Descriptive Catalogue Of Manuscripts Vol 17 Part 03

Author(s): Hiralal Rasikdas Kapadia
Publisher: Bhandarkar Oriental Research Institute
Catalog link: https://jainqq.org/explore/018118/1

Page #1
COVERNMENT COLLECTIONS OF MANUSCRIPTS BHANDARKAR ORIENTAL RESEARCH INSTITUTE INSTITUTE POONA FOUNDED 1917 tejasvi nAvadhItamastu // Published by Bhandarkar Oriental Research Institute 1940

Page #2
DESCRIPTIVE CATALOGUE OF MANUSCRIPTS IN THE GOVERNMENT MANUSCRIPTS LIBRARY PREPARED UNDER THE SUPERVISION ON THA MANUSCRIPTS DEPARTMENT OF THK BHANDARKAR ORIENTAL RESEARCH INSTITUTE, POONA INSTI STITUTE POONA FOUNDED 1917 Bhandarkar Oriental Research Institute POONA 1940

Page #3
Copies can be bad direct from the Bhandarkar Oriental Research Institute, Poona 4 ( India ) Price: Rs, 5 per copy, exclusive of postage. Printed and published by Dr. R. N. Dandekar, M.A., Ph.D.' at the Bhandarkar Institute Press, Bhandarkar Oriental Research Institute, Poona No. 4 (India)

Page #4
Descriptive Catalogue of the Government Collections of Manuscripts deposited at the Bhandarkar Oriental Research Institute COMPILED BY HIRALAL RASIKDAS KAPADIA, M.A. Volume XVII: JAINA LITERATURE AND PHILOSOPHY Part III: (a) Agamika Literature Bhandarkar Oriental Research Institute POONA 1940

Page #5

Page #6
CONTENTS PAGE PREFACE XV-XXVI RULES FOR THE GOVT. MANUSCRIPTS LIBRARY XXVII-XXIX LIST OF CATALOGUES AND REPORTS XXX-XXXIII SYSTEM OF TRANSLITERATION XXXIV A. AGAMIKA LITERATURE PART III VI. 4 Mulasutras The First Mulasutra No. PAGE 644-649 Uttaradhyayanasutra I-14 650 Asamskstadhyayana ( Uttarao IV ) 14,15 651 Namipravrajyadhyayana ( Urtarao IX) 15,16 652 Moksamargagatyadhyayana (Uttara XXVIII) ... 16,17 653-661 Uttaradhyayanasutra with Sukhabodha 17-33 662,663 Sukhabodha (Uttaradhyayanasutravitti ) 34-37 664 Uttaradhyayanasutra with avacuri Do Do vstti 38-40 666 Do Do aksararha 40,41 667 Do aksararthalavalesa 42,43 668 Do Do 43,44 669 Do. 45,46 670 Do vstti 46-50 67! Do Do dipika 50-52 672 Uttaradhyayanasutradipika 52,53 673 Do 53,54 37,38 665 Do Do Do Do Do I Under this head are given six works and not four. See the Preface (p. xviii) 2 The works having the same title are here separately noted, when the identity of their authorship remains to be settled.

Page #7
Contents No. 675 PAGE 54.56 56-58 58-60 60,61 677 62,63 63,64 682 64,65 66,67 68,69 70-77 674 Uttaradhyayana sutra with balavabodha Do Do tabba 676 Do Do Do and katha Do Do aksararthalavalesa Do Do balavabodha and katha Do ( XVIII-XXI ) with tabba 680 Mahanirgranthiyadhyayana (Uttarao XX) with tabba 681 Uttaradhyayanasutraniryukti Do with tika 683 Sisyahita (Uttaradhyayanasutrabrhadvstti ) 684 Uttaradhyayanasutrabthadvsttigatakatha pratisamisksta 685-687 Uttaradhyayanasutrabthadvsttiparyaya 688 Uttaradhyayanasutravacurni 689 Uttaradhyayanasutravacuri 690 Do 691 Do 692 Citra-Sambhutiyadhayana(Uttalao XIII)vyakhya 693 Uttaradhyayanasutrakatha Do 695,696 Uttaradhyayanasuirakathasamkse pa 697 Uttaradhyayanasutra (I-IX) with kathas 698 Pratyekabuddhacatustayacaritra 699 Do 700,701 Manusyabhavadurlabhatasucakadasadrstanta 72-74 74,75 76 77 77,78 78,79 79,80 80,81 81,82 83,84 694 85,86 86,87 87,88 88-90 The Second Mulasutra 91,92 92,93 93-102 702 Dasavaikalikasutra ( I-IV) P703 Do (I) 704-708. Do with Culikayugala ... 709 Do Do Do , niryukti and tika ... 710,711 Dasavaikalikasutraniryukti 712 Dasavaikalikasutradibrhadvfttyavacuri la 103-107 107-111 III, 112

Page #8
Contents viz PAGE 113,114 114-118 118, 119 120, 121 o No. 713-715 Dasavaikalikasutrabshadvstti paryaya ... 716,717 Dasavaikalikasutra, Culikayugala and tika 718,719 Dasavaikalikasutratika . ... 720 Dasavaikalikasutra, Culikayugala and avacuri' ... 721 , Culikayugala and avacuri 2 722 , Culikayugala and avacurij ... 723 , Culikayugala and avacuri 4 724 Do , Culikayugala and tabba 725 Dharmopadesa (?) with vyakhya 726 Dasavaikalikasutra-Culikayugalavacurni s 727 Do 6 728 Dasavaikalikasutra-Culikayugalavacuri 7 729 Do 8 121, 122 122, 123 124, 125 125-127 127, 128 128, 129 129 130 131 Do Do Do The Third Mulasutra 730-733 Sadavasyakasutra 132-147 734-740 Namaskaramantra (Navakarmantra ) 9 148-164 741 with balavabodha 164, 165 742 Do Do ... 165, 166 743 Do Do 166 244, 745 Namaskaramantravivarana 166-168 746-748 Prabodhacaityavandana (Jagacintamaniceiyavandana ) ... 169, 170 749-752 Tirthavandanasutra (Jam kinci) ... 171, 172 753-758 Sakrastava ( Namutthu nam ) ... 173-175 759-762 Sarvacaityavandana ( Javanti ceiyaim ) ... 176, 177 763-766 Sarvasadhuvandana ( Javanta ke vi sahu) ... 178, 179 1-4 The author of the avacuri seems to be different, in each case. 5-6 These avacurnis do not seem to have been written by one and the same author. 7-8 These two differ so far as the author is is concerned. This and the following works up to 883 are mostly arranged as on p. 134.

Page #9
viii Contents No. Do Do Do Do PAGE 767-774 Upasargaharastotra (Uvasaggaharathotta ) 180-184 775 with laghuvstti 184,185 776-779 Do Arthakalpalata 185-188 780 Do Do vstti 188, 189 781 Do Do tika 189, 190 782 Do vstti 190, 191 783 Do avacuri 191, 192 784, 785 Upasargaharastotravitti 192, 193 786-789 Prarthanasutra Jaya viyaraya ) 194-196 790-794 Iryapathikisutra (Iriyayahiyasutta ) 197-199 795-799 Uttarikaranasutra (Tassa uttari ) 200-202 800-805 Kayotsargasutra (Annattha ) 203-205 806-813 Kayotsargasutrapratika 206-208 814-818 Namastava (Logassasutta ) 209-211 819-825 Caityastava ( Arihantaceiyanam ) 212-214 826-829 Caityastava pratika 215,216 830-834 Srutastava (Pukkharavara ) 216-218 835-839 Siddhastava ( Siddhanam buddhanam ) 219-221 840 Caityavandanasutra with tabba 222, 223 841-844 Lalitavistara ( Caityavandanasutravyakhya) 224-228 845, 846 Lalitavistarapanjika 228-231 847, 848 Caityavandanasutravrtti 232, 233 849-851 Samsaradavanalastuti 234-236 - 852 Do with vyakhya 236, 237 853-856 Vandanakasutra (Vandanayasutta ) 238, 239 857,858 Vandanakasutravivarana ... 239, 240 859-864 Daivasikalocanasutra ( Devasiyaloyanasutta ) ... 241-243 865, 866 Ratrisamstarakagatha ( Raisantharagagaha) 244, 245 867-870 Guruksamanasutra ( Abbhuthio ) 246, 247 871-874 Samayikasutra ( Karemi bhante ) 248, 249 875, 876 Jaya mahayasah ( Jaya mahayasa ) 250 877-879 Acaryadiksamanaka ( Ayariya uvajjhaye ) 251, 252 880, 881 Sri-Stambhanaka-Parsvanathastuti (SiriThambhanaya-Pasanahathui) 253, 254 882, 883 Samayika-pausadhaparanagatha ( Samaiyaposahaparanagaha). ... 255, 256

