. L. PI 20 2 30

Page #421
386 Jarna Lilerature and Philosophy ( 278. -- fol. 9' iti zrI. vicite kathAnAyakavaMza mUlasya zrIvIrasya bhagavato digvi jaya ... tRtIyaH sargaH 3 - fol. 12" iti zrI digvijaya kathAnAyakagurodigvijayavarNano nAma caturthaH margaH -- lol. 15" iti zrI kathAnAyakasya uttarAzAvijayavarNano nAma paMcamaH sargaH 5 --- fol. 17" iti zrI kathAnAyakasya IzAnavidivijayavarNano nAma SaSThaH sargaH6 - fol. 20' iti zrI0 pazcimadigvijayo nAma saptamaH sargaH 7 / - fol. 24* iti zrI zivapurI sthita zrI zaMkhezvara'pArzvavarNano nAmASTamaH sargaH - fol. 28" iti zrI. prasthAnavarNano nAma navamaH sargaH // - fol. 33" iti nagaravarNano nAma dazamaH sargaH -- fol. 39* iti zrI. 'udayazrI'kalite pUrva digaprayANavanabhavananagaramArgavarNano nAma ekAdazaH sargaH // - fol. 44" iti zrI. udayadeg pUrvApattanavihAranagarazrI ciMtAmaNi'pArzvaprabhustuti varNananAmA dvAdazaH sargaH Ends.-- fol. 480 evaM devaniSevaNapraNayinA sarvA(5)pi pUrvA harita / tIrthAnAmabhivaMdanena sudRzA saMbhAvitA tena sA saMprAptana mahodayaniyamaho puNyairagaNyaistata cAturmAsyavidhAnataH punarapi zrIpattanAMtaHsthitaM 102 // // iti zrIdigvijayanAmni mahAkAvye mahopAdhyAya zrImeghavijayagaNiviracite 'udayazrI sNklite| zrItIrtharAjagirizrIgautamasvAmizrIsudharmaH svAmistutivarNano nAma trayodazaH sargaH / / zrIH / / zreyaH // zrIrastu // zrImtAllekhakapAThakayossadA vaH // zrI / / Reference.- Published in "Singhi Jain Series" as No. 14 in A. D. 1945. In its introduction ( pp. 4-9) a classified list of works composed by Meghavijaya Gani is given. On p. 9 his seven Gujarati works are mentioned. 20 5 - dIpAlikAkalpa Dipalikakalpa 719. No. 279 1892-95. Size.- 9. in. by 41 in. Extent.- 10 folios; I3 lines to a page; to letters to a line, 10

Page #422
280] The Svetambura Narratives 387 10 Description.- Country paper tough and white; Devanagari characters ; bold, big, clear and good hand-writing; borders ruled in two lines in black ink; foll, numbered as usual ; complete. Age.-- Not quite modern. Author.- Is he Jinaprabha Suri? If so, see p. 388. Subject.-- Ritual pertaining to Dipalika is trea-ed in this work ___along with the origin etc. of this par van. Begins. -- fol. ! 5 6 0 // zrIgurumo nmH| saMtu zrIvarddhamAnasya sukhaHyAMhinakhAH matAM / darpaNA: maMyamINAM padmarAgamayA iva // 1 // etc. Ends.- fol. 10 Asman parvaNi cadarda)zyamAgasyAyAM 16 praharAvadhiH pradIpaM vIra. svAmino'ye kRtvA koTIsahitamupoSya yaH paMcAzatsahasraparivAravataM zrI gautamasvAminaM smAn akhaMDa 50 sahasra raNDulAna Dhokate nityaM sahamapaMcAzadguNaM puNyamupArjate / iti zrIdopAlikAkalpaH samAptaH . Then follow 3 .. verses embodying dIpotmavAzIrvAdA. The last one is as follows:: vIro vizvavibhunIyA vIrazAsanamapyadaH / kalpo dIpAlikAyAzca parvedaM paramaM tathA // 3 // iti dIpotsavAzIrvAdaH // Reference. - See p. 389. For additional Mis. see Ji naratnakosa 20 ( Vol. I, p. 175). dIpAlikAkA Dipalikakalpa TabbA sahita with tabba 718. No. 280 1892-95. Size.- 10.4 in. by sfin. Extent (text) - 29 folios ; 6 lines to a page ; 34 letters to a line. , (tabba ) - ,, , , , , , 540 " " " . Description.- Country paper thick, tough and white; Devinaga: ! characters; bold, big, legible and goo! hand-writing; borders ruled in two lines and edges in one in red ink;

Page #423
388 1 Jaina Literature and Philosophy [280 foll. numbered as usual; foll. 1 & 29deg blank ; this Ms. contains both the text and its explanation ; the former in Sanskrit and the latter in Gujarati; the explanation which may be named as ' tabba' written alove the corresponding lines of the text and comparatively in a smaller hand; both the text and its tabba complete ; condition very good. Age. - Not quite modern, Author of the text.- Jinaprabha Suri, pupil of Jinasimha Suri. For his additional works see D CG C M ( Vol. XIX, Sec. I, pt. 2, p. 311 ). ,, the tabba. -- Not known. Subject.- Importance of the -- Dipalika' parvan narrated in verse mainly in Sanskrit together with its explanation in Gujarati. Begins.-- ( text) fol 10 || 60 sadgurubhyo namaH // maMtu zrIvarddhamAnasya etc. as in No. 279. : com.)fol. ' hai jinezvarAya namaH / __supanai kAnai caraNakA naSarU dhamI lokAne pI kamala valI mahAvIrakA naSa ki chai ArAsAnI pare sAdhamArgarUpa strIkaivale mahAvirakA naSa kisAka che malanA raMganI pare lAla cha ! // 1 // et:. Ends.-- ( text ) fol. 286 doSAH samastA pralayaM prayAMtu / paropakAra kalayaMtu sUtu / zrIsaMghamukhyAH sukhino bhavatu / ___ kalyANavAlaH phaladA bhava(?)tu // 13 // iti zrIdIpamAlikAkalpa kRta zrIjinaprabhariNA -- ( com.) fol. 28deg doSa sArA pralaya jAya para upagAra karo sajanAM zrIsaMghane mukhya suSI hoya kalyANarUpa belI phalakI deNahAra // iti zrIdIpamAlikAparvamahimA saMpUrNa / liSataM paM. manasuSajI 'jayapura madhye saMvegI tulachArAmajIsya hetave / 20

Page #424
281.] The Svetambara Narratives 389 Reference. This text forms a part of Vividhiatirthakalpa. But it is not found in the work bearing this name and published in "Singhi Jain Series " in A. D. 1934. For additional Mss. see p.387. dIlikAkalpa Dipalika kalpas 1173. No. 281 1887-91. Size.- 10 in. by 4 in. Extent.- 6 folios ; J7 lines to a page ; 48 letters to a line. Description.- Country paper tough and greyish ; Desanagari 10 characters; small, clear and fair hand-writing ; borders ruled in three lines and edges in two in red ink ; numbers for foli. entered twice as usual3; fol. 6b blank; complete%3B composed in Samvat 1345 ; condition very good. Age.- Not quote modern. Author.- Vinayacandra Suri, pupil of Ratnasimha Suri. He is the author of kalpasUtradurgapadanirukta (Vol. XVII, pt. 2, No. 548). Subject.- Origin of the -- Dipalika' embodying a narrative of King Sanprati. Begins.-- fol. 1 // 6 // __ zrIvarddhamAnamAnamya vakSye dopAlikotsavaM / rAjA'bhUt saMprati ma trikhaMDa bharatA'dhika (p.)| 1 etc. Ends.- fol. st. itthaM sahasrapaMcAzaguNaM puNyamupAyaMte / jainadharmaratA bhavyA prAtyakSayaM sukha !' 89 / / zruti saMpratipaH prativarSameva / dIpotsavaM janapade khileSu tene / zrImatsuhAstagurupAdabhavaprasAdA dAptaM ca rAjyamazikhajinadharmaramyaM // 90 // kimi (cita) tyA zrutvA bodhaH / cid bahuzrunane nAta (?) kRpto dIpAlikAkalpaH zodhyaH sadbhiH prasadya saH / 91 / 20 30

Page #425
396 jaina Literature and Philosophy [ 281. gagyugazivizazi(1345)varSe ziSyaH zrIratnasiMhasUrINAM / zrIvinayacadramarizca ke dIpAlikAkalpaH // 92 / / zrI yathA vRNAM cakravartiH surANAM pAkazAsanaH / grahANAM ca grahAdhIzastarUNAM tridazadrumaH / 93 / / etc. tathA 'dIpAlikA parva paramaM sarvaparvaNAM / 94 // yatra nivRtimavApa ti(tI)rthapaH kevalaM ca kila gautamaprabhuH bhUbhujeyaraci dIpikotsavaH tacca parva paramaM (ma)hItale // 95 // vIro vizvavibhujIyAd vIrazAsanamapyadaH / kalpo dIpAlikAyAzca parvedaM paramaM tathA / 96 / mphUrjanA(nA )geMdranAle digupacitadale tArikAdhIjajAloH / kSoNIbhRtkesarAle 'kanakagiri 'lasakarNikAcakracAle / yAvad vyomAMbuje'smin sphugdurulalitaM gajate rAjahaMsa. dvaMdva nidvamatajjagati vijayatAM tAvadeSo'pi saMghaH / 9 / cha! etc. iti dipAlikA saMpUrNam // likhinaM somacaMdrana / yAdRzaM pustaka etc. ... Reference.-- For additional Mss. see Jinaratnakosa (Vol. I, p. 175). 15 10 dIpAlikAkalpa Dipalika kalpa 722. No. 282 1875-76. Size.-- 104 in, by 4 in. Extent. - s folios ; 15 lines to a page; 46 letters to a line. Description.- Couniry paper rough and white : Devanagari characters with occasional geniars; small, legible and good hand-writing ; borders ruled in two lines in red ink ; foll. numbered in both the margins; edges of some of the foll. slightly damaged; condition tolerably good ; complete.

Page #426
283.J Age.- Samvat 1745 Begins. fol. 14 zrIgurubhyo namaH // Ends. The Svetambara Narratives zrIvarddhamAnamAnamya etc. as in No. 281. - fol. so 'zrutveti saMpratinRpa etc. up to dIpAlikAkalpaM as No. 281. This is followed by the lines as under : iti zrI dIpotsava kalpe saMpurNAni likhitaM pa. somagaNinA saMvata 1745 varSeSu jyeSThamAse zuklapakSe paMcamyAM tithau bRhaspativAsare lakhitaM ' rAjanagara madhye gaNizrI kuzala vimalajI vAcanArtham / N. B. - For additional information see No. 281. dIpAlikAkalpa ( dIvAliyakappa ) No. 283 Begins. - fol. 14 // 60 // zrIsarvajJAya namaH / Size.- rogin. by 4g in Extent. - 4 folios; I lines to a page ; 60 letters to a line. Description. Country paper thin and greyish; Devanagari characters with gears; small, clear and good handwriting; borders ruled in two lines and edges in one in red ink; foll. numbered as usual ; complete; condition very good. Age.- Not modern. Author. - Nor mentioned. 391 Dipalikakalpa ( Divaliyakappa ) Subject. Origin of the Dipalika kalpa is depicted in verse in Prakrit. 1 The number of this verse is here mentioned as 82. 720. 1892-95. 'pANAya' kampAu cuu (o) bhagavaM / AsADhasukkachaTTidi / 'khattiyakuMDa 'ggAme hatthottarArikhujoela / 1 // etc. saMtracchariyaM dANaM dAu 'caMdappA'e sIyAe / oss sirivIro maggasire kinhadasamardiNe // 8 // etc. 5 10 Is 20 25 30

Page #427
5 10 15 20 25 392 Ends. -- 4b Jaina Literature and Philosophy tammiya khaNaM tassa vi kevalimahimaM karitu tuDumanA / saTTA saTTA saMpatta suravarA saye // 127 // i dIvAliyakappo lihiu ruMdAu suyasamuddAu | guruguruparaMparau cipa soheyatvo subaharehi // 128 // iti dIvotsave kalpaH samAptaM // dIpotsava kalpa (dIcchavakapa ) [ apApAbRhatkalpa ] No, 284 Size.- 104 in. by 44 in Extent -- 19 folios; to lines to a page; 36 letters to a line. Description. - Country paper tough and white; Devanagari chara. cters; big, legible and good hand-writing; borders not ruled; foll. numbered as usual; complete; composed in Sarvat 1387 at Devagiri; condition very good. Age.- Samvat 1875 ( ? 876 ). Author. Subject. Begins. fol. 1a || cho || Ends. -- fol. 19b Jinaprabha Suri For his works etc. see p. 388. This is only a part of Vividhatirthakalpa which supplies us with the history about the holy places of the Jainas. This kalpa points out the importance of Pavapuri. [ 283. Dipotsavakalpa (Divucchavakappa ) [ Apapabrhatkalpa ] paNa maya vIraM vucchaM tasme (se) va ya siddhigamapAttAe / pAvApurIi kappaM dInamahaSu (hupa ) tti paDiva (ba) ddhaM // 1 // etc. pAva purakappo dIvamahupattibhaNaNaramajjo | jiNapasUrIhiM kao ThirahiM sirei 'devagirinayare 1 582. 1895-98.