Page #10
Contents va Do Do No. : PAGE 884-887 Pranipatasutra (Khamasamanasutta ). ... 257, 258 888 Bharatesvara-Bahubalisvadhyaya ( Bharahesara-Bahubalisajjhaya ) with kathakosa and tabba 259-265 889-894 Do with kathakosa 265-272 895,896 Mahavirasvamistuti ( Snatasyastuti ) 273-275 897-900 Namorhat 276, 277 901-905 Srutasya bhagavatah (Suyassa bhagavao) .... 278, 279 906-910 Vaiyavstyakarasutra ( Veyavaccagarasutta) ... 280, 281 911-915 Sarvasyapisutra (Savvassavisutta ). 282, 283 916 Munivandanasutra ( Addhaijjesusutta, 284 917-923 Sramanopasakapratikramanasutra ( Samanovasagapadikkamanasutta ) 284-289 924, 925 Do with curni 290-293 926-930 Do Arthadipika 294-302 931 Do vivarana 302, 303 932 Sramanopasakapratikramanasutravivarana ... 303, 304 Sramanopasakapratikramanasutrabalavabodha ... 934 Trividhaharopavasapratyakhyana ( Tiviharau. vavasa paccakkhana ) 305 Granthisahita pratyakhyana ( Ganthisahiya paccakkhana) 936 Vikstipratyakhyana ( Vigaspaccakkhana ) ... . 306 937 Ekasanadipratyakhyana ( Egasanaipaccakkhana ) :: ... 306, 307 938 . Dvivihaharaikasanapratyakhyana ( Duvihara. egasanapaccakkhana ) ... 39 7, 308 Dvividharaikasthanapratyakhyana ( Duvihara egathanapaccakkhana) : 940. Abhaktarthapratyakhyana ( Abhattatha. . paccakkhana ) . 308, 309 Divasacarima pratyakhyana (Divasacariyapaccakkhana ) ... 309, 310 942 : Caturvidhaharadivasacarimadipratyakhyana. ( Cauvviharadivasacariyaipaccakkhana )... 3to 933 935 939 -308 941

Page #11
312, 313 Contents No. * PAGE 943. Sakarabhavacarimapratyakhyana ( Sagarabha vacariyapaccakkhana ) ... 310, 31 944 Sakarapratyakhyana ( Sagarapaccakkhana ) ... 311 945 Anakarabhavacarimapratyakhyana ( Anagarabhavacariyapaccakkhana ) 311 946, 947 Namaskarasahita pratyakhyana ( Namukkara. sahiyapaccakkhana ) Paurusipratyakhyana ( Porisipaccakkhana) ... 313, 314 949 Purimardhapratyakhyana ( Purimaddha- . paccakkhana ) 314 950 Acimlapratyakhyana (Ayambilapaccakkhana)... 314, 315 951 Pratyakhyanasutra with tabba 315, 316 952 Pratyakhyana (?) Do Do 316, 317 953-960 Paksikaksamanasutra ( Pakkhiyakhamanasutta ) :: 317-320 961 Paksikaksamanasutravacurni 320-321 962 Paksikastuti 321 963 Namo'stu Varddhamanaya (Vardhamanastuti)... 322, 323 964-968 Sramanasutra ( Samanasutta ) 323-328 969 Do with balavabodha 328, 329 970 Do!. 329 971,972 Yatipratikramanasutravyakhyana 330, 331 973 Yatipratikramanasutravstti 331, 332 974 Sadavasyakasutra ( Sadavassayasutta ) with laghuvstti 332-334 975 Sadavasyakasutralaghuvstti 334 976-983 Salava yakasutra with Anusthanavidhi .... 335-344 984, 985 Do Do Do and tabba ... 344-347 Anusthanavidhi ( Vandaruvstti) 347, 348 987 Sadavasyakasutra with Vandaruvstiyavacurni ... 348, 349 Sadavasyakasutra with vstti 349-352 989 Do Do avacuri ... 352-354 990 Salavasyakasutravacuri ... 354, 355 I Really speaking this ought to have been assigned a place prior to No. 969, and the latter after this. 986 988

Page #12
Contents) No. PAGE 991 . Sadavasyakasutra with avacurini ... -356, 357 992 Do Do 'avacuri l ... 358 993 Do D o do.... -359 994.* Do (?) Do do 360 995 Do Do balavabodha 361 996 Do D o tabba ... 362, 393 997 . Do Do balavabodha 363, 364 998 DO Do tabba 365-367 999 . Do (?) Do balavabodha ... 367, 368 1000 Salavasyakasutravstti (?) . ... 368, 369 100r Salavasyakasutrabalavabodha ... :370 1002-1010 Avasyakasutraniryukti (Avassaganijjutii) ... 371-384 :: 1011 Sthaviravali ( Theravali ) ... 384-386 1012, 1013 Pithika (Pedhiya) ... 386-388 1014,1015 Pithikabalavabodha ... 388-390 1016 Prathamavaravarika ( Padhamavaravariya ).... 390, 391 1017 Prathamavaravarikabalavabodha 391 1018, 1019 Dvitiyavaravarika ( Bisyavaravariya) . 392, 393 1020 Dvitiyavaravarikadipika ... 394 1021, 1022 Upasarga ( Uvasagga ) 395 1023* Upasargavyakhya ,396 1024, 1025". Ganadharavali ( Ganaharavali) 396,397 1026 "Ganadharavalyavacuri 397, 398 T027 Samavasarana ( Samosarana ) 1028 Do with avacuri. 399 1029, 1030 Samacari ( Samayari). ... 399,400 1031. Do with Dipika: 401 1932-1034 Upodghataniryukti (Uvagghayanijjutti) ... 402-404 1035. Do with vyakhya ... 404, 405 1036-1038 Namaskaraniryukti ( Namokkaranijjutti) ... 405,406 : 1039 Namaskaraniryuktivyakhya...... ... 406, 407 1040-1042 Samayikaniryukti ( Samalyanijjut : . 407, 408 1043 Samayikaniryuktyavacuri. ...... 409 1044-1046 Caturvimsatistavaniryukti (Cauvisatthayanijjutti ) ... 409-411 1047 Caturvimsatistavaniryuktidipika . .. 411 - 398

Page #13
xii No. 1048-1050 Vandananiryukti (Vandananijjutti) 1051 Vandananiryuktidipika 1052-1054 Pratikramananiryukti (Padikkamananijjutti) 1055-1057 Dhyanasataka (Jhanasayaga) 1058, 1059 Paristhapanikaniryukti (Paritihavaniyanijjutti) 1060, 1061 Pratikramanasamgrahani (Padikkamanasamgahani) Contents 1075-1077 Sisyahita (Avasyakasutraniryuktivivrti ) 1078 Sisyahitantargata-Kumaranandikatha 1079 Avasyakasutrabrhadvrttitippanakagatasayyatarasvarupa 1080 Avasyakasutraniryukti with vivrti Do Do laghuvrtti 1087 Do Do tika Do 1088 Do avacuri 1089-1091 Avasyakasutraniryukticurni 1092 Avasyakasutraniryuktyavacuri 1093 Avasyakasutraniryuktyavacurni Do 1081-1086 1062, 1063 Yogasamgraha (Jogasamgaha) 1064, 1065 Asatana (Asayana). 423,424 1066, 1067 Asvadhyayaniryukti (Asajjhayanijjutti) 1068, 1069 Kayotasarganiryukti ( Kaussagganijjutti) 1070-1072 Pratyakhyananiryukti (Paccakkhananijjutti)... 424-429 1073, 1074 Avasyakasutraniryukti (Avassaganijjutti) with Sisyahita 1094 1095 Avasyakasutraniryuktibalavabodha 1096 Avasyakasutraniryuktidipika * 1097 Avasyakasutraniryuktilaghuvrtti 1098 Avasyaksutraniryuktyavacurni 1099, 1100 Avasyakasutravrttipradesavyakhya- IIOI, 1102 Avasyakasutravrttivisamapadaparyaya tippanaka ... ... ... ... ... ... ... PAGE 412,413 413 ... 414,415 415-417 417,418 418,419 419, 420 421,422 422, 423 429-432 432-435 435,436 436,437 437,438 439-446 446,447 447,448 449-452 452,453 453,454 454,455 455,456 456,457 458 459 460-462 462,463

Page #14
Contents No. PAGE 1103-1105 Visesavasyakabhasya ( Visesavassayabhasa ) ... 464-467 1106 . Do Do with vyakhyana ... 467-469 Do yrtti 1107-1111 Do 470-476 1112 Sisyahita ( Visesavasyakabhasyabshadvrtti) ... 476-480 The Fourth Mulasutra' (I) 1113, 1114 Pindaniryukti 481, 482 IIIS Do with Sisyahita (vitti) 483-485 IN16 Do Do vivecana ... 485,486 1117 Pindaniryuktyavacuri 489, 490 T118-1120 Pindaniryuktivisamapadaparyaya 490, 491 1121-1123 Pindaniryuktivisamagathavivarana ... 491, 492 (II) 1124-1128 Oghaniryukti 493-498 1129-1132 Do with tika ... 498-503 1133 Oghaniryuktitika ... 503,504 1134 Oghaniryukti with avacurni ...Sos,506 1135-1137 Oghaniryuktyavacurni 506-508 1138 Oghaniryuktyavacuri 509 1139 Do 509,510 1140-1142 Oghaniryuktiparyaya ... 510,511 (III) 1143-1149 Paksikasutra .... 512-518 IISO with vstti ... 518,519 IISI-1156 Paksikasutravrtti 520-527 1157 Paksikasutravacuri ... 527, 528 1158 Paksikasutra with avacuri 528, 529 1159 Paksikasutravacurni 529 1160 Paksikasutravacuri 530 1 Under this head, three works are given as any one of them is looked upon as the 4th Mulasutra.

Page #15

Page #16
PREFACE At the very outset it may be mentioned that since the publication of Part II of Volume XVII of Descriptive Catalogue of the Government Collections of Manuscripts, it has been decided that my work on Jaina Mss. is to be issued in three Volumes XVII, XVIII and XIX instead of two ( XVII and XVIII ) as settled in 1930 by Rao Bahadur Dr. S. K. Belvalkar, M.A., Ph.D., the then Hon. Superintendent of the Manuscript Department and the then Hon. Secretary of the Bhandarkar Oriental Research Institute. This is due to the fact that the original idea of publishing in one volume, all the descriptive sheets dealing with the Mss. of both the Agamika Literature and the Darsanika Literature could no longer be entertained owing to the material pertaining to the Agamika Literature alone, requiring practically an entire Volume to be devoted to it. This means a further change viz. that No. XIX originally assigned to a section 'styled as " Prakrit and Vernacular" henceforth represents Vol. XIX of " Jaina Literature and Philosophy", and that Vol. XX will deal with " Prakrit and Vernacular".: It is a matter of great pleasure to mention that the publication of this Part-III enables me to place in the hands of the scholars a further section pertaining to the Agamika Literature, some of the Mss. of which were described by me as far back as 1930 and of which the press-copy was handed over in 1933. It is thus after about nine years and a half since I commenced the work and seven years after the press-copy of the Agamika Literature (Ritualism, in cluded ) was handed over to the press, that this Part III of Volume XVII comprising 530 pages, gets published. . Now a word about the procedure adopted here. As already stated in the Preface (pp. xiii-xiv ) of Part I of this Volume XVII, the headings of description, the inter-arrangement of descriptive sheets having a bearing on the same text and the matter to be included in this Volume were decided by Dr. Belvalkar in 1933. I may note that the type for bhale () was specially prepared when i Vide" Bhandarkar Oriental Research Institute Poona Report of 1935-36." (p-14). .

Page #17
Xvi Preface Part II of Vol. XVII was in press. As I then happened to be in Poona, I could include when required, the corresponding symbol, in my galley-proofs by consulting the necessary Ms. But this has not been throughout possible so far as this part is concerned; for, it has been printed during my stay mostly in Bombay and partly in Surat. Hence the discrepancy pertaining to this bhale may have remained unattended to, as I had no access to the required Mss. I may therefore crave indulgence of the learned reader in this connection. As regards the general outlines it may be mentioned that as in the case of Parts I and II, here, too, all textual matter which appeared to me to be superfluous is enclosed within rectangular brackets [ ], while additions and alterations are enclosed within paranthesis ( ). Furthermore, the system of transliteration followed here is identical with that adopted in Parts I and II as will be seen from page xxxiv. There is, however, one change introduced here, and it is in connection with the method of giving a Serial No. for the Ms. in rectangular bracket in the top-line of a page. As already suggested in the Preface (p. xiii) of Part II, the usual method is followed here. With these remarks about the procedure I may now deal with the contents of this Part III. To begin with, it may be mentioned that as adumbrated in the Preface of Part II (p. xiv), all the Mulasutras, miscellanea, some of the Svetambara works on Ritualism and nine Appendices were to be given in this Part III. But, on finding that it was not possible to include this entire material in this very part and waiting any longer till it is completely printed off, meant exhausting the patience of the persons interested in this work, I proposed to Dr. V. S. Sukthankar, M.A., Ph.D., the then Hon. Secretary of the Bhandarker O. R. Institute, to publish as much portion as given here. I am glad to say that he kindly agreed to my proposal, and the result is that this Pt. III gets published. Herein are treated Mss. pertaining to Uttaradhyayanasutra and Dasavaikalikasatra along with those dealing with their exegetical literature in Prakrit, Sanskrit and Gujarati. Then follows the description of the Mss. of Sagavasyakasatra and its component factors along with that of the Mss. elucidating this literature. It may

Page #18
Preface xvii be mentioned en passant that the main object of separately treating these component factors of Sadavasyakasulra and their explanatory literature has been to give due importance to these iactors-the sutras most of which constitute Avasya kasutra as visualized by Haribhadra Suri, who is well-known as Yakini-mahattaradharmasunu. Thi Sadavasyaka literature is followed by Pindaniryukti, Oghaniryukti and Paksikasatra' which are somehow looked upon as Malasutras. This completes the treatment of all the Malasutras concerned. But before proceeding further, I may say a few words about the number and order of the Mulasutras. As is well-known to the student of Jaina literature, the traditional number for the Malasatras is either three or four; but, on his going through this Part III, he will find that six works are dealt with under this heading. This is however due to the option an individual has as to which work out of Pindanijjutti, Ohanijjutli and Pakkhiyasutta should be looked upon as the fourth Mulasulra, the other three works being, of course, Ultarajjhayanasulta, Dasaveyaliyasutta and Avassayasutta. It may be mentioned in this connection that there seems to be no hard and fast rule laid down regarding the sequence of the Malasutras. For, different scholars have indicated different sequences. For instance Prof. A. Weber 2 in his Verzeichniss der Sanskrit-und Praksit-handschriften der Koniglichen Bibliothek zu Berlin 3 ( Vol. II, pt. II, p.x) has mentioned Uttarajjhayanasutta, Avassayasutta and Dasaveyaliya as the first three Malasutras. He appears to believe that these are the only works that deserve to be 1 As implied in the Preface (p. xiv) of Part II, this was not to be included as a Mulasutra and was to be given in "Miscellanea ". But, on finding that some look upon this as a Mulasutra, I thought it desirable to modify the original plan. 2 He has exhaustively discussed in Indischen Studien (vol. XVI, p. 211ff, and vol. XVII, p. Iff. ), the scriptures belonging to the capon of the Svetambara Jainas. For the English translation of these papers by Dr. H. W. Smyth see "Indian Antiquary" (vols. XVII-XXI). 3 Catalogue of the Sanskrit and Prakrit Mss. in the State Library at Berlin. 4 The list for the arrangement of the canonical scriptures adopted by Prof. Weber was originally drawn up by Dr. Georg Buhler. Vide Prof. Hermann Jacobi's kalpasutra (p. 14, foot-note ).

Page #19
xviii Preface styled as Malasatras, and that is probably the reason why he has referred to Ohanijjutti and Pakkhiyasutta under the heading "Anderzum weit Siddhanta gerechnete Texte". Prof. M. Winternitz, too, has followed the same order for the 3 Malasutras, but he differs from Prof. Weber, when, in his Geschichte der Indischen Litteratur (vol. II, p. 292) he mentions four Malasutras instead of three, Pindanijjutti being the fourth.! Dr. A. Guerinot agrees with Prof. Winternitz, both regarding the order and the number of the Mulasutras. This will be evident from La Religion Djaina (p. 79 ) where he has mentioned four Malasatras as under : L' Outtaraddjhayana (Outtaradhyayana ), L'Avacyaka-soatra, Le Daca-vaikalika and Pinda-niryoukti, In Prof. Arthur Berriedale Keith's Catalogue of the Sanskrit and Prakrit Manuscripts in the Library of the India Office (vol. II, pt. II, pp. 1262-1272), the Mss. of Ultarajjhayanasutta are given the first place, those of Sadavassayasutta (Avassayasutta ) the second, and those of Dasaveyalijasutta, the third. This is in accordance with Dr. Georg Buhler's list of canonical treatisies given in this Prof. Keith's Catalogue on pp. 1274-1275 and designated as " Sarvasutradhyayanoddesanirnaya ". Prof. Walther Schubring in his Die Lehre der Jainas nach der alter Quellen dargestellt (p. 57) has noted Uttarajjhaya, Avassayanijjutti, Dasaveyaliya, Pindanijjutti and Ohanijjntti as Malasutras. Thus it will be seen that the line of procedure adopted by me differs from that followed by one and allof these occidental scholars, in two respects viz. (i) the number? of works to be included under Malasatra and (ii) their sequence. 3 I may add that it is possible to reduce the traditional number four for the Malasatras to three by bracketing Pindanijjutti with Dasaveyaliyasutta and Ohanijjutti with Avassayasutta on the ground 1 Jarl Charpentier in his introduction (p. 10) to Uttaradliyayanasutrd has done the same. He has there given a list of the scriptures as adopted by Prof. Weber and has looked upon it as the most authoritative of all." 2 My number is six and not three, four or five. .3. I have arranged the six works as under: (i) Uttarajjhayanasulta, ( 2 ) Dasaveyaliyasutta; (3) Avassayasutta, (4) Pindanijjutti, (5) Obanijiutti and (6) Pakkhiyasutta. ***