Page #428
285 J (C The Svetambara Narratives rahasattAsIe (1387) vikkama (va)risaMmi bhaddavaya bahule / posika vArasIe samatthio esa satyikaro 2 // samAptA ayaM zrI apApa bRhatkalpo dIpotsava kalpo vA / saMvata 1876(25) miti posavadi 2 zukravAsare zrIdilA myAha jihAnAbAdamadhye lipikataM munI rAmavijayadhanavijaya AtmArtha iyaM pustakA liSatAH .. Reference. This forms a part of Vividhatirthakalpa published in 'Singh Jaina Series" in A. D. 1934. See its pp. 34-44. S See Peterson, Reports (IV, p. 95). For additional Mss. see B. B. R. A. S. ( Vols. II-IV, p. 438) and Jinaratnakosa (Vol. 1, p. 175 ). durghaTakAvya [kriyAdiguptakAvya ] No. 285 Age. Pretty old. Author. Not known. Subject. This Ms. starts with Size. 10 in. by 4 in. Extent. 7 folios; I lines to a page; 34 letters to a line. Description. Country paper thick, rough and white: Jaina Devanagari characters with occasional gears; big, quite legible, uniform and very good hand-writing; borders and edges as well ruled in two lines in red ink; red chalk 20 used; foll, numbered in the right-hand margin; in the left-hand margin the title is written as ; practically complete so far as it goes; in all there are 102 complete verses; yellow pigment used while making corrections; explanation is at times recorded in the Ms. Begins.- fol. 1 Durghatakavya [Kriyadiguptakavya ] 50 J. L. P.] 393 . Then we have aifagana. Thus this work is a kind of "citrakavya". jina ! trijagataH pUjya ! sudA tvAM satkriyAvalI aa fman va aftaia adisaia: ? 304. 1884-86. tlena 15 25 30

Page #429
S 10 IS 20 394 30 Ends.- fol. 7a - fol. 7b -- Jaina Literature and Philosophy kumArapAla pAla ! tvamaho jIvarakSaNa sabhAsamakSamAdiSTaM guruNA hemasUriNA 2 sayaH saMprApya samare purutasahA tAM dAnavezvara sainyAni sarvANyapi nalaH purA 3 etc. pArzvanAtha ! jagannAtha ! kAruNyakSIrasAgara ! tara mAM bhImajjaMtaM mavabudhau 100 bho gAmAnava rAjyasyAdhigame (5)pi kadAcana zrImaddevAdhidevasya pramANaM pAdanaMdane 1 kAsuddharati zUmararUpaH kAmArarahitAmicchati bhUyaH kena kRtaM manmagha (dha) jananaM kena tu rAjati (?) yoSiti vadanaM 2 kuMkamena ti // ... yA... mA mamatA mAyA mApakSikSakSaNepamA tArAne gagane rotA ma kSaga ! kSa ! kSagakSama 1 etc. asyArthaH yA samaMtAta mA lakSmIrmAtA kathitA 25 hRDhaprahArikathA No. 286 [ 285. fol. 70 kSaH kSetreti vacanAt kSaM kSemaM tatra gacchatIti kSagastasya saMbodhane kSaH kSama iti vacanAt he kSa ! samartheti cha / Then in a different hand we have: pavanasya putraH bhImaH tasya putraH gaToTagacchaH tasya mAtA heDabA taspAH pitA rAkSasaH sUryasya putrakarNena gaToTagacchaH hataH tadA haDabA rudanaM kati hA iti khede khacarasya sutasya sutaH khacaraH khacarI jananI ca pitA khacaraH khaccarasya sutena hataH khacara khacarI roditi hA khacaraH kva gataH khacara kva gataH khacaraH Extent. -- fol. rob to fol. rtb. Description.-- Complete ; 52 verses. For other details see mUladevakathA No. 1310 (1). 1886-92. Author - Not mentioned. Drdhapraharikatha 1310 (12). 1886-92.

Page #430
287.] The Svetambara Narratives 395 Subject.- A versified story of Dsdhapraharin so named as he used ___to deliver hard blows. Begins.- fol. 10b kSarA vi sahAveNaM / bisayavisava mANugA vi houunn|| bhAvia jiNavayaNamaNA / telukasuhAvahA huMti // 1 // etc. Ends. -- fol. 116 amlAnaM kevalajJAnamadya lebhe suTurlabhaM / ayogikevaliguNasthAnastho muktimApa ca // 52 / / iti dRDhaprahArikathA // cha / 10 devapAlakathA Devapalakatha _1310 (34). No. 287 1886-92. Extent.- fol 34s to fol. 354. Description. - Complete. For other details see mUladevakathA 1310 ( 1 ). No. 1886-92. Author.-- Not known. Subject. - A story of Devapala. It pertains to a worship of the Tirthankara. Begins.- fol. 34 mugiha jinaganamajaaM / yo(s) pUjayati maMjalabhA / sa prabhU zubha bhaagymmeto| devapAla itra karma labhata // 1 // asti 'hastinapura' purazastaM / bhUSaNaM 'bharata'varSarigAH zavasiMha zarama pama AsI tatra siMharagha(tha) ityavanIzaH / / 2 / / etc. Ends.- 33 tatrAjagAma municadragumastadAnIM / naMtu jina tamabhinaya nRpo nizamya / tadezanAM ca sumatoyata AyuSo te / 40 // devapUjAyAM davapAlakathA // cha /

Page #431
396 Jaina Literature and Philosophy [288 10 devarAja-vatsarAja-kathA : Devaraja-Vatsaraja-katha (devarAyavaccharAyakahA ) ( Devaraya-Vaccharaya-kaha ) 722. No. 288 1892-95. Size.- 10 in. by 44 in. 5 Extent.- 13 folios ; 19 lines to a page; 54 letters to a line. .... Description.- Country paper very thin, brittle and grey ; Deva pagari characters with occasional Tags; small, legible and tolerably good band-writing: borders ruled in four lines in black ink; space between the pairs coloured red; foll. numbered as usual ; a blank white paper affixcd to fol. 1; so is the case with fol. 13; the unnumbered sides have a spot in red colour in the centre only; the numbered in the two margins, too; complete ; 705 verses in all; condition good. 15 Age.- Not modern. Author:- Not mentioned. Subject.- Life of Devaraja-Vatsaraja in Prakrit in verse: Begins.- fol. asthi ttha 'jaMbu'dIve 'bhAraha khittamsa mjjhkhNddmi| nAmeNa 'khiipaiTTiya'nayara pagguNagaNAinnaM // 1 / . taM pAlai vararAyA ase ssaamNtpnnypykmlo| . pava(ya)pAlaNikarAsiA nAmeNa vIrAsaNu tti // 2 // etc. Ends. fol. 136 caviUNa devalogA suyalogAsamANusattAyaNa kameNa tu / - pAvisaha muttimuhaM khaviUNaM sambakammAI / / 705 // iti zrIdevarAjavaccharAjakathA // cha / Reference :- No additional Ms. is noted in Jinaratnakosa ( Vol. I, p. 178.)

Page #432
10 is 289.] The Svetambara Narratives 397 devarAja-vatsarAja-rAsa / Devaraja-Vatsaraja-rasa [devarAja-vaccharAja-rAsa] [ Devaraja-Vaccharaja-rasa ] 723. No. 289 1892-95. Size.- 104 in. by 3 in. Extent. -- 10 folios ; is lines to a page ; 56 letters to a line. Description.- Country paper thin and white; Devanagari chara cters; small, legible and fair hand-writing ; foll. num. bered as usual ; a corner of the first fol. worn out; edges of several foll, slightly damaged ; condition very fair; com. plete ; composed in six Khandas. Age. - Samvat 1656. Author.- Lavanyasamaya, pupil of Samayaratna. For his life-sketch .....and his additional works see No. 197. Subject. - Life of Devaraja-Vatsaraja in Gujarati in verse. It is divided in khandas. This work points out the importance of ahimsa ( non-injury to living beings ). Begins.- fol. ideg zrIgurubhyo namaH // vastu sakala jinavara sakala jinavara pAya pnnmedhi| tau paNamevi ckksrii| eka citti bahu bhatti kAria / niya guru taNai supaptAulai / ridayakamala nIya mati / vimAsIya sajjana ! maha ka u saMbhalau / hIya ui bhAva gha(dhI)reya / / bolisu nava nava kavita rasa / sirivchraajvriia||1||etc. Ends.- fol. 10deg vastu pAchilai mavi pAchilai bhavi iNi / bacharAji / jIvadayA pAlI parI / tiNi prabhAvaI vihU desa pAmIya / Apada savi saMpada huI anai valI bahu suSa pAmIya / muni lAvaNyasamai bhaNai / bhavIyaNa loya saha / jIvadayA pAlau parI / jima pAmau suSa bhua|| iti zrIdevarAjavacharAja cupai samApta / saMbata 1656 varSe caitra mavi 13 dine uSitaM RSiraMgA /

Page #433
398 Jaina Literature and Philosophy [289. The fifth khanda ends on fol. 10'. There it is stated "paMca SaMDa samApta". References.- Published in Ananda-kavya-mahodadhi ( mauktika III ). For extracts and additional Mss see Jaina Gurjara Kavio ( Vol. I, pp. 83-85 & Vol. III, Pt. I, P. SI). - - - JO draupadIrAsa Draupadirasa No. 290 1624 1891-95. Size.-98 in. by 4g in. Extent.- 61 folios; 11 to 14 lines to a page ; 28 to 42 letters to a line. Description.- Country paper tough and white; Devanagari chara cters; big, clear and fair band-writing ; borders ruled in two lines and edges in one in red ink; numbers for foll, entered twice as usual ; foll. ja and 61 blank ; foll. 37 etc. seem to be written in a different hand ; complete; composed in V.S 1693 in Jesalamera; condition very good. Age.- Not quite modern. Author.- Kanakakirti, pupil of Jaya niandira. He is the author of Nemanatharasa ( V. S. 1692) and a commentator of Meghaduta. Subject. -- A life-sketch of Draupadi in Gujarati in verse. Begins.- fol. 1 zrIsadgurubhyo namaH mAru rAgo / 20 'purasAdANI pAsa jiNa caraNakamala vita lI(lA)ya / praNamaM trikaraNa bhAvasu pAtika dUri pA(palA)ya // 1 // etc. yugapradhAna jinadatta guru zrIjinakusalasUrIMda / zrIjinacaMda suguru nahu~ pAdaM paramANaMda // 3 // sIlasuragI dropadI nirmala pAlyo sIla / hA carita vAMgatAM lahiyA avicala lIla // 4 // etc. 30

Page #434
291.] Ends.- fol. 61" suranara je nara tasu praNagya sadA je nara pAlai sIla / jasa parimala maha ke ca (tri) huM loka paiM pAmaiM sivasuSa lIla || 23 || 60 saMbaMdha ko jima sAMbhalo gurumutra mati anusAri / The Svetambara Narratives sIla taNA guNa gAvaNa mana ralI kanakakIrati suSakAra ||24|| 60 iti zrI dropadI caritraM saMpUrNa / Reference. For extracts and additional Mss. see Jaina Gurjara Kavio ( Vol. I, pp. 569-572 & Vol. III, pt. I, pp. 10561058). draupadIrAsa No. 291 Size.- 1og in. by 4g in. Extent. 31 folios; 18 lines to a page; 44 letters to a line. Begins. fol. 1 kArAya namaH // dUhA / 'purisAdANI' etc. as in No. 290. Ends.- fol. 31b 399 Description.- Country paper thin and greyish : Devanagari chara 15 cters; small, clear and tolerably good hand writing; bor. ders ruled in three lines in red ink; toll. numbered as usual ; fol. ra blank ; all the four edges coloured red; fol. 13 badly torn ; strips of paper pasted to its edges; edges of a few foll. damaged; condition very fair; complete ; 20 extent 1541 slokas. Age. -- Sarvat 1719. up to under: sura nara kiMnara tasu sevA karaijI ne nara pAlai sIla etc. practically as in No. 290. This is followed by the lines as lighataM / zrIrastu / etc. B. For further particulars see No. 290. Draupadirasa 10 1625. 1891-95. dhana dhana sIlavatI satI drupadIjI / iti zrI pada satIcatuHpadI saMpUrNa graMthamAna 1541 saMvat 1719 ASADhamAse kRSNapakSe pratithau guruvAre zrI' medanIpura'madhye 5 25 30

Page #435
to IS dvAdazavatakathA No, 292 Size - 124 in. by salin. Extent. - 5 folios; 13 lines to a page; 36 letters to a line. 5 Description.- Country paper thick, tough and grey ; Jaina Devanagari characters; big, quite legible, uniform and good hand-writing; borders ruled in two lines and edges in one in red ink ; dandas for the verses written in red ink; foll. numbered in the right-hand margin; fol. 1 blank; edges of the first fol. slightly gone; condition the whole good; in the first line a part of the line is so written that the alternate letters are in red and black inks; complete. on 20 25 400 30 Jaina Literature and Philosophy Age.- Samvat 1770. Author. -- Not known. Subject.-- Stories pertaining to 12 vows of the Jaina laity. They are an outcome of having seen the corresponding work of Amradeva, a poet, in prose. Begins. -- fol. 1 // 60 // N namaH // atha dvAdazavratakathA likhyate // nemIzaM zrIjitaM natvA bhAratI surupaSkajaM / Ends.- fol. sb kathA vyAkhyAyate stokA dvAdazavratasaMbhavA // 1 // 'jaMbU' dvIpest vikhyAte 'bhArata' kSetramuttamaM / mlecchAyyaiH khaMDatAM yAtaM kRtrimAdivivajjitaM // 2 // etc. [292. Dvadasavratakatha 1108. 1884-87. sakalasukhanidhAnaM karmamAtaMgasiMha jinavara khajAtaM svarga sopAnapati || vidhimima matiramyaM svagehe kapATa durita timirabhAnu zarmakAmA bhajaMtu / / 99 / asama guNasamudrAn vizvanAthAcitAMhIna rahita nikhiladoSAn svargamokSekahetUn // bhavajalanidhipotAnnaIdAdIna gurUMzva jagati vimalabhaktyA saMstuve vizvavaMdyAn // 100 // iti dvAdazavratakathA saMpUrNA /

Page #436
The Svetambara Narratives 401 abhradevakaveH vANI gadyAM vIkSva mnohraaN| katheyaM varNitA padyamayA pUrvAnusArataH // 1 // doSabhAvaM bhuvi tyaktA dayAM kurvati ye narAH / rAjyaM saMprApyate yAMti jarAdicyutamavyayaM // 2 // gatapaye zubhaM hAI sthApitaM kavinA ca yat / patnAt saMzodhya vijJena saMdhA manasi dhruva // 3 // upavAsa / 1 / ekasthAnaM / 2 / kaMjikA / 3 / mukhazuddhiH / 4 / nirmAna 15 / alpAhAra / 6 / nirvikRtiH / 7 / rukSAnaM 101 nilavaNaM / 9 / ekAzanaM / 10 / nirgorasaH / 11 / apAzcAhAraH // 12 // ete bhaMgAH // saM 1770 le. kA. 4 likhataM pAMDe bhIvasI ToDaramala vAcAnArthenedaM Reference.- In Jinaratnakosa (Vol. I, p. 184) Mss. of the diffe rent works bearing this very name are mentioned. Jo 20 dvAdazavatakathA Dvadasavratakatha No. 293 384 (b). 1871-722 Size.-- 104 in. by 4 in. Extent.- fol. 24deg to fol. 40*. Description.- Complete. For other particulars sec sadayavatsasAbalijajIkathA No. . ___ 384 (a). -- 1871-72. -Age.- Samvat 19:7. Author. - Not mentioned. Subject. --- Stories connected with the 12 vows of the Jaina laity, the last story being that of Sumitra. Begins.- fol. 21 // namo sarvajJAya || zrImarutuMgamareMdraH gurun natvA mahAdarAt / dvAdazavratasaMbaMdhikathA saMkSipya vacamyA / 1 // aNavratAni paMce sya guNAnAM ca vrttrik| zikSAvratacakSu(tu) kaM ca dvAdazeti bhidA matA // 2 // etc. 61 1J.L.P.1

Page #437
40% Jaina Literature and Philosophy [293. Ends.-- fol. 39" iti nRpAdyAH saMprAgbhavaM zrutvA eraM natvA svasthAnamAgatya dharma dhyAMnaparA mokSaM praapyuH| ityAkarNya janAH ! samyak sumitra(trA)yA nidarzi(0)naM / vrata sevadhvamatithisaMvibhAgaM zubhAspadaM // 1 // iti zrIatithisaMvibhAgavratavicAre sumitrakathAnakaM samAptaM // 12 saMvat 1917nA azADha sUda 6 sanIvAre zrI sUratabidare zrI sUratamaMDaNa' pArzvanAthazrIdharmanAthajIprAsAde laSItaM paM rAjavijaya(ga)NI / paM uttama. satka comAsaM rahI, labyuM che zrIjizrIdeviMdrasUrIsvarajInA comAsAmA rahi laSyu cha sahI cha / Reference. - See Nos. 292 and 294. 10 dvAdazavratakathA Dvadasavratakath, No. 294 355. 1871-72. Size,- 101 in. by 4g in. Extent.- 15 folios; 16 lines to a page; 40 letters to a line. Description.- Country paper thick, rough and white; Jaina Devanagari characters; small, quite legible, fairly uniform and good hand-writing ; borders mostly ruled in two lines and once or so in three lines in red ink; edges in'one line in the same ink; red chalk used; white paste used for making letters illegible ; foll. numbered in the right-hand margin ; fol. 15deg blank ; edges of some of the foll. slightly gone ; condition on the whole good; complete; extent 618 slokas. Age- Samvat 1833. Begins.- fol. I'5 6 / / zrImerutuMgarIMdraguruM nanvA mahAdarAt / dvAdazavratasaMbaMdhIkathA saMkSipya vasmyAhaM // 1 // aNuvratAni paMca syu guNAnAM ca vratatrikaM / zikSAbatacatuSkaM ca dvAdazati bhidA matA // 2 // etc. 20 is

Page #438
193.j The Svetambara Narratives Ends.- fol. IF iti nRpAdyAH svaprAgbhavaM zrutvA guru natvA pa(? svasthAna mAgatya dharmadhyAnaparA mokSa prApuH / ityAkarNya janA ! samyak sumItrAyA nidarzanaM vrataM sevadhvamatithisaMvibhAgo zubhAspadaM // 1 // ittha (a)tithisIvabhAgavratavicAre sumitrakathA saMpUrNa // iti dvAdazavratakathA saMpUrNam // graMthAnaM 678 zrIrastuH // kalyANamastuH // saMvat 1833nA varSe kArtikazudi 11 dIne guro vAsare // paM muniMdravijaya lIpIkRtaM / / zrI mati'madhye / / zreyamaMgalaM bhUpAta // bhI / N. B.- For further particulars see No. 293. - Dhanapatikathi to 1886-8715 dhanapatikathA No. 295 1310 (10). 1886-92. Extent.-- fol. 9 to fol. 9". Description.- Complete. For other details see No. !310 / 0) Author.- Not mentioned. Subject.- A story of Dhanapati, a Bania. It illustrates the prowess of donation given to the deserving personages. Begins.- fol. 9" atha pAtradAne / / 'acalapure' sUratejonAmA nRpaH / tatra zreSThI dhanapatirabhidhAno niHsva. vaNijaH etc. Ends.-fol. 9deg sa jagrAha vizuddhazrAddhadharma samyaktabhUlaM.. pratipadya...tRtIyabhA(ma)va(ve) mokSo bhAvI te // iti supAtradAne dhanapatikathA / vasahIsayaNAsaNaprabhRti aSTau dharmopadezA paSTaMbhakadAnAnAnAM kathA // cha / cha / Reference. For additional Mss. see Jinaratnakosa (Vol. I, p. 187). Is it that all these Mss. are of one and the same work? One of the Mss. is dated as V. S. 1489.

Page #439
5 10 404 Jaina Literature and Philosophy E 296. dhanamitrakathA Dhanamitrakatha No. 296 1288 (a). 1884-87. Size.-II in. by 4t in. Extent.-- 13 folios ; 17 lines to a page ; 64 letters to a linc. Description.- Country paper thin and white; Devanagari chara cters with gefrais; small, legible and good hand-writing; borders ruled in three lines in black ink; red chalk used ; yellow pigment used; foll. numbered as usual; edges of every fol. more or less worn out; some foll. worm-eaten; condition fair ; complete. This Ms. contains additional works as under:abhapadAne zIlavatIkathA foll. 31-40 dAne caMdra-mAnu-bhIma-kRSNa suMdara-kathA No. 215 foll. 4-70 bhAvapUjAyAm vanarAjakathA foll. 76-106 zIle sundararAjakathA foll. 10-13 Age.- Not modern.. . Author.- Not mentioned. Subject.-- This story of Dhanamitra illustrates the importance of dana in 149 verses in Sanskrit. Begins.-fol. !' jJAnavAn jJAnadAnena nirbhayo'bhayadAnataH annadanAta sukhI nityaM nIrogo bheSajAd bhavet // 1 // etc tathAhi atyatra 'magadhA 'bhikhye deze 'rAjapuraM' purN| tatrAsa trAsarahitAM jayaMto nAma pArthivaH // 8 // etc. Ends.--- fol. 3". jJAnaM tu tadupAdeyaM yat syAt svasya parasya ca / nirvyAghAtaprakAzArthamanadIpAlayopamaM 49 (149) / / 20

Page #440
131 298.] The Svetambara Narratives 405 dhanyakathA Dhanyakatha No. 297 1310 (24). 1886-92. Extent.-- fol. 25b to fol. 276. Description.- Complete. For other details see No. : 1886-92.' Author.- Not mentioned. Subject.-- A story of Dhanya in connection with "supatra dana". Begins.- fol. 25b. ciMtAmaNikalpamadrumakAmadudhAdIni divyavastUni / janavAMchitArthakaraNe / guruprasAdanehi gurUNi // 1 // etc. Ends.- fol. 27 AsannalakSaM pratidUrago na / mukto yatheSurbalato(s)pi tadvat AzaMsadA dAnamihAtu(nu )kaMpA / dAnaM tu kvApi (na) jinaniSiddha // 30 // mupAtradAne dhanyakathA // cha / Reference. For Mss. of anonymous works see Jinaratnakosa (Vol. I, P. 187). 0 20 dhanyarAjarSirAsa Dhanyarajarsirasa [dhannArAsa] [ Dhannarasa ] No. 298 . 1267. 1886-92. Size.- 10 in. by 41 in. Extent. - 30 folios ; 13 lines to a page ; 30 letters to a line. Description.- Country paper tough and white ; Devanagari chara cters ; big, legible and good hand-writing ; borders ruled in two lines and edges in one in red ink; red chalk used; foll. numbered as usual ; fol, ja pratically blank'; complete; composed in Samvat 1710; corners of a few foll, damaged; 30 condition tolerably good.

Page #441
406 Jaina Literature and Philosophy [298. Age.- Samvat 1805. Author:- Jinavarddhamana, pupil of Jinaratna Suri of the Kharatara gaccha. Subject. -- Life of Dhanna ( Dhanya ), a rajarsi. 5 Begins.- fol. 10 zrIparamasadgurubhyo namaH / / 10 zrIjinavara e jagatame / karamanikaMdana dhIra / baMdu trikaraNa zuddhanyu / trizalAnaMdana vIra dhanA RSi guNa gAvatAM / nyAI vIra praName iN| suta birudAvaNa avasaraI / pitAnAma dhuri leI // 3 // etc. Ends.-- fol. 30 tAsa paraMpara zrIjinacaMdA nava laSa vaMza viNaMdAjI vechinapUraNa suratarukaMdA suvihita munivaraiMdAjI // 4 // dhas tasa paTa zrIjinaratna virAjye dinadina adhika divAjejI jasa darisaNa mithyAmati bhAje guNagaNa karI gururbAjejI // 5 // ghas tasa ziSya jinavardhamAna jagIse Asme zudi chaTri divasejI saMvata satara dAhottara (1710) barase 'bhAyata' mana haresajI // 6||ghdd e saMbaMdha racyo matisAre navA me aMge aNusArejI bhaviyaNa janaNe vAcaNAre vistarajyo jagajArejI / / 7 // tehavI sarasa nahI che vANI sAdhu taNA guNajANIjI Adarasye guNa gAhaka prANI kIdhe ima mani ANIo // 8 // kavitArasavasiM vAta ji kAI sUtthI adhika kahAIjI kAraNa tihAM kaNi kavicaturAI / / SoDi nahI tiNa rAIjI // 9 // rs caturAIviNa sarasa na lAge catura na voce rAgejI te viNa pahanavAle AgeM tiNa e sarasa suhAgejI // 10 // jayavaMtA zrIjina covIse / caratamAna paNi vIseM jii| vA, trikaraNa nAmI sIse / avicala rAja jagIse jI / gha0 / 11 // iti zrIdhannArAjarSisabaMdharAsarI saMpUrNatAmagamat / sakalabhaTTArakapuraMdarabhAlatilAkAyamAna zrIvijayakR(?)ddhisUrizvaraciraMjivItuH / / sakala. bhaTTArakapuraMdaradavaMdAraka sakalabhaTTArakamugadasamAna bha zrI 108 zrIvijaya. saubhAgyasUrivijayarAjye lapi ziSya paM jinavijayavAcanArtha enImohana 20