Page #20
Preface xix that Pindanijjutti is after all a supplement to-an off-shoot of Dasaveyaliyasuttanijjutti, and that similar is the case with Ohanijjutti. On this understanding I had a desire to deal wihh PindanijjuttiMss. just after those for Dasaveyaliyasutta, and to deal with Ohanijjutti-Mss. after those for Avassayasutta; but, as it was considered rather inconvenient to follow this line of arrangement in this Catalogue, I have not acted up to it. The late Muni Caturavijayaji, a disciple of Pravartaka Srimat Kantivijayaji had outlined this plan to some extent as can be seen from p. 25 of Appendix III of his Catalogue of Mss. of the Jaina jnana-bhandara of Limbdi ("sagt jaina jJAnabhaMDAranI hastalikhita prationuM sUcIpatra"). Consideration of space does not permit me to discuss why a particular sequence for the Malasatras, is more scientific than the rest. Consequently it thus gets reserved for being dealt with on some other occasion.' So I may now say a few words about the contents of Part IV. These will include ( 1 ) miscellanea, (2) ritualistic works and (3) appendices. Therein "miscellanea " will consist of works which can be, broadly speaking, divided into two categories as under : (1) Appendages of the Avassayasutta. (ii) Works, though not a part and parcel of any of the six well-known groups ? of the Agamas, are more or less closely . related to them. These works will be followed by "ritualistic works". This title is self-explanatory. Yet it seems necessary to point out that: it will not include each and every work of the Svetambara School, much less any ritualistic work of the Digambara School. The works thus left out here will be separately treated in. Vol. XIX, along with those of hymnology, narrative literature etc. 'Under the third (last ) head " Appendices " there will be given nine Appendices already referred to in the Preface (p. xv ) of Part - 1 Some discussion in this connection is carried on by me in my work entitled A Comprehensive History of the Canonical Literature of the Jainas (pp. 45-48.). They are: (1) anga, (?) uvanga, ( 3 ) paznnaga, ( 4 ) cheya, (s) mula and (6) culiya.

Page #21
XX Preface II. In this connection I may mention that Dr. Belvalkar had desire ed that I should give good many Appendices, over and above the three kinds of Appendices given by him in "Vol. I: Vedic Literature. Part I: Samhita and Brahmanas ". As, in all other matters of detail I have, here, too, acted up to his desire and have been all along preparing during the course of printing of this part of Vol. XVII at least six Appendices, in addition to three pratically prepared in 1933. The complete list is as under : (1) Index of Authors.' ( II ) Index of Works. (III) Classification of Works according to languages. (IV) List of Works according to the date of their composition. (V) Correspondence table of Manuscripts. 2 (VI) Chronological order of dated Mss. (VII) Names of places where Mss. were written and works. composed, (VIII) Names of scribes, presentees and others. (IX) Abbreviations occurring in Mss. Out of these nine Appendices, the first two are features common to almost all catalogues, especially the Descriptive ones, though the method followed here will be found to be differing in details. As for example, Prof. H. D. Velankar, M.A., has treated both these Appendices under one head - Index of Jaina Authors and Works" in his "Descriptive Catalogue of Samsksta and Praksta Mss. in the Library of the Bombay Branch of the Royal Asiatic Society". Therein he has only mentioned the titles of works without indicating the names of the authors against nominuous works. Furthermore, against the name of an author, he has indicated his works by the Serial Nos. noted in his Cata 1 It will not be too mnch to hope that a similar index of authors when published at the end of each of the Volumes XVIII and XIX, with the necessary information supplemented from other sources will form a pretty "Onomasticon of the Jaina Writers " dealt with, in these Volumes. 2 In Prof. Keith's Catalogue the word "concordance " is used. And I, too would have done the same, had it not been obligatory to maintain uniformity with the other Catalogues published by this Institute.

Page #22
Preface xxi logue. Thus his method of treatment differs from that of mine and the one employed in Vol. I published in 1916 by the Government of Bombay. For the sake of ready reference, I have followed the very method adopted by the late Prof. Weber in his monumental Catalogue of the State Library at Berlin. I find that Prof. A. B. Keith, too, has done the same. The third Appendix given thereafter will seem to be the special feature of Jaina Mss., if not, of Jaina works, dealing with compositions not only in Sanskrit and Prakrit but in several other languages. It is hoped that this Appendix will enable the reader to have at a glance, an idea of the works composed in different languages. Appendices IV and VI have been then given on account of their historical value. For instance, the fourth Appendix prepares a back-ground for Jaina chronology, and the sixth is helpful in fixing the terminus ad quem for undated works. The fifth Appendix is what one generally meets with, in Descriptive Catalogues of Mss. belonging to big libraries like the State Library of Berlin, the Library of the India Office etc. In this connection I may mention that the letters and the numerical figures given in parenthesis after the old ) Ms. No., when needed, do not belong to the original collections, but have been introduced by me in the case of composite codices. When a composite codex contained not more than 26 works, letters of the Roman alphabet have been used, whereas in the case of a composite codex having more than 26 works, numerical figures have been used instead of the Roman alphabet which could not have been of much help without suffixes or dashes-a process which would have unnecessarily become cumbrous, if followed. It is perhaps needless to add that certain numbers such as 736 (1) of 1875-76 not giren under old Ms. No. are not discrepancies as a layman is likely to think. They will be given in due course as they refer to works to be dealt with, in one of the subsequent volumes. ? 1 I do not remember to have seen any Catalogue where a list of works classified according to languages is separately given. 2 Such a state of affairs is due to the variety of subjects treated in one and the same Ms., and seems to be a special property of at least the Jaina Mss,

Page #23
xxii Preface The seventh Appendix is given there with the hope that it will serve as a geographical index to some extent, useful for identifying old place-names. I may add that I do not remember to have come across any Catalogue where such an appendix is separately given. * The eighth Appendix is assigned a separate place by the late Prof. Weber, while Prof. Keith has dealt with it, under a general index wherein he has mentioned names of works and authors as well. Under the heading of this Appendix given there, I have mentioned presentees over and above the patrons of scribes with a view to bring into prominence, the speciality of the Jaina code of Ethics. . .. . . . The ninth and the last Appendix is perhaps a unique feature of this Catalogue inasmuch as it appears to be found nowhere else. In this Appendix abbreviations are recorded for the first time they occur, and not for as many times as they do. For, the main object in giving this Appendix is to facilitate the reading of Mss., and that is why the full form is given against the corresponding abbreviation. .. This finishes a rough survey of the contents of Parts III and IV, which when taken into account with the corresponding survey of the contents of Parts I and II, will show that the completion of this Volume XVII will cover up the description of Mss. pertaining to all the six groups under which the Svetam baras classify their 45 canonical treatises known as the Agamas. This fact goes to prove the richness of the Government Manuscripts Library deposited at the Bhandarkar Institute, and it, when taken into account with its collection of Jaina Mss. of non-canonical treatises, can make any one endorse at least the first part of the following statement made in the Preface (p. xxxvii) of Vol. I, Pt. I : "That no library of Oriental Mss. possesses as valuable and numerous a stock of Mss. of Jaina literature as our library has, has been acknowledged by scholars from the very beginning and in fact it could even be said that there is hardly any edition of an The 11 Angas, the 12 Upaugas and the 10 Prakirnakas along with 18 Supernumerary ones have been treated, together with their exegetical literature in Part I. The six Chedasutras and the two Calikasutras have been similarly dealt with in Part II, and all the Malasutras, in this part.

Page #24
Preface xxiii important work brought in any part of the world which had not to use, in some way or other, Mss. of this library." In this connection I may add that I have already collected by this time data which can give a clue to the nature of the Jaina Mss.! at the Institute, regarding their material etc.; but I think it better to reserve this topic till the completion of the printing of Vol. XVII. In the meanwhile I may however draw the kind attention of the authorities concerned to the fact that it will immensely enhance the value of this magnificient library, if an attempt can be made to procure, if available, a Ms. or a transcription of each of the following works and the like forming the Agamika class : (1) Pancakappasutta. (2) Mahanisihasuttacunni. (3) Laksmikallola Gani's commentary on Ayarangasutta. (4) A commentary on Uttarajjhayanasutta, by Vinayahmsa. (5) Danasekhara's commentary on Bhagavaisutta. (6) Malayagiri Suri's commentary on Pindanijjutti. Now a word about some of the discrepencies that have crept into this work. They are : : (i) On p. 154 Avagahanadvara and Gatidvara are mentioned as separate works but really speaking they form a part and parcel of Sangrahaniratna. (ii) Nos. 954 and 959 deal with the same work, but even then this Ms. is somehow described twice; so, one of the descriptions is to be discarded. (iii) No. 969 ought to have been assigned a place after No. 970 as it fits in with the plan of the inter-arrangement of Mss. dealing with the same work laid down by the Institute. A similar remark holds good in the case of Nos. 1099 and 1100. Vide foot-note I of p. 460. .. (iv) In some cases, the subject-matter deserves to be reconsidered, and I may cite as an example the case of works having Serial Nos. 934 to 952; but this cannot be done now as it means rehandling the corresponding Mss. and carrying on a thorough investigation of the entire problem of the constituents of the 1 A general survey of the Jaina Manuscripts with casual references to these Mss. is made by me in my paper on The Jaina Manuscripts (pp. 98-127) published in Journal of the University of Bombay" (vol. VII, pt. 2, September 1938).