Page #442
299. ] The Svetambara Narratives 407 vijaya pikRtaM saMvat 1805 nA varSe mAgasara bada 3 dane bAra some zrI'surata baMdare laSitaM // zrIgaNezAya namaH Reference. For extracts and additional Mss. see Jaina Gurjara Kavio (Vol. II, pp. 80-81 & Vol. III, pt. 2, p. 1144). dhanyazAlibhadra caritra [ dhannAzAlibhadra copai ] No. 299 Size.-97 in. by 4 in. Dhanya-Salibhadra-caritra [Dhanna-Salibhadra-copai] Extent. 50 folios; 10 lines to a page; 36 letters to a line. Description. Country paper tough and white; Devanagari characters; bold, big, legible and good hand-writing; borders ruled in two lines and edges in one in red ink; fol. 1* blank; red chalk used; complete; composed in Samvat 1726; condition very good. Age. Samvat 1905. Author. Rajalabha Gani, pupil of Rajaharsa. His additional works are as under : I. uttarAdhyayana 36 gIta 2. goDIchaMda 3. dAnachatrIsI 4. bhadranandasandhi 5. vIra27 bhavastavana 6. atat 7. svapnAdhikAra 1626. 1891-95. V. S. 1723 V. S. 1723 V. S. 1734 latest V. S. 1765 Subject.- Life of Dhanna (Dhanya) and that of Salibhadra as well narrated in Gujarati in 3 khandas in verse. Begins. fol. 7' zrIsiddhacakrAya namaH 5 10 15 20 25

Page #443
408 Jaina Literature and Philosophy [299 zrInAbhirAyAMkulatilo AdIsara arihaMta caraNa namuM huM tehanA / bhayabhaMjaNa bhagavaMta // 1 // etc. .. zrIgotama gaNadhara pramukha jinadatta kuzala sUriM(rI)da sadguru bali saMnidha karo giruvA 'meru' giriMda // 5 // etc. bhabiyANa dhannAno muNo / kahuM carita saMSevi / tAsa kathA muNatAM thakAM / ve ANaMda nitameva // 7 // etc. Ends.- fol. 50 harikIratI moTA yatIe munivara mAhamAMvata ma0 utkaSTI kirIvA kare e zIlavaMta guNavaMta ma0 12 rAjaharaSagaNi hitakarU e ratanaharaSa savicAra madeg sadA suSa saMpaje e rAjalAbhagaNi ima kahai e mana dhara haraSa apAra sadA0 13 jIvarAjaAgraha karI e prabhaNpo eha paMcAra sa0 sadagururne supasAule e gAMma vuNArDa' majhAra | sa0 // 14 // mahAmunIsara gAvatAM e pAMme suSa saMtAna udharaMgavadhAmaNa e dinadina vadhano yAMna sa0 15 tIjo paMDa pUro huyo e na(ta)No guNe nara jeha sa0 ghara baiThAM saMpada mile e manabaMchita lahai teha sa 0 16 kahai kahAve je valI e sAMbhali je ye dAMna s.| rAjalAbhagaNi ima kahe e tihAM ghara nave ya nidhAna / s017|| iti zrIdhannAsAlabhadracopaI saMvat 1905 miti mAdravA vadeM 1 Reference.-- For an additional Ms. see Jaina Gurjara Kavio (Vol. III, pt. 2, p. 1232). 28 dhammilacaritra Dhammilacaritra 614. No. 300 1875-76, Size:- 121 in. by 4g in. Extent.-- 77 + 1 = 78 folios ; 15 lines to a page ; 52 letters to a line.

Page #444
300. ] The Svetambara Narratives 409 Description. Country paper thin and greyish; Devanagari characters ; hand-writing big, legible and good but not uniform in size; foll. numbered as usual; fol. 1a blank ; numbers for some of the foll. written between the borderlines; fol. 51 repeated ; edges of the first two foll slightly damaged ; condition very fair; red chalk used; yellow pigment, too ; complete; composed in Samvat 1462. Age.- Sarvat 1508 ( ? ). Author.- Jayasekhara Suri, pupil of Mahendraprabha Suri. For his additional works see Nos. 241 & 253. Subject.- Life of Dhammila in verse. Begins. fol. 1 e // arha bodhibIjaM satAM svAMtabhUmau vapnumanA iva / yo'dhAd vRSau padoSAMte sa zrImAna RSabhaH zriye // 1 // etc. vRNoti sakalA saMpatkaruNAbhAjanaM janaM / caritraM dhammilasyAtra sAkSAtkurmaH pratItaye // 18 // etc. Ends. fol. 770 tatrApi samaye dIkSA (mU ) rarIkRtya tapojalaiH / dhutakarmamalo gaMtA tattvataH padamacyutaM / / 90 / / evaM budhadhAtidhammilasya samyag nizamya caritaM karuNAkarasya / AmuSmikai hika sukhAya bhajaMtu jatu rakSArthamAdaramudAradhiyaH sadaiva / / 99 / / iti zrIdhamilacaritra saMpUrNa / zrIjayazeSarasUrigurukRtiH samAptA / graMthasaMkhyA 350 [0] 4 aSTasaunyazirAzcaMdra (19508) pramite vatsare kRtaM / bhAdrapadA'sitASTamyAM liSitaM pustakottamAM // 1 // 'maMDalakara 'durge bha0 zrIpadmAnaMdasuriNAM parivAre upa0 zrI karmasAgaraziSyeNa muninA meghakumAreNa liSitaM / zrIdharmaghoSagacchIyAH bha0 zrIpadmANaMdasUrayaH ciraM datu / Then in a different hand we have : gaNi zrI (kha) kSIrasAgaragaNinI parati chai || 52 1 J. L. P. I 5 10 15 20 25 30

Page #445
410 Jaina Literature and Philosophy [300. Reference.- Published by L. N. Shah for the Jaina Mitra Mandala. For additional Mss. see Jinaratnakosa ( Vol. I, p. 188 ), - - 1484. 5 dhammilarAsa Dhammilarasa No. 301 1887-91. Size.- 10 in. by 4g in. Extent.- 32 folios ; 18 lines to page ; 40 letters to a line. Description.- Country paper somewhat thick, tough and white; Jaina Devanagari characters ; small, quite clear, uniform and good hand-writing; foll. numbered in both the margins ; borders of all the foll, except 31 and 32 unruled; borders of the 31st fol, ruled in two lines and edges in one in red ink whereas borders of fol 32 in 4 lines and edges in 2; complete ; composed in Samvat 1715; condition very good. 10 IS Age.- Samvat 1797. Author.- Jnanasagara, pupil of Manikyasagara. For his other works see No. 55. Subject.- A biography of Dhammila in Gujarati in verse. Begins.- fol. 1* 160 // aiM namaH / / 20 svasti zrIsUkhadAyikA trimUvanamAtA jeha praNamuM huM nita premamuM dhuri sarasati dhari neha 1 sAnidhi karajo sAradA dolatadAi deva karatAM tapa Upari kathA vadanai vasajo hevi 2 etc. After six verses we have : __ yaduktaM paca(ca)kavANassa phalaM iha paraloe a hoi duvihaM tuMrata) ihaloi dhammilAi dAmanagamAi paraloe 9 (1) ityAvazyakapratyASyAnanirjuktI etc.

Page #446
411 302.] The Svetambara Narratives Ends.- fol. 320 gaccha' aMcala' gururAjiA zrIsubhatisAgarasUriziSyo re zrIgajasAgarasUriyarUM tazu pATiM puNyaratnasUri dakSo re 12 jU0 pATaprabhAkara tehanA vidyamAna virAjai reM guNa(ra)tnasUri kSamAguNai balI zIlavidyAguNi gAji re 13 jU gajasAgarasAra taNA paDita ziSya pratApI re lalitasAgara lIlA karUM jagatIi jasu kIrati vyApi re 14 jU0 ziSya prathama tazu sobhatA mANikyasAgara munirAja(jo) re muja guru te mahimAnilA sIddhAMta zusAnidhikAjore (15 jU0) saMvata 17 kuMgha(?thu) saMkhyA hyo(dyo) ekiM mahAvratanI mahAvIrane jANo 10 zuci kArtika terasiM revatI guruvAra siddhi joga vaSANo re 16 (jU) bIji paMDiM trevIsamI kahI DhAla thayo kalyANo re dhamilavilAsa dhanyAsIiM pUraNa caDiu parimANo re 17 jU0 nyAnasAgara kahiM neharuM zrIsaMghani sukha zrIkAro re dina dina dolita dIpayo sUkha saMpati sakala prakAro re 18 jU0 iti zrIdhamillarAsa saMpUrNa triSu khaMDeSu miliyA savvagAthA 10006 zubhAkhita 24 // saMvata 1797 nA phAlguna mudi 12 some lissitaaniiH| Reference. - For extracts and additional Mss. see Jaina Gurjara Kavio ( Vol. II, pp. 1961 & Vol. III, pt. 2, p. 1) 28 ). dharmakathA Dbarmakatha * 20 1334. No. 302 1891-95. Size.- 94 in. by 48 in. Extent.-- 7 folios 15 lines to a page ; 52 letters to a line. Description.- Country paper thin, brittle and greyish ; Deva. nagari characters ; small, legible and good hand-writing ; 2 borders ruled in three lines in black ink ; foll. numbered as usual ; edges ot all the foll. more or less worn out; condition fair ; red chalk used ; complete so far as it goes. Age.- Pretty old. Author.-- Not known.

Page #447
5 10 15 20 25 412 Jaina Literature and Philosophy [302. Subject. Stories told by Lord Santinatha to king Cakrayudha. The work starts by describing the 12 pirsadas of a samavasarana. This is followed by guNadharma -kana kavatI kathA and nAgadattakathA, the first illustrating the penalties to be paid by one having undue attachment to objects of sense and the latter by one yielding to passions, etc. Begins. fol. 14 || 6 || atha dvAdazapariSatsvarUpaM kathyate / Ends.- prathamatramadhye pUrvadizito pravizva AjJepakUNe / pUrva sAdhusabhA tataH sAdhvIsabhA tatpRSThe vaimAnikadavAMganA sabhA tathA dakSiNato (taH) pravizya etc. fol. 7 tathA ca sa devastaM namaskRtya svasthAnaM yayau / tadanaMtaraM sa munizvaronupi kaSAya sarpAn zarIrakaraMDake saMyagya bahirgacchato rakSayAmAsa nAgadatta samunirevaM kaSAyAn vinirjitya sakalakarmakSayaM kRtvA kiyatA kAlena kevalaM prApya mokSaM prAptaH / iti zrI gAMdharvanAgadattavihAriNo pramAdapaMcaviSaye zrISadadazatIrthakaro zrIcakrAyudhanRpeNa agra iyaM kathAnakaM kathitA / Reference. -- This very Ms. along with two more are noted in Jinaratnakosa ( Vol. I, p. 188). dharmadattakathA No. 303 Size - 1o in by 44 in, Extent.--- 16 folios; 16 lines to a page ; 44 letters to a line. Description. Age.- Samvat 1521. Author. -- Not known. Dharmadattakatha 1312. 1887-91. Country paper very thin and greyish; Devanagari characters ; small, legible and good hand-writing; borders ruled in three lines in red ink; foll. numbered as usual; on every fol. almost in the centre there is a spot in two colours viz. red and yellow; yellow pigment used; edges of almost every fol. more or less damaged; condition very fair ; complete.

Page #448
304.] The Svetambara Narratives 413 Subject. --- A story of Dharmadatta pointing out the importance of "supatra dana". Begins.-- fol. 1 // 6 // // 'raMgAvatyAM' rAjA lkssmiiptiH| kamalA rAjI tayoH putraH pAtraMzadaMDAyudhazramaveditA / shbdvedhii| dhanurvedapAragaH / sarvavidyApravINaH / sarvabhASAnipuNaH meghanAdanAmA etc. Ends.-- fol. 16 zrIdattaM putraM rAjye sthApayitvA svayaM saMyamazriyaM gRhItvA siddhi saukhyaM sisseve| puMsAM ziromaNI aMte dharmArjanaparA narAH / AbhiyaMte ca saMpalitAbhiriva pAdapAH // 105 // iti supAtradAne dharmadattakathA samAptA / likhitA vijayaharSagaNinA 'mAhaNam'grAme / saM. 1521 varSe / cha / Reference.- This very Ms. and the next together with some more are noted in Jinaratnakosa ( Vol. I, p. 183 ). 10 20 dharmadattakathA Dharmadatta katha 1313. No. 304 ___15 1887-91. Size--109 in. by 4 in. Extent.--- 8 folios; 16 lines a page ; 48 letters to a line. Description.- Country paper thin and greyish ; Devanagari chara cters ; small, legible and good hand-writing ; borders ruled in four lines in black ink; red chalk used; foll. numbered as usual ; edges of some foll, slightly worn out; condition tolerably good ; complete. Age.- Samvat 1660. Author.- Not known. 25 Subject. - Life of Dharmadatta narrated in Sanskrit to illustrate the prowess of dharma ( religion ). Begins.- tol. 1 dharmAdeva samIhitArthaghaTanA no pauruSAta prANinAM / yad bhAnobhraMmato'pi nAMbaratale syAdaSTamaH sedhavaH / / 30

Page #449
414 Jaina Literature and Philosophy [304. svasthAnAt padamAtramapyacalato vidhyasya caaneksho| jAyate madhupAlipAlitayaza zrIlaMbhinaH kuMbhinaH // 1 // tathAhi / iha 'bharata'kSetre 'kAzmIra'deze 'caMdrapuraM' nAma nagaraM yazodhavalo nAma rAjA etc. 5 Ends.-fol, 8 samaye zrIdattaM putraM gajye sthApayitvA saMyama lAtvA zivamApa || cha / bhImaM vanaM bhavati tasya puraM pradhAnaM / ___ sarvo janaH sujanatAmupayAti tasya // kRtsnA ca bhUrbhavati saMnidhiratnapUrNA / pasyArita pUrvavihitaM sukRtaM narasya // 1 // iti zrIdharmadattakathA samApta saMbata1660varSe Asuja vadi 11 dine / Reference.- See p. 413. 10 .. dharmadattakathAnaka Dharmadattakathanaka 1311. No. 305 1887-91. Size, -- Iof in. by 41 in. Extent.- !3 folios ; 13 to [4 lines to a page; 36 letters to a line. Description.- Country paper thin and greyish ; Devanagari chara. cters; big, clear but poor hand-writing ; borders ruled in three lines in red ink ; red chalk used; foll. numbered as usual ; complete; condition very good. Age.- Samvat 1635. Author.- Not mentioned. Subject...~ This story points out the importance of " supatra dana". It is written in prose in Sanskrit. Begins.-fol. 1 // 6 // OM namo vItarAgAya dAnaM supAtre vizadaM ca zIlaM tapo vicitraM zubhabhAvanA ca / ... dharma caturdhA munayo vadati / / 1 // 1 The third foot is wanting in the Ms.

Page #450
306. j The Svetambara Narratives 415 atra kathA yathA / iha 'bharata' kSetre 'kAzmIra' deze 'caMdrapuraM nAma nagaraM caMdraghavalo nAma rAjA etc. Ends. fol. 134 krameNa tasya dattanAmA putro jAtaH / so ( 9 ) pi samaye tasya rAjyaM dattvA svayaM svarNapuruSeNa abhivarddhitasaMvatsa (raM) pravartayAmAsa / pazvAd dIkSAM labhau / yataH AgamoktaM / vaMde caMde abhicaDhiyaMmi caMde abhicaDhie ceSa | adya yAvaccaMdra saMvatsara abhirvAdvaya saMvatsaraH pravartate sa vIradhavalo rAjarSiH kevalaM prApya mokSaM prAptaH || 5 iti zrIdharmadattakathAnakaM / samAptaH saMvat 1635 sAsarabadi some / 'gurjara 'dese 'harasora' nagare likhitaM RSiyAdavagaNinA / subhaM etc. dhUrtAkhyAna ( dhuttakakhANa ) No. 306 Dhurtakhyana_10 ( Dhuttakkhana ) 1314. 1887-91. Size - ro in by 4g in. Extent.- 10 folios; 17 lines to a page; 56 letters to a line. Description. Country paper very thin and greyish; Devanagari characters with pRSThamAtrAs; small, clear and fair hand-writing; borders mostly ruled in three lines in red ink; foll. numbered as usual ; complete; condition good. Age. -- Samvat 1484. Author.- Haribhadra Suri. Yakini is his spiritual mother. For details in English about the author's life and works see my introductions to Anekantajayapataka ( Vols. I-II ) published in " Gaekwad's Oriental Series " as Nos. LxxxVIII and CV in A. D. 1940 and 1947 respectively 25 and for details in Gujarati see my book entitled zrIharibhadrasUri ( " mahattarA yAkinInA dharmaputra samabhAvabhAvI zrIharibhadrasUri : jIvana ane kavana ) published in Sri Sayaji Sahityamala as No. 336 in A. D. 1963. Subject. This Prakrit work contains five akhyanakas giving rise to 8, 6, 10, 10 & ro stories in 485 verses. They deal 15 20 30

Page #451
TO 5 Begins. fol. 12 I0 / namaH zrIsarvajJAya || IS 20 416 2 Jaina Literature and Philosophy [306. with five rogues. For details see my introductions etc. noted in "author". The object of this story is to point out inconsistency regarding some of the beliefs of the Vaidika Hindus. Ends. fol. rob bhiUNa jinavariMde tiasesara die dhuakele se | viu sajaNaboNatthaM dhuttakkhANaM pavakrakhAmi // / 1 etc. dhUrtAkhyAna No. 307 sammatta suddhiheDaM cariaM haribhaddasUriNA raiaM / Nita kahaMtANaM bhavavirahaM kuNau bhanvANaM || 22 aMbaravarasUrI haribhaddo kuNau amha bhddaaii| jassa sasisaMkhadhavalA jiNAgame erisA mattI // 23 iti tairuktaM khaMDavANApratyuttarakathAnakadazake // cha // iti dhUrtAkhyAne paMcamaM AkhyAnakaM // cha // saM. 1484 varSe (rSe) dIpotsave likhitaM // cha // graM0 600 // Reference. - Published in " Singhi Jain Series as No. x9 in A. D. 1944. This edition contains two additional works : ( 1 ) Sanghatilaka Suri's Dhurtakhyana (a Sanskrit metrical version of the Prakrit text ) and ( 2 ) its old Gujarati prose rendering named as " Dhurtakhyanakatha ". KHl Size.-- ro++ in. by 4g in Description. Extent. - 23 folios; to lines to a page; 32 letters to a line. Country paper tough and white; Devanagari characters; big, quite legible and good hand-writing: borders ruled in two lines and edges in one in red ink; numbers fof foll. entered twice as usual; white paste used; complete; condition very good. Dhurtakhyana 1378. 1891-95.

Page #452
307.] Age.- Pretty old. Author.-- Sanghatilaka Suri, pupil of Gunasekhara Suri of Rudrapalliya gaccha. He is the commentator of Damsanasuddhi (Samyaktvasaptatika) ascribed to Haribhadra Suri. - Subject. A Sanskrit version of Dhuttakkhapa. It examines some of the statements occurring in the Puranas etc. of the Brahmanical_literature. This work forms a part of 'Tattvakaumudi ( pp. 324 - 465 ), a commentary on v. 12 of Samyaktvasaptatika. Begins. fol. 1deg // OM hrIM namaH // The Svetambara Narratives samasti 'bhArate' varSe harSotkarSakare satAM / etc. 'yA' deza lezo yatra na pApmanAM // 1 // svaH purIjayinI tatra samasyujjayinI purI / yAM draSTumi gIrvANA nirnimeSatvamAzritAH / 2 // Rang ( ? )yuvacAlA nikRtivratAH / sUyAMso sUrivezebhyaH samIyurdhartapuMgavAH // 5 // etc. fol. 4b Ends.- fol. 23* Reference. yaH surAdhA (zA) debA hariharAdayaH / muktvakaM zrImahAvIraM khaMDitA hi manobhuvA // 54 // yadi sarvagato viSNuriti satyaM vaco bhavet / tadA smarAturo gopi (pIH ) kiM ciMtayati kAmivat ? // 24 // asaMmAnyamidaM loke zrUyate yadumAmatA (lA) t / jAto'pi prAptacaitanyaH paTTathe sa gaNAdhipaH // 25 // ityete laukikAlApAH purANAdisamudbhavAH / vizIryete pratipadaM vicakSaNavicAritAH // 26 // ato lokikaM vAkyaM rAsabhoccAraSad bahiH / ramyamaMtazvityamAnaM punastuSava sAkulaM // 27 (427 ) / / iti zrIdhUrtAkhyAnaM saMpUrNa samAptaM // zrI Published in Samyaktvasaptatika and in the edition of Dhurtakhyana ( pp. 33-48 ) noted on p. 4.6. For 417 1-2 Both are published together in D. L. J. P. Fund Series as No. 35 in A, D, 1913. 53 J. L. P. S 10 15 20 25 30

Page #453
418 Jaina Literature and Philosophy [309. additional Mss. see "preface (p. XIII ) of this edition and Jinaratnakosa ( Vol. I, p. 199). On pp. 37-39 of this edition there is an investigation of the contents of this work ( No. 307). dhUrtAkhyAna DhurtakhyanavAlAvabodharUpakathA balavabodharupakatha No. 308 407. 1879-80. Size.-93 in. by + in. Extent.-- 17 folios; 13 lines to a page ; 40 letters to a line. 10 Description.-- Country paper thin, tough and white; Devanagari characters; small, clear and good hand-writing ; borders not ruled ; white paste used ; foll. numbered as usual; fol. 8b blank but the matter is not lacking ; fol. 176 blank; some foll. slightly worin-eaten ; condition fair; complete. 15 Age.- Not quite modern. Author.- Not mentioned. Subject. - A Gujarati version of Dhutlakhana of Haribhadra Sari. It deals with rogues. Herein the Prakrit text and its Sanskrit version, too, are utilized. 20 Begins.- fol. !" // 50 / / zrIzAradAyai nmH|| sadupaniSadi(da)nekagraMthasaMdarbhabhAbhiH / parasamayatamAMsi dhvasayitvA(5)pumAH(nA)d yaH / gaganamiva dinezaH zAsana jainametat / / za(sa) jayatu haribhadraH sUrI(ri)rU(ru)dA(hA)maghAMmA[:] // 1 // iha hi caturdazasaMkhyaprakaraNapraNetRbhiH zrIharibhadrasUribhiH etc.. dhUrtAkhyAnaM(na)samAnatAM darzanAya nirmitasya dhUrtAkhyAnabhidhAnasya kathAgraMthavizeSasya lokabhASAyAM kathA likhyate / zrI mAlava'dezi ujeNI nagarI sehaneM utara dize eka udyAMna chai etc. Ends.- fol. 17* sakala puruSArthasArA paramAnaMdapadadAyaka pUrvAparavirodhagaMdharahita zrIvItarAga trailokyapUjita sarvajJanAM vacana sAMbhalavAM sahahavA anumodavAM dhyAvA iti sakalazvetAMbaziromaNisarvazAstrakArAlakArAyamAMnabha zrIharibhadrasUriviracitasya dhUrtAkhyAnaprabaMdhasya bAlAvabodharUpAH kathA samAptAH // 25 30

Page #454
309.) The Svetambara Narratives 419 Reference. - Published as one of the three works on pp. 49-65 in the 'edition of Dhurtakhyana mentioned on p. 416. On its pp. 39-41 there is an investigation of this work. For an additional Ms. see p. XIII of this edition. In Jinaratnakosa ( Vol. I, p. 199 ), it is observed : " gaitnia ( Bhasa ). Idar 95. Probably a Hindi rendering ". Is this surmise correct? - dhUrtAkhyAna DhurtakhyanabAlAvabodharUpakathA balavabodbariipakatha 10 335, No. 309 1895-98. Size.-- 91 in. by 4} in. Extent.-- 7 folios ; 22 lines to a page ; 54 letters to a line. Description. --- Country paper thin, tough and white ; Devanagaris characters; small, legible and good hand-writing ; borders not ruled; red chalk used ; toll. numbered as usual ; fol. 7" blank; complete ; this Ms, appears to be better than the preceding in point of correctness ; condition good. Age.- Pretty old. Begins.- fol. 1 stataTittit 4: 11 Fagage(a)af etc. as in No. 308. Ends. fol. 7a FG#14H14# etc. up to arslaaiTEIT: For: goi: 1 practically as in No. 308. N. B.- For further particulars see No. 308. 20 1 Herein this very Ms. ( No. 308 ) is utilized,

Page #455
420 Jaina Literature and Philosophy [310. bhavajabhujaGgakathA Dhvajabhujangakatha 1310 (8). No. 310 1886-92. Extent.- fol. 7* to fol. 9*. Description.- Complete. For other details see mUladevakathA No. 1886-92. 10 Author.- Not mentioned. Subject.- A story of Dhvajabhujanga for illustrating the impor tance of vastu-dana, a kind of donation. Begins,- fol. 7* atha yastudAne dhvajabhujaMgakathA // 'ujjayinI pratyAsama(na)'zAli 'grAme tthkkrsiNhpaal| mAcI yazodevI etc. Ends. -- fol 9' anazanena samaraNaM mRtvA / sodharmavetraH samajani katipaya bhavamokSo mAdhi // vastRvAne dhvajabhujaMgakathA / / 7 // Reference.- In Jinaratnakosa ( Vol. I, p. 199) three Mss. of an anonymous work bearing this very name are mentioned. 20 dhvajabhujaGgakathA Dhvajabhujangakatha 823(f). No. 311 1892-95. Extent.- fol. I0deg to fol. 14'. Description.- Complete. For other details see kumcandramantrikathA __No. 154. Begins- fol. 10* atha vastudAne dhvajabhujaMgakathAH // 5 / 5 // 'ujjayinI 'pratyAsanna zAli'grAme ThakurasiMhapAlaH // mAryA yazo devI // etc. Ends--- fol 14vaM bhUri bhavavedanIyaM dughu(?ka)ma arjitaM tadapi tIvradhamIzravapA... dinamitI zrutijAtismaraNaM zrAvakatva prAptaM // krameNa mRtvA saudharmadeva katipayabhadhe mokSyaH / / zrImahAvIrajIna namaH / N. B.-- For additional information see No. 310.