Page #25
xxiv Preface Avasyakasutra--a problem not finally solved by any scholar up till now, so far as I know. As regards the Reviews of this Jaina Catalogue (Pts. I and II) that I have seen, I find that on the whole my work is appreciated on all hands so much so that the late Prof. Winternitz did not only not find any fault whatsoever but fully approved of the plan followed there.' Prof. H. D. Velankar has however sounded a different note in his review. 2 He seems to suggest that too much attention has been paid to the objective side of the Ms, rather than the subjective one, and thus the question of providing materials "useful for the historical reconstruction of Jaina literature " is not sufficiently attended to. He holds me responsible for this attitude but I think this is owing to his not having paid due attention to what I have specifically mentioned in my Prefaces. This is again the reason why he finds fault with me so far as the inter-arrangement of Mss. dealing with the same work is concerned. This is neither the place to answer his criticisms nor is it incumbent upon me to do so as, after all, I have tried to carry out the instructions of the Institute. Prof. Walther Schubring has made the following suggestions by way of corrections in his Review published in Orientalalistische Literaturzeitung 1937 No. 3, pp. 186-187. They are as under Pt. I, p. 373: Kavacadara = Arahanapadaga, dara 30 from v. 26. 398 : Divasagarapannattisamgahani to be connected with 199 foll., because the D. S. P. forms a part of Jivajtvabhigamasutra. 399 : Pajjantarahana printed in Payannasamgrahm Bh. 1, Ahmedabad, Samvat 1962. 427 : See Peterson I, p. 53 and 91, Weber II, p. 919; a medical treatise appreciated by the Svetambars as well as by the Digambaras; for, the latter see Puspadanta Bhutabali (as must be read ) and Pujyapada. 1 Vide his review published in Archiv Orientalni (Prague) VIII, 2, 1936. The pertinent lines are as under : "The Catalogue offers every thing that can be desired by the student of Jaina literature, both as regards details about the Mss. described, extracts from them, and references to editions, or accounts of the works in question ". 2 This has been published in Journal of the Bombay Branch of the Royal Asiatic Society" (vol. XII, 1936, pp. 118-120).

Page #26
Preface 428 Yasobhadra is not the author of Vaggacaliya (this is the correct name), but Jasabhadda, the man who is introduced as the teller of the story. 246 Not a commentary to Jambuddivapannatti, but a treatise dealing with calculations concerning the Jambudvipa continent. The true title is Jambuddviva-karanacunnt (vide the Berlin Ms.) and some scribes have only been misled to write J. D.-pannatli (or pannattikarana) cunni. Cf. Str. 3 of the text. In 587 must not be called Pancakappasuttacunni, since a P. K. sutta never existed nor have curni and bhasya the word satra. other cases, though there was a sutta or sutra, still the authors did not use that word, e. g. they never wrote Ayarangasuttacunni, Acarangasutratika, but only Avaracunni, Acaratika. Similarly Vuddhakappasutta seems to be a fiction, since the true name is Kappa. I do not intend to make here any comments on these suggestions. I shall therefore simply mention that on p. 58 we meet with Sri-Sthanamgasutrartha. Now a word about the following entries printed in the Jaina Catalogue (pt. II, p. 299): (1) In line 10 we have: composed (?)". This should be replaced by "completed". (2) "Author.-Not mentioned. According to the tradition Jinadasa Gani Mahattara." 99 The words "Not mentioned, According to the tradition should be droped; for, the author has mentioned his name in a queer way in the verse noted on p. 299 and has probably given the clue, too. But before we can see it, the first carapa requires an emendation as under : "C cc "6 'NireNaNAgattamahA sadAjinA' These letters when properly re-arranged can be read as jiNadAsagANaNA mahAntareNa. Thus this supplies us with the author's n, XXV 39 name. On p. 449 of this part III, the author is not mentioned, but he is said be Jinadasa Gani Mahattara. Before I conclude this Preface, I may mention that I have tried to make this Part III as up to date as possible by making necessary additions while going through the proof-sheets. This will explain why there is anachronism at times. 1 I use this word as the pertinent verse is incorrect. 4

Page #27
Preface In the end it remains for me to record gladly and respectfully, my indebtedness to Vidvadvallabha Muni Punyavijayaji, a disciple of the late Muniraja Sri Caturavijaya and a grand-disciple of Pravartaka Srimat Kantivijaya, who has for the third time quite willingly rendered to me valuable assistance by going through a duplicate copy of the page-proofs of the non-English portions up to 56 pages. I have also to thank Dr. V. S. Sukthankar, for having agreed to insert in this part, a photograph of a fol. of Ms. No. 7123 of 1892-95 (Serial No. 720 ), on my drawing his kind attention to the fact that this Ms. has been written in very small hand-writing, perhaps the smallest I remember to have seen at the Institute, and that this Ms. was selected for exhibit for that very reason and was very highly appreciated by the late His Excellency the Right Hon'ble Lord Brabourne, G.C.I.E. MC., the former Governor of Bengal when His Excellency paid a visit to the Institute as the Governor of Bombay on 22nd June 1935. Equally indebted I am to Dr. R. N. Dandekar, M.A., Ph.D., the Hon. Secretary for his having complied with my request of inserting in this Part III a photograph of the last fol. of the Ms. No. 286 of A. 1883-84 (Serial No. 1139 ) on my drawing his kind attention that this is the oldest dated ( Samvat 1333) paper Ms. in the Institute and perhaps elsewhere, too. 3 Dr. Sukthankar deserves to be once more thanked for having agreed to publish this part and thus given an early opportunity to the public in general and the Jaing community in particular, to know more about the Jaina Mss. dealt with in this part. Sankdi Sheri, Gopipura, SURAT. 30th May, 1940 Hiralal R. Kapadia 1-2 These face pp. 120 and sio respectively. 3 The Ms, No. 57 of 1880-81 (Serial No. 1106) is the oldest dated palm-leaf Ms. I know of. Its date is Sathyat 1138.

Page #28
REGULATIONS OF THE MANUSCRIPTS DEPARTMENT 1. "The Government Manuscripts Library" formed and maintained by the Government of Bombay, and formerly deposited at the Deccan College, Poona, is now, subject to the general control of the Department of Education, Bombay, placed under the direct charge of the Bhandarkar Oriental Research Institute, Poona. 2. The Department is administered by a Superintendent appointed by the Executive Board of the B. O. R. Institute subject to the approval of Government. 3. The Manuscripts are available at the Institute, during work. ing hours, for purposes of bona fide study. 4. The Manuscripts in the Library, if, in good condition, and subject to the requirements of Department, are lent out to bona fide scholars on their applying for them in writing to the Superintendent of the Department or to the Secretary of the Institute. Such scholars shall, however, execute a bond for the value of the manuscripts required, this value being fixed by the officers in charge of the Library. s. In the case of scholars from outside India, all requisitions for loans of manuscripts shall be made to the Secretary of State for India in Council, through whom also the transactions in manuscripts shall take place. Such scholars shall execute the necessary bond with the Secretary of State for India in Council, at his discretion. 6. In the case of scholars in India, the execution of the bond shall be necessary before the manuscripts are lent out. When the applicant is not sufficiently known to the Superintendent of the Department, this latter officer. shall have the power to call upon the. applicant to produce a certificate as to his interest in the study of Sanskrit Literature, and of his being a fit person to be entrusted with Government manuscripts. Sych a certificate shall have to be signed

Page #29
xxviii Regulations of the Manuscripts Department by Orientalists of recognised position, or by Government officers of the Provincial or other highest service, not below the rank of a Deputy Collector or Extra Assistant Commissioner. The certificate should contain a reference to works or essays published by the applicant. N. B.- In the case of scholars residing within the jurisdiction of a Native State, the certificate may be signed either by the Chief Sahib or the Divan or the administrator of the State. 7. All applications for manyscripts shall state the reasons for which the manuscripts are required and the period for which the loan is sought. 8. If any manuscripts belonging to this Library have been used in the publication of an edition, or in any other learned disquisition, the authors should present to the Manuscripts Library a copy of the work or works so published. 9. The number of manuscripts to be lent out at a time to a scholar, and the period of loan, is determined by the officer in charge of the Library. Usually, however, in the case of Indian scholars, not more than five manuscripts are allowed to remain with them at a time, and the period of loan shall not normally exceed six months. 10. Immediately on receipt of manuscripts, the scholars are requested to examine them carefully before signing and returning the receipt-form accompanying the manuscripts, as no complaints will be entertained thereafter. II. When the manuscripts are returned to the Library they are duly examined, and if found in their original condition, the receipt formerly signed for them is returned and the bond cancelled. The liability of the borrowers ceases only after the return of this receipt.

Page #30
Regulations of the Manuscripts Department xxix 12. If scholars find that, owing to the work on the manuscripts not being completed within the stipulated period, they cannot return the manuscripts when due, they shall, sufficiently in advance, apply in writing to that effect to the Superintendent of the Department, or to the Secretary of State for India in Council, as the case may be. The period of loan will be extended at discretion. In no case, however, shall any manuscripts be allowed to remain with a scholar longer than two years in India, and five years outside India. 13. The Manuscripts Department reserves to itself the right of refusing to lend out any manuscript to any scholar at any time, and in the case of manuscripts lent out, of demanding their return before the expiry of the stipulated period, if the manuscripts be required for library or other purposes, 14. All postal charges shall be borne by the applicant. 15. The Department undertakes to procure on loan, for the members of the Institute, manuscripts from other lending Libraries.