Page #456
SUPPLEMENT 10 'Anandamandira rAsa Anandamandira'rasa [ starfaitia) [ Sricandra kevalirasa ] 346. No. 312 1871-72. Size.- 101 in. by 4 in. Extent.- 181 folios; 15 lines to a page; 40 letters to a line. Description.- Country paper thick, rough, tough and white ; Jaina Devanagari characters with occasional TrataTS; small, quite legible, fairly uniform and beautiful hand-writing ; borders ruled in two lines and edges in one in red ink; foll. numbered in the right-hand margin ; fol, r. blank; almost all the lines on fol. 18. are written in red ink; yellow pigment profusely used on fol. 1806: edges of the last fol. partly gone ; condition on the whole good ; complete; composed in Samvat 1770 in Radhanapura in In dhalas; the total extent 7649 slokas the entire work is divided into four adhikaras ; the extent of each of them is as under :Adhikara I foll. I to 286 II 290 , 346 III >> S4 >> Tos , IV 105* 181. Age.- Samvat 1790. Author.- Joanavimala Suri ( previously named as Nayavimala ), pupil of Dhiravimala. His additional works are as under : (A) Sanskrit [1+3=4 ] (a) metrical ( 1 ) 1. TESTISTFITS 20 35

Page #457
422 Jaina Literature and Philosophy [312. (b) non-metrical (3) 2. praznavyAkaraNa-vRtti 3. zrIpAlacaritra V. S. 1745 4. saMsAradAvAnalastuti-vRtti (B) Gujarati [ IS +12=27 ] (a) metrical (15) 5. azokacandra-rohiNI-rAsa V. S. 1774 kalpavyAkhyAna 7. kalyANamandirastrotragItasaGgraha 8. gaNadharastava-devavandana 9. covIsI 10. jambUrAsa V. S. 1738 II. tIrthamAlA 12. dIpotsavI-devavandana 13. pandaratithi-amAvAsyA-stutisaGgraha 14. bAravratagrahaNa(TIpa)rAsa V. S. 1750 I5. maunaikAdazI-devavandana 16. raNasiMha-rAjarSi-rAsa 17. sAdhuvandanA V. S. 1728 18. 'stavanasaGgaha : zAntijinastavana (V. S. 1736 ) etc. 19. 'svAdhyAyasaGgAha : aGgopAGgasvAdhyAya, AThaguNasvAdhyAya, caraNa saptati-karaNasaptati-svAdhyAya, dazavidhayatidharmasvAdhyAya, narabhavasRSTAntasvAdhyAya ( earlier than V. S. 1734), pazcanamaskArasyAdhyAya etc. V. S. 1755 I A number of Gujarati stavanas, stutis, svadhyayas ( sajjhayas ) and padas is published in "prAcIna stavana ratnasaGgraha" ( pt. I). Here a life-sketch of the author is given. 2 A list of the published svadhyayas is given in Jaina Gurjara Kavio (Vol. II, p. 335).

Page #458
312. ] Supplement: The Svetambara Narratives (b ) non-metrical ( 12 ) Balavabodha ( Vartika ) on each of the following works: V. S. 1770 20. adhyAtma kalpadruma V. S. 1769 21. AnandaghanacobIsI V. S. 1763 22. dIpotsavIkalpa V. S. 1739 V. S. 1773 23. navatatva 24. pakkhiyamutta 25. praznadvAtriMzikhA 26-28. bhAsatia ( bhASyatrika ) 29. yogadRSTinI sajjhAya ( svAdhyAya) 30. samaNasuta 31. sADI vraNaso gAthAnuM svatrana Subject.-- Life of Sricandra. For contents see p. 426. Begins.fol. 1' e50 // zrIpArzvanAthAya namaH zrIgurubhyo namaH sukhakara sAhiba sevIrye zrI' saMkhesara' pAsa jAsa sujasa jagi vistayoM mahimAnidhiAvAsa 1 Ends.-180b V. S. 1743 vAsavapUjitacaraNakajarajapAvitapITha paratA pUraNa paragaDo ehavo avara na dITha 2 saMprati kAle tIrtha chaiM je mahimAbhaMDAra pANae atIta cauvIsIiM kahIu tapati vistAra 3 // etc. nu jJAnavimala gharI neha e AnaMdamaMdirageha A udyama ANI e ghara sukhaheteM karya jI 29 jI re jI ho udyama 0 yataH kAvyaM elA yatra dayA kSamA calavalI satyaM laviMgaM paraM kIphalAni viditazcUrNaH sa tatvodayaH arvi 1 This date and the rest given hereafter pertains to " Balavabodha ". 2 For the vartikas on the three Bhasas (Bhasyas) see Vol. XVII, pt. 4, Nos. 1229, 1267 and 1312. 423 JO IS 20 25

Page #459
424 Jaina Literature and Philosophy [312. karaM munidAnamuttamaguNaM zIlaM supatroccayo pahanI(NI)dhvaM guNakajine nigaditaM tAMbUlametajjayaH 1 jihAM ravizazInAM teja siMdhu dharAne heja A AnaMdamaMdira pa tihAM lagaI thira raho jI 30 sarva gAthA 2267 bhatIta covIsI ehathI thaI pehalI jeha nirvANAjinatIrathe ya(tha)tho(po) eha guNageha 1 se saMbaMdha tapa Upari saMprati vIra jiNaMda / gautama pramukha paraMparA valI je pUrva mariMda 2 teNaI kathita caribathI tasa anusAra pragaTTa DAlarUpa e bAMdhIo manamode gahagaTTa 3 attAgama ne anaMtarA paraMparAgama jeha pravacana pramANa , tehi ja nissaMdeha 4 Apamati abhinivesiyA avinayI ne bahumApa tahanAM bacana pramANatAMbahusaMsArI thAya 5 jiNaANA Agali kareM naya gama bhaMgapramANa syAdvAdI zuddha kathaka je jJAna kriyA ahiThANa 6 sahanAM vacana pramANatAM samakita nirmala thAya samakitathI cAritranI guNa maghalA ThaharAya 7 sarva gA(thA) 2373 hAla 55 mI rAga dhanyAsI .. 'tapa' gacchako sulatAMna mahAyeM e dezI 'tapa' gancha nirmala jima gaMgAjala lAyaka nAyaka tehanA jI bhIANaMdavimala risara saMprati saMvegaguNa jehanA jI 1 suNayo maviyaNa ! sAdhu taNA guNa bhaNayo bhAve dharIne jI jinadarzana munivaMdana e behu moTA karaNI mavine jI suNayo0 AMcalI kriyAuddhAra karIne jeNe zAsanazoma caDhAIjI kamatajaladhImA paDatAM janarne bodhi dIo sukhadAI jI 290 bhIvijayadAnasUrIsara suMdara tasa paTadinakara sAraMpA jI aDI lAkha jinabiMdha pratiSThA jinamate suMdhA pariSyA jI su. hIro zrIhIravijayo sUrI kIrti sajI jiNe gorI jI sAhi akabarane nija vayaNe jinamata syu matti jorI jI 4 su.

Page #460
312.] Supplement : The Svetanbara Narratives 425 bhAhi salema Agali jaya varIo zrIvijayasenamarI guNadarIo jI virura 'savAI jagataguru' dhagao matti suraguru adhikario jI 5 saNa. bhIvijayadevamarIzvara tasa pATI udayo abhinara bhANa jI / AcArija zrIvijayasiMha sUrIsara jJAnakriyAguNa jANa jI 6 su. anukrame te AcArija sarapati praticodhana pohatA jI bhIvijayadevasUrI nija paTTe dhApaDa zrIvijayaprabhamUri vinItA jI saNa. saMprati te jayavaMtA huMtA tama maccha zobhAkArI jI bhIANaMdavimalasUriMdIkSina kavi dhamasiha prati sArI jI 8 mu. tasa ziSya zrIjayavimala vibudhabara kAtivimala kavi sIsa tAnA jI 10 sadAcArI zuddhAhArI viruda kahIjeM teinA jI 9 mu0 zrIvinayavimala paMDita vayasagI zigya tehanA lahIhaM jI zrIvijayaprabhamarinI ANA sIsa dharI niravahI jI(10) saNayo / dhIravimala pAData tasa sevaka samaya mAni zuddha pANI jI zaktipramANa kriyA anusaratA sIpavatA bhAva prANI jI 111deg 15 'vaImAna'tapakAraka tehanA labdhivimala tasa mIsA jI laghu sevaka nayavimala vibudhanA budhamA sabala jagIsA jI 12 maNayo mayaNa sahAI cita niramAya upapa karI lIdhu jI AcArijapadeM zAnavimala ili nAma dhayuM suprasIdhuM jI 13 eNayo' nidhi yuga muni zazI 1741 saMbata mAne phAguNa zudi paMcamI 20 divaseM jI 'pattana'[na]nayara saNeM tama pAse pada pAmyaM zubha deze jI mnnyo| 14 bhIvijayaprabhasUrIne pATi papa ?) bhaMvega bahAyA jI jJAnAvamalasUrI saMprati dIpaI taji taraNI savApA jI 15. tiNe e ANadamAMdara nAmeM gama ko sukhaheti jI 23 sAgara vijaya behu bhamavAye saNavA ne saMkate jI 16 maNayo. 'rAdhanapura' sahareM prAraMbhyo saMpUraNa thayo tihAI jI nabha mani muni vidhu 1770 saMvatra mAni adhika bhadhika upavAjI 17 maNayo. mAha zudi ajUyAlI terasI pUraphAraka yoge jI snAtrovadine baDhayo pramANe epathI sakhIo saba loga jI 18 30 saNayo. 64 1J.L.P.

Page #461
426 10 laina Literature and Philosophy (312. arihaMta siddha susAdhu sudharmanAM maMgala ehi cyAra jI e AnaMdamadiramA tehathI sukhIyo sahu saMsAra jI 19 suNayo. eka zata ekAdaza (111) che DhAlA nava nava baMdharasAlA jI zata cchIhottarI guNayAla graMthaI bhaNatAM mAlA jI 20 suNayo. sarva gAthA 2394 graMthAgraMthabhAna 7649 // iti zrIzrIcaMdraprabaMdhe pravAsacaryAyAM tApasapratijAgaraNa 1 svargasiddhiprApaNa 2 zrIparvate gamanaH 3 bhillamocana 4 aya kuMbhasvarNIkaraNa 5 sthAna sthAne kanyApANigrahaNa 6 kakkoMTaka'dvIpagamana 7 tatra umAkharparAmukhAta jJAtapitRdukkhaM tannirAkaraNArtha nimittarUpadharaNa 8 pAtAlanagagaMtakanyApANigrahaNa 9 'caMdrahAsa[ma] khaDgaprApaNa 10 vidyAsAdhana 11 abadhunabhavanamAtRmilaNa 12 svajana pakSaNa tatra jaMtugRhAMtarjalanapitRpakSaNa 13 bhilladharmopadezakathanA 14 mohinIpratibodhana 15 vividhavinodavilokana 16 bhATakeM pANigrahaNa 17 rAjaputrabaddhamocana 18 zIladRDhIkaraNa 19 rAjAmilana 20 baMdhujana. mamahaHkaraNa21sakalastrImamudAyIkaraNa 22 vaitAThyagamanage 22 tadrAjyAdibahulAbhaprApaNa 23 dharmopadezazravaNa 24 svabhavapRlchana 25 zrAddhadharmaaMgIkaraNa 26 rAjya sthApana 27pitRmAtRsaMyamagrahaNa 28 ziSyAsahana 29 susaDhakathAprathana 30 dharmakaraNAkaraNa 31 sutAdInAM dezagajyAdivitaraNa 32 svayaMdIkSagrahaNa 33 kevalajJAnaprApaNaH 34 parivAradIkSaNa 35 AtmanI(nirvANagamanaH (36) AnaMdamaMdiraguNaprakaTana 37 ityAyanekavicArasAramaya AnaMdamaMdiranAmni rAsake caturtho(5)dhikAraH samAptaH || iti zrIzrIcaMdrakevalIrAsa // AnaMdamaMdiranAmA saMpUrNo likhitaH saMvat 1790 zA. 1655 phAguNa zudi 10 ravI sakalapaMDitaziromaNi paDitazrI 108 zrIdevasaubhAgyagaNijhiMdhagaNiratnasaubhAgyalipika saMpUrNam zubhaM bhavatu Reference.- Published by Bhanji Maya for Bhimsimha Manak in A. D. 1912 ( 2nd edition). For extracts and additional Mss. see Jaina Gurjara Kavio ( Vol. II, pp. 320-323 & Vol. III, pt. 2, pp. 1304-1305). 1 This numbering is wrong in the Ms.

Page #462
314.] 6 Anandamandira 'rAsa No. 313 Supplement: The Svetambara Narratives Size. 10 in. by 48 in. Extent. 216 folios; 15 lines to a page; 34 letters to a line. Description. Country paper thick, tough and white; Jaina Devanagari characters; big, thoroughly legible, uniform and very good hand-writing; borders ruled in two thick lines and edges in one in red ink; red chalk used especially for marking out the numbering of the verses; foll. numbered in the right-hand margin; fol. 1 blank; condition very good except that edges of the last fol. are slightly gone; practically complete; total extent 8640 slokas. Age. Not modern. Begins fol 1 || e 50 // zrIgoDIpArzvanAthAya namaH // duhA gal etc. as in No. 312. N. B. 'Anandamandira'rasa 179. 1881-82. Ends. fol. 2154 jJAnavimala gharI neha etc. up to avadhUtabhavana mAtRmala 12 as in No. 312. This is followed by the lines as under:ityAdi saptatri ( triM ) zata adhikAre anekavicArasAramaya AnaMdamaMdiranAma caturthI ( s) dhikAraH samAptaH 427 ' Anandamandira 'rAsa No. 314 iti zrIcaMdra kevalirAsaH samAptaH 'sUrata baMdare' #zubhaM bhava (tu) / zrIH // zrIH // zrIH // chaH zrI / zubhaM bhavatu / zrIH // 5 For further particulars see No. 312. 'Anandamandira'rasa 1664. 1891-95. Size. 10 in. by 48 in. Extent. 183 folios; 15 lines to a page; 42 letters to a line. Description. Country paper thick, tough and white; Jaina Devanagari characters; big, perfectly legible, uniform and very good hand-writing; borders ruled in two lines and edges 5 10 IS 20 25 30

Page #463
428 Jaina Literature and Philosophy [314. in one in red ink ; red chalk used ; foll. numbered in both the margins ; fol. :a blank; so is the fol. 1836 except that on it is written the title as zrIcaMdra kevalIprabodha ; on foll. 116", 117, 117, 118' and is some verses from the Mahabharata etc. are quoted; so Gujarati tabba is written interlinearly ; in the left-hand margins the title is written as zrIcaMdakeva, zrIcaMda ke and zrIcaM kevalI ; complete ; edges of the last fol. slightly gone; strips of paper pasted to it; condition on the whole good. Age.- Sainvat 1813; Saka 1679. Begins.- fol. 10 // 50 / / zrIISTadevatAya namaH / sakalabhaTTArakapuraMdarabhaTTAraka zrIzrAzrI 108 zrI zrIzI vijayakSimAsurizvaraparamagurubhyo namaH // 10 IS sukhakara sAhiba patrIiM etc. as in No. 312. Ends.- fol. 181 jJAnavimala dharI neha etc. up. to AnaMdamaMdiranAmni rAzake caturtho()dhikAraH 4 samAta: as in No. 312. Then we have: sayata 1813 varSe zAke 1679 pravartamAne jyeSTamAse kRSNapakSeH SaSTItithau somanAsare laSitaM ghoghAdare / / sakala (jya)bhaTTArakapuraMdarabhaTTArakamI 108 zrIzrIzrI vijayakSamAsUrizvaracaraNasevIH paMjIvavijayagaNi tatsISyapavinItavijayagaNa tatbhrAtA paMharSavijayagANi munizAMtivijayavAcanArthaH / / zrInavakhaMDaprasAdAta pArzvanAthajinaprasAda 'purNamA'gacche / / paMphattesuMdarajI tAsIrapaharaSasuMdara lapikRtaM / 'marudhara dese / / 'ahilANa' - puravAstavyaH tathA taDavAmadhye cArAkSare svanAM pratiSTitaM // jiddA lage 'mesa' mahIdharAja baMtA sasi bhANa jihAM lage e pustikA / dAMcI harSa sumAMga 1 jihAM lagi 'meru' aDaga / jihAM lagi zasI hari mUri tyA lagi A pothI sadA rahata sadA bharapUra 2 // zloka: bhannapRSTi kavigrIvA krAdhiomukha kaSTena likhita zAsa jo paripAlayet 3 yAdRzaM pustakAdavA tAdRzaM laSitaM mayA yadi zuddhamazuddhaM vA mamopAna dIyate 4 //

Page #464
is.] Supplement : The Svetambara Narratives 429 iti zubhaM bhUyAt // zrIsstu kalyANamastu / / kahAM koyala kahAM aMbadhana kahAM maurA kahAM meha? dura gayAM naha vIsare sajana taNA saneha 1 prIta purAMNI na huve jje uttamase lagma so barasa jalameM rahe to hi cakamakka taje na agA(gga )2 prIta purAMNI na huve je lAgI laghu veza mAghe aMgANa ghara vaso bhAveM vaso videza 3 // vAMcajo bhaNajo saMbhArajojI / / shrii| N. B.- For further details see No.312. khimaSicatuSpadI Khimarsicatuspadi 10 (khimarisicopAi) ( Khimarisicopai) No. 315 127 (7). 1872-73. Extent.- fol. 6. to fol. 6b. Description.- Complete ; 26 verses in all. For other details see is Upadesaratnamala (Vol. XVIII, pt. I, No. 264 ). Author.- Not mentioned. Subject.- A story of Khima ( Boha ) xsi in Apabhramsa. Begins.- fol. 6 / / 6 / / namaha narAmarasivasuhakaraNa / siriSamarisihi muNidaha calaNa / siriSamarisihi mahiMdaha vrii| nimuNau bhavIyA ! thira mana dharI / ' 1 // etc. Ends.- fol. 60 bohau Samaripti kanharisIsAra sirijasabhadasUrigaNahAra iya jo nAmoccAra karei / lIlai so saMsAra tarei / cha / // 26 // iti ghamArasiMcapaI samAptaH // cha /

Page #465
JO 15 20 21 430 Jaina Literature and Philosophy aziigehal bvA sahita No. 316 Extent. fol. 13" to fol. 17. Description. Both the text and its explanation complete. For other details see zrImatIkathA No. 1321 (a). 1886-92. Begins. (text) fol. 13b Author. Not mentioned. Subject. A story of Candapingala, a thief and its explanation in Gujarati. The prowess of Navakara' mantra is pointed out in this work so much so that this thief became a king in the next birth. "1 [316. paratre ( s)pi hi labhyate rAjalIlocitAn sukkhAn navakArAt yathA prAptaM caureNa caMDapiMgalavat 1 etc. ( tabba ) fol. 13 deg navakAranai prabhAvai paratre kahatA Agalaha bhavai etc. Ends. (text) fol. 17b pApakamavidhivauro caMDapiMgalanAmakaH mRtvA puraMdaroM rAjA saMjAto jainamaMtrataH 45 iti zrI navakAraviSaye caMDapiMgalacaurakathA || 46 ( tabba ) fol. 17h iti caMDapiMgacorakathAsaMbaMdhaH TabArthai caturthaH 4 // Candapingalakatha with tabba 1321 (d). 1886-92. candradhavaladharmadatta-kathA No. 317 Size. 10 in. by 41 in. Extent. 17 folios; 13 lines to a page; 33 letters to a line. Description. Country paper tough and white; Devanagari characters with rais; big, clear and good hand-writing; borders ruled in four lines in black ink; foll. numbered Candradhavala Dharmadatta-katha 160. 1872-73.

Page #466
318.] Supplement: The Svetambara Narratives 431 as usual ; foll. 1 and 17 blank : red chalk and yellow pigment used; complete; condition very good. This Ms. opens with one verse in Prakrit. Age. -- Samvat 1641. Begins. -- fol 1 || 6 Ends - 17 * zrIdattaM putraM etc. up to saMpUrNA kRtA as in No. 204. This is followed by saM. 1641 varSe. different hand : Then we have in a || zrIvItarAgAya namaH | sataha satthA sauNA bhumiNA gahA ya nakkhatA / tihuaNa maMgalAnilayaM hiya ( pa ) mi jiNaM bahaMtANaM // 1 // tathAhi / iha ' bharata 'kSetre etc. as in No. 204. zrIrudraziSyo mANikya suMdaraH / sUrirenAM karoti sma saMvibhAgavrate kathAM // 1 // yAvanmerurmahI yAvad yAvaccaMdradivAkarau vAcyamAno janaistAvat kathA ( 1 ) sau labhatAM prathAH // 2 iti dharmadattakathAnakam | zrI stAt N. B. - For additional information see No. 204. jinadAsakathA TabbA sahita No. 318 - Extent. fol. tot to fol. 13. Description. Both the text and its explanation complete. For _1321 (a). other details see zrImatIkathA No. 1886-92. Jinadasakatha with tabba 1321 (c). 1886-92. Author. - Not known. Subject. A story of Jinadasa, a merchant, along with its Gujarati explanation. This merchant's life was saved as he resorted to ' Navakara' mantra. 5 10 15 20 25

Page #467
432 Jaina Literature and Philosophy [318. Begins.-- ( text ) fol. 104 ApataH saMkaTe jIvo navakArAt pramucyate jinadAzo yathA zreSTI prayuktaH saMkaTAdapi etc. "- (tabba ) fol. 10* ApadA saMkaTa kaSTa mAMhi te navakAranA prabhASadhI etc. s Ends.- (text) fol. 136 navakAramabhAvena saMkaTaM maraNAtikaM TalitaM jinadAsasya purAvAsI jane(s)pi ca 45 evaM jinadAza(sa)sya kAlo('pi kiyato gataH aMte samAdhinA mRtvA saMprAptaH murAlaye 46 10 iti navakAraviSaye jinadAsAkathA // 3 "- (tabba ) 3 iti zrInavakAranai jinadAsakathA tRtIyA dhanapatikathA Dhanapatikatha 823 (g). No. 319 1892-95. Extent.- fol. 14* to fol. 14b. Description.- Complete. For other details see kurucandramantrikathA 823 (a ). IS NO. 1892-95.. Begins - fol. 14 'acalapure' nagare sUratejo nAma nRpaH / / etc. Ends.- fol. 14 zrute jAti smaraNaM // satpAtraM sAdhubhyo dAtavyamityatigrahaH // Avakadharma ca prapanna // tRtIya bhave mokSaH // iti pAtradAna( ne) dhanapati vasahIsINAsINakathA saMpUraNAM // lapataM gaNipunyasAgara nIraja rAhita / saMyapaTa(Tha)nArathaM N. B.- For additional information see No. 295. - -

Page #468
5 320.] Supplement : The Svetambara Narratives dharmaparIkSAkathA Dharmapariksakatha 1270. No. 320 - 1891-95. Size.-- 11 in. by 4; in. Extent.- 12+1=13 folios; 16 lines to a page; to letters to a line. 5 Description.- Country paper thin, rough and greyish; Devanagari characters with occasional Trai; small, clear and good hand-writing; borders ruled in four lines in black ink; red chalk used; numbers for foll. entered just in the corners of the right-hand margins ; fol. II repeated; the last fol. 10 though 12th numbered as 1 3; perhaps because the 12th fol. is missing ; edges of the first fol. slightly damaged ; condition very fair ; complete ; composed at the request of Devacandra, pupil of Padmanandin, a spiritual descendant of Pujyapada. Age.- Does not appear to be modern. Author.- Ramacandra. He is a Digambara. Consequently this work ought not to have been assigned a place in this Part I. Anyhow this work is copied by aj Svetambara monk.. Subject.-- A religious discourse. Begins.- fol. !" ||60 // namo jinAya / praNipatya jinaM bhaktyA syAhAdaparanAyakaM / myAM dharmaparIkSAlyAmabhivAsye yathAgamaM // 1 // tara padhA 'visa'girI' vIranASasamavasaraNe pratigAbinA gayA 35 zreNikAya pitA etc. Ends.- fol. 12 iti rAmacaMdraga enimA guNazAlinA / katA dharmaparIkSeyaM surajyA bhuvi kopiH|| kATItatvato vIkSya lATiM ca pidrii| kayAM dharmaparIkSAM tAM (katA) kRttiriya tataH / bhIpUjyapAdasadaze (jA)to'so paniAMgavaH / padmanaMdIti vikhyAto bhavyajyUhapravAditaH // 20 30 IIT. P1

Page #469
434 Jaina Literature and Philosophy [320. sacchiSyo devacaMdrAkhyo bhadrazvArugNAnvitaH / beditA sarvazAsANAM vikhyAto dharmarataH sadA // sa ca zuddhavratopetaH samayAdivivarjitaH / so'bhayaH sarvasattvAnAM tatprArthanavazAda brH| yAvad nyomni pravartate zazAMkaravitArakAH tAvad dharmaparIkSeyaM partipIpTa sadAzaye // 7 // iti dharmaparIkSAkathA samApta || 'Agama gajhe paM.haritilaka. gaNibhiH svavAcanArtha lakhitA // Reference.-- For additional Mss. see Jinaratnakosa (Vol. I, p. 190). 10 dharmaparIkSAkathA Dharmapariksakatha 1268. No. 321 1886-92. Size.-- 104 in. by 4; in. Extent. --- 16 folios ; 17 lines to a page ; 48 letters to a line. Description.- Country paper thin and grey; Devanagari chara. IS cters with pRSThamAtrAs; small, legible and good hand-writing 3 borders ruled in four lines in black ink; red chalk used; foll. numbered as usual ; fol. 16deg blank ; a strip of paper pasted to fol. 16'; complete; condition on the whole good. Age.- Nct modern. 20 Begins.- fol. !' praNipatya jinaM bhaktyA etc. as in No. 320. Ends.- fol. 16. iti zrIrAmacaMdreNa muninA gunnshaalinaa| khyAtA dharmaparIkSA sA kRtA kRtiriya tataH / / zrIpUjyapAdasadaMze etc. up to sadAzaye | as in No. 320. This is followed by the lines as under: pAnivAmamUtA hi kathA panAyanI bagaM / tathA dharmaparIkSA ca mithyAtvAjJAnAsinI // iti dharmaparIkSAkathA samAptA / / zubhaM bhavatu lekhaka. paaukyo| N. B.- For additional information see No. 320. 30