Page #31
A LIST OF PRINTED CATALOGUES AND REPORTS ABOUT MANUSCRIPTS The following is the list of works (Catalogues, Reports, etc.) already published embodying the results of the search and preservation of Sanskrit and Prakrit manuscripts in the Bombay Circle from 1868 to 1915. All lists published up to 1884 have been incorporated in our consolidated Catalogue prepared by Mr. S. R. Bhandarkar, M.A., in 1888. The lists for the subsequent years are to be found embodied in the various Reports published thereafter. These Reports are of considerable value, inasmuch as they give in many cases the history of individual manuscripts, personal details of authors, their chronology, and such other items. All these works are therefore here put together in one place for ready reference. Papers relating to the Collection and Preservation of the Reports of ancient Sanskrit Literature, edited by order of Government of India, Calcutta, 1878, by Mr. E. A. Gough. This is a useful work for the general history of the Search during the earlier period upto 1878 and contains, among other things, lists of manuscripts bought for Government during the years 1868-69, 1869-70, 1870-71, 1871-72, 1872-73 and 1874-75. All these lists, originally published at different times, were also included in our consolidated catalogue (to be mentioned below ) published in 1888. Report on the results of the Search for Sanskrit Manuscripts in Gujarat during 1871-72, by G. Buhler, Surat, 1872, II pages in folio. Report on Sanskrit Manuscripts 1872-73, by G. Buhler, seven and seventeen pages. Bombay, 1874. Report on Sanskrit Manuscripts 1874-75, by G. Buhler, 21 pages. Girgaum, 1875. Detailed Report of a Search of Sanskrit Manuscripts made (in 1875-76), in Kashmir, Rajputana and Central India, by G. Buhler. Extra No. XXXIVA, Vol. XII of the Journal of the Bombay Branch of the Royal Asiatic Society, 1877, Bombay.

Page #32
A List of Printed Catalogues and Reports xxxi Lists of the Sanskrit Manuscripts purchased for Government dur. ing the years 1877-78, and 1869-78, and a list of the Manuscripts purchased from May to November 1881, by F. Kielhorn, Poona, 1881. A Report on 122 Manuscripts, by R. G. Bhandarkar, Bombay, 1880, 37 pages in folio. Report on the Search for Sanskrit Manuscripts in the Bombay Presidency during 1880-81, by F. Kielhorn, Bombay, 1881. A Catalogue of the Sanskrit Manuscripts in the Library of the Deccan College ( being lists of the two Visramabag collections ). Part I prepared under the superintendence of F. Kielhorn ; Part II and Index prepared under the superintendence of R. G. Bhandarkar, 1884, 61 pages in folio. A Report on the Search of Sanskrit Manuscripts during 1881-82, by R. G. Bhandarkar, Bombay, 1882. A Report on the Search for Sanskrit Manuscripts in the Bombay Presidency during 1882-83, by R. G. Bhandarkar, Bombay, 1884. A Report on the Search for Sanskrit Manuscripts in the Bombay Presidency during 1883-84, by R. G. Bhandarkar, Bombay, 1887. A Report on the Search for Sanskrit Manuscripts in the Bombay Presidency during 1884-87, by R. G. Bhandarkar, Bombay, 1894. . A Report on the Search for Sanskrit Manuscripts in the Bombay Presidency during 1887-91, by R. G. Bhandarkar, Bombay, 1897. A Consolidated Catalogue of the Collections of Manuscripts deposited in the Deccan College (from 1868-1884) with an Index, by S. R. Bhandarkar. A Report on the Search for Sanskrit Manuscripts in the Bombay Presidency during 1891-1895, by A. V. Kathawate, Bombay, 1901. Detailed Report of Operations in Search of Sanskrit Manuscripts in the Bombay Circle, August 1882 to March 1883, by P. Peterson. Extra No. XLI, Vol. XVI of the Journal of the Bombay Branch of the Royal Asiatic Society, 1883, Bombay.

Page #33
A List of Printed Catalogues and Reports A Second Report of Operations in Search of Sanskrit Manuscripts in the Bombay Circle, April 1883 to March 1884, by P. Peterson. Extra No. XLIV, Vol. XVII of the Journal of the Bombay Branch of the Royal Asiatic Society, 1884, Bombay. xxxii A Third Report of Operations in Search of Sanskrit Manuscripts in the Bombay Circle, April 1884 to March 1886, by P. Peterson. Extra No. XLV of Vol. XVII of the Journal of the Bombay Branch of the Royal Asiatic Society, 1887, Bombay. A Fourth Report of Operations in Search of Sanskrit Manuscripts in the Bombay Circle, April 1886 to March 1892, by P. PeterExtra No. XLIXA of Vol. XVIII of the Journal of the Bombay Branch of the Royal Asiatic Society, 1894, Bombay. son. A Fifth Report of Operations in Search of Sanskrit Manuscripts in the Bombay Circle, April 1892 to March 1895, by P. Peterson, Bombay, 1896. A Sixth Report of Operations in Search of Sanskrit Manuscripts in the Bombay Circle, April 1895 to March 1898, by P. Peterson. Bombay, 1899. This contains also a list of manuscripts purchased by Professor Peterson from 1898-99. Lists of Manuscripts Collected for the Government Manuscripts Library by the Professors of Sanskrit at the Deccan and Elphinstone Colleges containing the following Collections : (i) 1895-1902, (ii) 1899-1915, (iii) 1902-1907, (iv) 1907-1915, (v) 1916-1918, (vi) 1919-1924 and (vii) 1866-68.

Page #34
VOLUMES PUBLISHED Vol. 1, Part I-Vedic Literature, Samhitas and Brahmanas pp. xlviii +420; Size: 9 inches x 6 inches. 1916, Compiled by the Professors of Sanskrit, Deccan College, Poona. Price Rs. 4. Vol. XVII. Part 1-Jaina Literature and Philosophy (Agamika Literature) pp. xxiv + 390; Size :- 9 39 91 Descriptive Catalogue of Manuscripts IN THE Government Manuscripts Library 39 99 in. x 6 in. 1935. Compiled by Prof. H. R. Kapadia, M.A. Price Rs. 4. Part II-(Agamika Literature contd.) pp. xxvi + 36324; Size:- 91 in. x 6 in. 1936. Compiled by Prof. H. R. Kapadia, M.A., Price Rs. 4. Part III-(Agamika Literature contd.) pp. xxxv + 530; Size: 9 in. x 6 in. 1940. Compiled by Prof. H. R. Kapadia, M.A. Price Rs. 5. Vol. XII-Alamkara, Samgita and Natya Mss. pp. xx + 486 Size :- 91 in. x 6 in. 1936. Compiled by P. K. Gode, M.A., Curator, B. O. R. Institute, Poona. Price Rs. 5. Vol XIV-Nataka Mss. pp. (xviii + 302 ); Size:- 9 in. x 6 in. 1937. Compiled by P. K. Gode, M.A., Curator, B. O. R. Institute, Poona. Price Rs. 4. Vol. II, Part 1-Grammar Mss ( Vedic and Paniniya) pp. xvi. + 348; Size.-9 in. x 6 in. 1938. Compiled by S. K. Belvalkar, M.A. Ph.D. Price Rs. 4. Vol. XVI, Part 1- Vaidyaka Mss. pp. xxi + 418. Size.-91 in. x 6 in. 1939. Compiled by H. D. Sharma, M.A., Ph.D. Price Rs. 4. Other volumes in preparation. For copies apply to:- The Secretary, B. O. R. Institute, POONA 4, (INDIA).

Page #35
SYSTEM OF TRANSLITERATION a a ar kA A / ii I 1 u u U // la ! ai e ai ai o 0 au au ii g k kh kh c ch hai laM th t e th I p ph yU y r g H gh j jh d da dh d y dh b bh lU 1 v v zI S s hah visarga h, anusvara m.

Page #36
JAINA MANUSCRIPTS

Page #37

Page #38
JAINA LITERATURE AND PHILOSOPHY A. AGAMIKA LITERATURE V. 4 MULASUTRAS' THE FIRST MULASUTRA uttarAdhyayanasUtra Uttaradhyayanasutra (SATHER) (Uttarajjhayanasutta ) 159. No. 644 1871-72. Size.-- 12 in. by 48 in. Extent.-- 73 folios; 11 lines to a page; 46 letters to a line. Description.-- Country paper thin and white; Jaina Devanagari characters with occasional TCHETTS; big, fairly legible, uniform and elegant hand-writing ; borders ruled in two pairs of lines in black ink; the space between these pairs coloured red; numbers for foll. written in the right-hand margin; foll. 1a and 736 blank ; fol. 16 decorated with a beautiful illustration of a samavasarana with a Tirthamkara in the centre; unnumbered sides have a square in I For the interpretation of this word mulasutra and the question of the propriety of the word sutra according to Jarl Charpentier see his introduction (p. 32) to his edition of "The Uttaradhyayanasutra ". 2 That the meaning of the word uttara occurring in this title cannot mean "best" though so suggested in the commentary on Nandisutra, but it should mean " latter", is the opinion expressed by Charpentier in his introduction (p. 33) to Uttaradhyayanasutra

Page #39
Jaina Literature and Philosophy [ 644 III IV V yellow colour in the centre; the numbered, in each of the two margins, too; all the foll. more or less worm-eaten ; but, fortunately the body is not affected to the same extent; condition tolerably fair ; complete ; the entire work is divided into 36 adhyayanas as under :Adhyayana I Verses 1-48 foll. I to Il prose+, 1-46 I-20 I-13 1-32 VI I-18+ prose, VII 1-30 VIII I-20 IX 1-62 1-37 XI 1-32 XII 1-46 XIII, 1-35 XIV XV 12b 1 1 XVI prose+ XVII XVIII XIX XX XXI XXII XXIII XXIV XXV XXVI XXVII XXVIII 1-17 1-21 1-54 1-98 1-60 1-24 I-51 1-89 I-20 I-44 1-26 1-17 1-36 266 , 30* 30(r) ,, 324 326 ,, 335 336 , 356 * >> 399 a ,,, 39 396 , 416 411 , 436 436 , 448

Page #40
644.] 1. 4 Malasutras ,, 53 Adhyayana XXIX prose+ Verses 1-73 foll. 455 to Sob XXX I-37 , 51 ,, 53 XXXI 1-20 XXXII I-III XXXIII 1-25 , 59 XXXIV I-62 , 60* XXXV I-21 XXXVI 1-267 , 63* Age.- Sarivat I6SI. Author.-- Various authors are suggested by various persons. For instance some ascribe the authorship to Lord Mahavira, some to Bhadrabahu and some to Kapila and other saints. Subject.-- This Jaina canonical treatise mostly in verses in Prakrit is styled as "mulasutra". On the whole, it depicts the life which a Jaina saint ought to lead. The details can be inferred from the significant titles 3 of the 36 adhyayanas which are as under: (I) viNayasuya (vinayazruta), (2) parIsaha (parISaha), (3) cAuraMgijja ( cAturaGgIya ), (4) asaMkhaya (asaMskRta) or pamAyappamAya (pramAdApramAda), (5) akAmamaraNijja (akAmamaraNIya) or akAmamaraNa, (6) khuDDAgaNiyaMThijja ( kSullakanimranthIya ) or niyaMThijja (nirgranthIya), (7) elaya (elaka) or urambha (aurabhrIya ), (8) kAbilIya ( kApilIya) or kavilijja (kapilIya), (9) namipanvajjA (namipravrajyA), (10) dumapattaya (drumapatraka ), (II ) bahussuyapUyA ( bahuzrutapUjA ), ( 12 ) hariesijja ( harikezIya ) or hariesa (harikeza ), ( 13 ) cittasaMbhUijja (cittasambhUtIya) or cittasaMbhUya (cittasambhUta), (14) usuyArijja ( iSukArIya ), (IS) sabhikkhu ( sabhikSu ) or sabhikkhuya ( sabhikSuka), (16) baMbhacerasamAhiTThANa ( brahmacaryasamAdhisthAna ) or samAhiTThANa (samAdhisthAna), ( 17 ) pAvasamANijja (pApazramaNIya ), (18) saMjaijja (sajayIya ), (19) miyAputtIya (mRgAputrIya) or miyacariyA (mRgacaryA), ( 20.) mahA I Verses 79 to 87 are wrongly numbered as 49 to 57. 2 See p.7. 3 For a set of these titles see Nos. 659 and 681.

Page #41
Jaina Literature and Philosophy [644: niyaMThijja ( mahAnirgranthIya ) or niyaMThijja (nigranthIya), ( 21 ) samuddapAlijja or samuhapAlIya ( samudrapAlIya ), ( 22 ) rahanemijja ( rathanamIya ), ( 23 ) kesigoyamijja (kezigautamIya ), ( 24 ) samiIa ( samitIka), (25) jainnena or jannaijja ( yajJIya), (26) sAmAyArI (sAmAcArI), ( 27 ) khalaMkijja ( khalaGkIya ) or khaluka (khalaGka), ( 28) mokkhamaggagai (mokSamArgagati) or mokkhagai (mokSagati), ( 29 ) saMmattaparakkama ( sAmantaparAkrama ) or appamAda (apramAda), (30) tavamaggaijja (tapomArgIya) or tavamagga (tapomArga), (31) caraNavihi ( caraNavidhi ), ( 32 ) pamAyaTTANa (pramAdasthAna ) or samAhiTThANa ' ( samAdhisthAna ), (33) kammappayaDi or kampappagaDi (karmaprakRti), (34 ) lesA (lezyA ), ( 35 ) aNagAramagga (anagAramArga) cr aNagAra (anagAra) and (36) jIvAjIvavibhAtti (jIvAjIvavibhakti. The names of the 36 adhyayanas mentioned in Samavayangasutra ( sutra 36, p. 64 ) and in the niryukti ( v.13172) to Urtaradhyayanasutra differ at times from these. In this connection it may be added that the names of the adhyayanas 3, 4, 7, 10 and 26 can be mentioned as examples of a naman ( name) by adanapada (one of the ten types) noted in the 13th sutra of Anuyogadvarasutra.3 .. The ninth adhyayana of this text can be compared with the Mahabharata ( XII, 178, 2) and the Buddhistic Jataka No. 539 g. 125 ( Fausboll's edn). The 12th adhyayana 1 This heading is due to a scribal error So says Charpentier in his introduction (p. 36, 2nd foot-note) to Uttaradhyayanasutra. 2 These along with English translation are given by Charpentier in his introduction (pp 35-36) to Uttaradhyayanasatra, and they are given here, too. 3 Cf. Maladharin Hemacandra Suri's following observation in this connection: " AvatItyAcArasya paJcamAdhyayanaM......ityAdAnapadenaitannAma, cAuraMgijjaM ti etaduttarAdhyayaneSu tRtIyamadhyayanam, tatra cAdau cattAri paramaMgANi dulahANIha jaMtuNo' ityAdi vidyate, asaMkhayaM idamapyuttarAdhyayaneSveva caturthamadhyayanam , tatra cAdAveva ' asaMkhayaM jIviya mA pamAyae' ityetat padamasti, tatastenedaM nAma, evamanyAnyapi kAniciduttarAdhyayanAntarvInyadhyayanAni kAnicit tu dazavakAlikasUyagaDAdyadhyayanAni svadhiyA bhaavniiyaani|" - Anuyogadvarasatravrtti, p. 141b

Page #42
644.1 I. 4 Malasutras so has its counterpart in the Matanga-Jataka No. 497, and the ... I3th can be compared with the Jataka No. 498. The I4th adhyayana can be compared with the Mahabharata (XII, 175, repeated XII, 277 ).. Markandeya-Purana (X ff.,) and the Jataka No. 509.' Begins.- fol. 10 5 6 7 // OM namaH // saMjogA vippamukkassa aNagArassa bhikkhuNo viNayaM pa(pA)ukarissAmi ANuyudhi suNeha me // 1 // etc. Ends.-- fol. 73 ii pAukare buddhe nAyae parinie / chattIsaM uttarajjhAe bhavasiddhI( ya ) sammae / tti bemi 267 cha jIvAjIvavibhattI // cha 36 uttarajjhayaNasuyakvaMdho sammatto // cha / ___ saMvat 1651 varSe kArtikavadi 2 ravau // 'barkapallIvAstavyazrI zrImAlI'jJAtIyasamaMgalabhAryA maMgayalA tatsutasuzrAvakadharmakAraNIyakArakasAhagogAkena la(li )SA(khA)pitaM / bhaTTArakazrIsaMyamaratnamaritatsi(cchi )vya - paMDitazrI (7 times ) jayaratnagANatazira cchi )dhyamunisiMgharSAvamalasya puNyArtha jJAnavRddhayartha dattaM zrIrastu dIrghAyuH zubhaM bhavatu[:] // Reference.-- Published along with Laksmivallabha's commentary and a Hindi gloss of Vijaya Sadhu in the Agamasamgraha of Rai Bahadur Dhanapatisimha, Calcutta, in Samvat 1936. The text together with the commentary of Jayakirti is published by Pandit Hiralal Hamsaraj, Jamnagar in A. D. 1909; the text with the niryukti and the commentary of Vadivetala Santi Suri, in the D. L. J. P. F. Series in three parts in A. D. 1916-17 ; the text with the commentary of Kamalasamyama is published in the Yasovijaya Jaina Granthamala, Bhavnagar in A. D. 1927; the text along with the commentary of Bhavavijaya Gani, by the Jaina Atmananda Sabha in Samvat 1974 and .."L..See " Indian Culture " vol. I, No. 2, pp. 146-147. 2 In the Ms. ya is written above maMgalAde.