Page #470
ADDENDA S DCGCM ( Vol. XVII, Pis. 1-4; Vol. XVII!, Pt. 1; and Vol. XIX, Sec. 1, Pts. 1-2 & Sec. 2, Pl. I ). Add: References - For additional Mss., extracts etc., of some of the works out of those so far treated by me in the printed portions of the Jaina Catalogue mentiond above the reader may refer to Parts I & II of the following 'catalogue to be issued in three parts : " Catalogue of Sanskrit and Prakrit Manuscripts Muniraja Sri Punyavijayaji's Collection". Parts I & II are compiled according to the Scheme for the publication of the Catalogues of Mss. of the Ministry of the Scientific Research and Cultural Affairs, Govi. of India, New Delhi. 10 Vol. XVII, Part 5, Preface Page VIII, line 28. Add : Vinayacandra Suri has enumerated 15 objects bearing the following numbers in his Kavyasiksa ( pariccheda III, pp. 44-52 ): 1-18, 22, 24, 28, 32, 34, 42, 64, 68, 72, 84, 100, 108, 60000, 88000 and 8400000. Page 1x, line 1. The study of place-names is useful for that 20 of various branches of knowledge. Primarily place-names are connected with geography but dates associated with them supply us with their history. These names occurring in colophons and postcolophons are written by scribes in various languages, a regional one being one of them. Consequently these names can be studied from a linguistic stand-point. They have even a sociological bearing. Such being the case, we should have an institute at least in 25 1 Its l'arts I and II are published by L.D. Institute of Indology ( [HTE T r ata uringt farrafat) from Ahmedabad in A. D. 1963 and 1965 respectively. 2 Hereby names of 64 yoginis are montioned,

Page #471
436 Jaina Literature and Philosophy 10 15 Gujarar. As a small beginning "Gujarat Sthalanama Samsad" was established in Baroda in 1957. In England we have "English Place-name Society" and in Scotland" Scottish Place-name Socisiy". There are some in America, too. As regards the comparative study one may consult" Dictionary of English Place-names" published by the Oxford University, and publications of Place name Societies of various cities, oriental and occidental. Page XII, line 31. Add: The No. 84 noted on p. 435 refer to 84 countries-regions. This portion thus furnishes us with geographical data, and it is useful for Appendix VII. Vol. XVIII, Pt. 1 Page 364, last line. Add : This very text along with ataat (faite-Thr) by Racnaprabha Suri, is edited by Hemasagara Suriji and published in A. D. 1958 by his brother Dhapjibhai Devchand as No. 6 of " 3172126-TA TEHTA" Page 391, line 9. Add in "Reference" : This commentary is published in A. D. 1958. Vol. XIX, Section I, P. 2 Pages 390-393. This Appendix VII funishes us with place. names. They may be studied along with those mentioned in Vol. XVII, Part s. Materials which can enlighten us in this direction are pointed out by ine in my "Preface" (pp. IX-XII). to Vol. XVII, Pt. s. To these I may add the following : 1. The Gujarati translation of Prabandhacintamani. 2. Sukstasankirtana. 3. Priyankaranfpakatha edited by me. Vasantavilasa. Vol. XIX, Sec. II, Pt. 1 Page 7, line 6. Add : Author.- Not mentioned. Page 28, line 9. Add after 'Gani.': For his additional works see No. 147. 20 30

Page #472
Addenda 437 10 Page 46, line 34. Add : N. B.- For additional information see No. 33. Page 69, line 1. Add a foot-note on gaia etc. as under: For explanation etc. of gafot etc. soe my articlo " Referencos to Fabulous Objects by Jaina Writors" published in the " Journal of the Oriental Institute" (Vol. VIII, No. 2). Page 78, line 15. Add after "narration": of King Prthvipala. Page 96, line 11. Add: N. B.-For further particulars sec my article "qafaaegjarmura ait". It is published in " Jaina Dharma Prakasa " ( Vol 82, No. 8 ). Page 112, line 14. Add after 'etc.': Herein we come across prabandhas ( lives ) of Jinaprabha Suri, Jagasimha, Sacavahana and Jagadu. Page 113, line 14. Add after etc.': They furnish us with some details about Devapala & Madanavali (for worship), Bahubali ( for pride ), Asokadatta ( for deceit ) and Nala etc. Page 116, line 15. Add after Bahubali : Stories about Madanarekha and Sanatkumara are also given here. Page 117, line 12. Add after 'good': On fol. 19deg Vetalapancavisi is quoted. Page 117, line 15. Add after Laksmivati' : Vikramaditya for amity and Amaracandra for holy reflection. A few small stories are in Apabhraisa and old Gujarati, too. Page 118, line 15. Add after 'Jimutavahana': Other stories throw light on lives of Srisena, Harisena and Aramatanaya. Page 157, line 28. Add after Tier': and in V. S. 1307 BITTIG23. Page 158, line 2. Add afterKumarapala ': For a bibliography of the biography of this king see my article named as "FATTI@(a)ar ficaqana hili lifco" and published in " Jaina Dharma Prakasa ( Vol. 75, No. 1). 20 25 30 1 A few details about this poem are given by me in my article " Tatra a ANECT : ' T FTTE" (ait published in " haa Jara FH Sun " (Vol. 30, No. 1, pp. 50-51).

Page #473
438 Jaina Literature and Philosophy 10 P. 179, line l. Add after. Kumara pala ': The first 200 verses describe his life prior to his becoming the king whereas the rest, his subsequent life. Verses 612-633 narrate his fight with Kumara, the mahamandalika ot Nagapura ( modern Nagor of Marvar ) and v. 671-68.1 Kalikalasarvajna' Hemacandra Suri's discussion with Sumati Suri of Raka paksa. Page 180, line 14. Add after 'Reference': This work forms a part of Kumarapalacaritrasangraha published in "Singhi Jain Series " as No. 41 in A. D. 1956. Page 181, line 12. Add after "1973": Its Gujarati translation by Manilal Nabhubhai Dvivedi along with the Gujarati introduce tion and summary of all the ten cantos written by Amstaraya Narayan Shastri, is published by "Team isprat era" in A. D. 1899. Page 181, line 15. Nos. 144-146 ought to have been treated prior to No. 139. Page 182, line 33. Add after 1971: This work is translated into Gujarati and it is published. Its substance in Hindi prepared by Lalitavijayaji is published by " TETATIA THE ATO" in V. S. 1971. Page 189, line 9. Add: Reference. - This work is assigned a place on pp. 35-111 in Kumarapalacaritrasangraha published in "Singhi Jain Series"' in A. D. 1956. There it is named as Kumarapalaprabodhaprabandha". Page 189, line l. Add : These verses are numbered as 85, 1 and 86 on p. 49 of Kumarapalacaritrasangraba. Page 192, line 33. Add : Besides, he has composed 16 works in Gujarati and s in Hindi. Their names are mentioned by me on pp. 134-195. Page 205, line 20. Add gray ( STIST 197 = Flau167 ) ( 17167 ) ( METRE). Page 205, line 24. Chappannaya 'is not a name of any author. Its Sanskrit equivalent is Siprajnaka ', and it is defined as under : 20 30

Page #474
Addenda 439 10 15 " VAFTAATLIS Jaargnosa i 78 SIT TEOLET' 9 'aftaliata: 11". Page 205, line 25. Add: janar ( M ai) grPST (C3Aafia). Page 205, line 29. Add: Is this stagrao same as "TITUCTDITETTTT"mentioned in Jinaratnakosa ( Vol. I, p. 320 )? Page 207, line 1. Add after 'Gujarati': and stroni rah To: Arreton Tesi ( pp. 28-31 ). This Kuvalayamala has been utilized by Ratnaprabha Suri for composing his Sk. Kuvalayamala and this in iis turn for " Simandhara Sobhataranga" (dhalas 17-39 ) by Tejapala Saba. The story of Mayaditya is alluded to by Nemicandra Suri in his Akhayanamanikosa ( v. 32, p 218 ) and is briefly narrated in its commentary (pp. 222-225 ) by Amradeva Suri in Prakrit. Verses 37-75 (pp. 364-365 ) of this commentary dealing with nara-laksana are practically extracted from this Kuvalayamala (pp. 129-131 ). This Prakrit Kuvalayamala is translated into Gujarati by Hemasagara Suriji. This translation along with my" Glance" (in Gujarati ) etc. is published in A. D. 1965 in " sararen FASF0A1r" as No. 10. Page 208, line 13. Add after "good": Age. - Not modern. Page 208, line 30. Add after 'work': together with its chaya ( Sk. rendering ). Page 208, line 31. Add after "1919": Prof. K. V. Abhyan. kar, too, has published the text in A. D. 1931. Page 293, line 25. Add after" Reference": This work is assigned a place as one of the Rasas on pp. 53-102 in " FATT # %" published by "Sadul Rajasthani Rescarch Institute" from Bikaner in V. S. 2017. Page 309, line 16. Add after " Jayanta" : For details per canto sec" A History of the Sanskrit Literature of the Jainas (Vol. II, pt. I, p. 117). 20 35 1 Seo my Gujarati introduction ( pp, 33-34 ) of this work,

Page #475
440 Juina Literature and Philosophy Page 312, line 15. Add after "cantos.". This is doubtful, if not incorrect. Page 344, line 6. Add after' respectively': Herein the No. of cantos per parvan is as under :Parvan No. of cantos I 11 III V VI VII VIII IX 13 --- 10 82 20 Page 344, line 7. Add after 1916 : and parvans II-IV edited by Punyavijayaji along with the Sanskrit contents in this very Series as No. 8 in A. D. 1950. * Page 344, line l. Add after 31182': In some Mss. the extent of the entire work is given as 34000 slokas or either as 36000 slokas. Page 385, line 25. Add after "Suri': For details per canto sec HSLJ ( Vol. II, pt. I, pp. 191-192 ).

Page #476
ERRATA Incorrect tehana Page Line 6 12 13 24 13 24 16 10 16 12 1634 Correct tehanai amanAsundarIgasa Anjanasundarirasa anArAsa Anjanarasa paMSInA pInA and sectin ssadeva nirmA0 sect in ssa devanirmA Amata pUrImAhi 2220 22 22 70 33 10 35-36 Amarao pUrI mAMDi three two The...cribed 85 22 Uttamakumara Uttamacaritrakumara fol. 4950 The entry about "subject " should be at the end of this page. 96 30 104 26-27 4956 pupii pupil zAktiInAma(8) (5)bhavad 119 119 15 1231 1248 125 2 141 141 12 16330 56 [J. L. P.] zAkitInAma mupa0 (s) bhavad pada : (50) zravavRttau paM(0) zrayavRttI

Page #477
442 Page 183 187 187 187 188 188 189 191 192 192 192 205 205 205 206 207 208 211 211 212 212 212 Line 31 I 22 28 25 33 2 26 9 22 28 24 27 28 30 35 30 26 30 9 16 20 Jaina Literature and Philosophy Incorrect zrIsiddharAje saMga0 pure zrI * prAthimakalpikena Kumara pala prabandha bho 0 dandAnye ca caitya O haribalalAchI 1761 jina 1725 error (paparNaka) harivarSa ? AhAraha 35 Sastra Sahitya W a ka U a Correct zrI siddharAjajesaMga * 'pure' zrI prAthimakalpikena Kumarapalaprabodhaprabandha zrI0 dabdAnyeca ( a ) caitra taM ( ) jinapratimAhaDhakaraNa hiNDIrAsa V. S. 1725 haravalamAchI 1755 O 0 bandiya (candika ) harirasa (harivarSa aAhAraya 35) Sahitya Shastra 23 1 0 25 1

Page #478
Errata 443 Correct 1853 ziva 237 paMDita saMsicyamAna: vidadhati [yati] 248 261 kI Page Line Incorrect 227 271653 233 30 zavi. ___10 paMDita 247 23 saMsijyamAnaH [vidadhati yati] 7 kIDaM 261 8 caTacai 274 20 25 274 25 30 27430 35 283 2 yugI 2837 bhagukaccha vijigve caTapaha bhagukancha 289 vijigye 295 khaMgAd saMgAda 295 zreyaHNeNa 303 degpura' napari 'sAgarakSemajI zreyaHzreNa. 'pura' nayari sAgara kSemajI 330 30 337 343 tively Nami 359 7 18 359 lively Nemi Not modern 'prasannacaMdradadurAMka paraloka jutta Samvat 1837. prasanacaMdradardurAMka 374 376 384 12 27 paraloka jatti

Page #479
444 Jaina Literature and Philosophy Correct - divyaprabhA Page 384 390 391 Line 30 . 4 4 tRNAM paMcamyAM Incorrect 0 vRNAM / paMcamyAM manmagha(dha) bhImAtasya taspA telapha 394 manmagha(tha) bhImaH tasya 394 .20 394 aa 3955 tasyAH telaka 399 406 jinavardhamAna jaNane 406 406 19 22 laSi 406 408 1 jinavadhamAna janaNe lapi vechinapUraNa harikaritI zrI(khI )kSAra zrIsubhAti nabhiUNa DhAlarUSa pramANatAMbahu 409 ve(vaM )china(ta)pUraNa hIrakIratI zrIkhI(kSI) zrIsumati namiUNa 411 4166 424 12 424 DhAnarUpa pramANatAM bahu

Page #480