Page #43
Jaina Literature and Philosophy | 644 the text along with Gujarati translation, by Jaina Dharma Prasaraka Sabha, Bhavnagar. The text is edited by Jarl Charpentier (Archives d'etudes orientales vol. 18), Upasala in A. D. 1921-22. Herein the introduction' contains in short a history of the canonical literature of the Jainas. The text is translated into English by Hermann Jacobi and is published in the Sacred Books of the East as vol. XLV, in A. D. 1895. For quotations etc. see Weber II ( Nos. 1901-1906), pp. 719-730, Indian Antiquary vol. XXI, p. 310 ff., Winternitz, Geschichte (vol. II, pp. 292, 300, 312-315, 316, 318, 320322 and 367), La Religion Djaina ( pp. 27, 49, 79, 80, 86, 91, 92, 96, 211, 218, 238, 249, 263, 269 and 303), A History of Indian Literature (vol. II, pp. 94n., 428n., 429, 431, 442, 446-471, 476n., 534f., 561 and 637) and Die Lehre der Jainas (p. 80 ). For comparison of Uttaradhyayanasutra with Jivavicara see A. Guerinot's "La doctrine des etres vivants dans la religion jaina " (Revue de l'Histoire des Religions, vol. XLVII, pp. 34-50), Paris, 1903. See A Barth's "Bulletin des Religions de l' Inde-Jainisme" (ibid.), vol. VII, 1902; H. Oldenburg's "Buddha, sein Leben, seine Lehre, seine Gemeinde", p.309, n.2 StuttgartBerlin, 1903; its translation in French by A. Foucher, p. 267, n. 1. Paris, 1903; A. Weber's "Ueber die heiligen schriften der Jaina" (Indische Studien, vol. XVI, Leipzig, 18831885); Indian Antiquary vol. XVII; and H. Jacobi's Ausgewahlte Erzahlungen in Maharashtri" (pp. 34-55), Leipzig, 1886, and his article "Ueber den cloka in Pali und Prakrit" (Kuhn's Zeitschrift fur vergleichende Sprachforschung (vol. XXIV, pp. 610-614), Berlin, 1879. 66 I Based upon the remark made by Weber (Indische Studien vol. XVI passin) Charpentier mentions on p. 34 that Uttaradhyayanasutra is identified with Isibhasiya in many canonical and other passages. But as he further observes it is not so as Isibhasiya contains 50 or 54 chapters. Uttaradhyayanasutra is also identified with Devendatthaya which was probably obsolete already in the time of Haribhadra Suri (Cf. Weber Ind. Stud XVII, 43).

Page #44
644.) I. 4. Malasatras E. Leumann's " Die Lejende von Citta und Sambuta" (Wiener Zeitschrift fur die Kunde des Morgenlandes, sf.), Wien and "Weld in Bild und Wort" (Strassburg 1890 ) may be also consulted. In Ardha-Magadhi Reader' there are given as extracts from Uttaradhyayana, the 5th chapter on pp. 55-57 and the 13th and the 14th on pp. 63-67 and 67-74. The English translation of these chapters is therein reproduced from S. B. E. on pp. 142-146, 154-158 and 158-166 respectively. On p. LI Banarsi Das Jain remarks that this work " was composed by Bhadrabahu. "......" Several of the legends" given here "are common to Brahmanic and Buddhist literatures. Many verses are a mere translation of the Mahabharata slokas and a few others correspond in wording to those of the Dhammapada and Jatakas". In the collection of 'Manuscripts of Sarabhai Nawab there is an illustrated Ms. of Uttaradhyayanasutra. It contains 46 illustrations. Out of them 8 are given in Jaina Citrakalpadruma in plates LXXXIV and LXXXV. Each of these plates contains 4 illustrations. The illustrations of the first plate respectively deal with the topics treated in adhyayana XI, verses 16 to 30; XII, 19-30; XIX; and XIX. The second plate has illustrations connected with XX, 19-31; XXI, 4-10; XXII, 33; and XXIII. All these 8 illustrations are preceded by one given from the collection of the late Muniraja Hassavijayaji. For additional Mss. of the text see B. B. R. A. S. vols. III-IV, p. 382, Keith's Catalogue Nos. 7485, 74862 and 74913 and Limbdi Catalogue Nos. 275-278, 279 and 286. For a suvarnaksari Ms. see the Jaina jnana bhandara of Devasa pada, Ahmedabad, I This Reader is published by the University of the Panjab", Lahore, 1923, 2-3 These contain a fragment in chapters XXX and XXXI and one of chapter XXXVI respectively. 4 This Ms. is referred to on p. 75. (foot-note) of Jaina Citrakalpadruma.

Page #45
8 Jaina Literature and Philosophy [645. uttarAdhyayanasUtra Uttaradhyayanasutra No. 645 1880-81. Size.-- 145 in. by i} in. Extent. -- 175 - 10 = 165 leaves ; 3 to 5 lines to a leaf ; 45 to 55 letters to a line. Description.-- Palm-leat; Jaina Devanagari characters with Arats; quite bold, big, uniform, legible and very beautiful handwriting; this Ms. presents an appearance of the work having been written into two separate columns; but, really it is not so, since iines of the first column extend to the second ; borders of each of the columns ruled in three lines in black ink; numbers for leaves written in different margins but on one and the same side of the leaf; in the right-hand margin, as 3, R etc., as usual in numerical characters, whereas in the left-hand one, in letter numerals such as far ifa etc. ; red chalk used; unnumbered sides decorated with a small disc in red colour in the centre; the numbered, in each of the two margins, too ; leaves 73 to 83 partly worm-eaten; the body of the leaves 174 and 175 partly worn out; edges of almost all leaves worn out to a smaller or greater extent; condition on the whole very fair ; leaves placed between two wooden boards; the Ms. well-preserved in the card-board box lined with oil cloth; extent 2300 slokas; leaves 127 to 136 missing ; otherwise complete. Age.- Samvat 1332. Begins.-- leaf 1ba011 TOTT FEC etc., as in No. 644. Ends:-- leaf 175 I(i)I(i) pAukare buddhe nAyae parinie / cha(ttI )saM uttarajjhAe bhavasiddhIya saMvuDe tti bemi // 266

Page #46
1. 4 Mulasatras MEA 3TTEHUU AFA1138 gu TTHOUTTTELEET FANT(#11) "g jua: 347...nistana tofagracial(s) pi zatAni // 2300 saMvat 1332 varSe vaizAkhabadi 3 zanau. Reference. - Regarding this Ms. Charpentier says in his introduc tion (p. 63 ) to Uttaradhyayanasutra that this is " wellwritten but lacks the last ten leaves". F. Kielhorn has described it on pp. 3-4 of his " Report on Ancient palm-leaf Mss. lately acquired for the Government of Bombay. Bombay, 188r". See Indian Antiquary vol. X, p. 100..... N. B.- For other particulars see No. 614. : uttarAdhyayanasUtra Uttaradhyayanasutra No. 646 - 1880-81. Size.-- 324 in, by 18 in. . ....... .!"Extent.--- 64 leaves ; 4 to 5 lines to a leaf ; 125 to 130 letters to a line. Description.-Palm-leaf durable and brownish; Jaina Devanagari characters with Estats; big, legible, uniform and good handwriting; this Ms, presents an appearance of the work having been written into three separate columns; but, really speaking, it is not so, since the lines of the first column extend to the remaing ones; borders of each of the columns ruled * in three lines in black ink ; leaves numbered in both the margins ; in the right-hand one as S, R, etc., and in the left-hand one as a Fal saft etc., i. e. to say in 'P ' S letter-numerals; complete ; some leaves slightly wormeaten ; condition tolerably good ; leaves placed between two I Letters are gone, 2 (J. L.P.]

Page #47
10 Jaina Literature and Philosophy [646. - , wooden boards; the Ms. well-preserved in a card-board box lined with oil cloth ; leaf , blank; so is the leaf 646; red chalk used. Age. Reported as Samvat 1340 (circa), on the ground that this U has been written by the same scribe who wrote: work - No. 663 in Samvat 1342. Begins.- leaf 1 l Q TA' Freire !! ForToT f f etc., as in No. 644. Ends.- leaf 64* iti pAukare buddha etc. up to bhavasiddhIya saMbuDe ti bemi as in No. 644. This is followed by the lines as under: chattIsaM[sa]imaM sammattaM // cha // 257 uttarAyaNAyakvaMbho smmtto|| jogavihIe vihitAe jo lihai sutta atthaM / / bA bhAseI ya bhaviyajaNo so pASai NijjarA viulA jammo dattAe ekaha vi // samagghaMti vigghrhiyss| so lakkhijjai bhanyo putvarisI eva bhAsaMti // Reference. This Ms. was utilized by Charpentier for editing the text of Uttaradhyayanasutra. In his introduction (p. 63) to this work he observes : "I have made use for the text of the Ms. no. 2 of coll. 1880-81, which is from samv. 1340 (= 1284 A. D.), and written apparently by the same hand which wrote no. 5 of the same collection mentioned above. It contains 64 leaves, is quite complete and is very well and clearly written. There are apparently very few mistakes in it, although the orthography is sometimes not quite correct. But this is a fault to be found frequently even in the most excellent manuscripts". N. B.- For other details see No. 644 and F. Kielhorn's Report for 1880-81, p. 3.

Page #48
I 4 Malasatras STERETETE I U ttaradhyayanasutra 86. No. 647 1872-78. Size.--- 10] in. by 4s in. Extent.-- 28 folios ; 17 lines to a page ; 66 letters to a line. Description.- Country paper thin and greyish; Jaina Devanagari characters with quaraTS ; small, legible, uniform and good hand-writing ; borders carefully and neatly ruled in two pairs of lines in black ink; fol. 12 has marginal notes written on it; those in the right-hand margin have slightly faded; strips of paper are pasted to foll. 2 to 25, and the missing letters written on them ; condition very good; complete ; yellow pigment rarely used. Age. -- Fairly old. Subject. The usual text plus the four verses of its niryukti which point out the importance of this text. Begins.- fol. 1 0 TA: f1( Par[:] Il soft II Patient farger etc., as in No. 644.. Ends.- fol. 286 97 ge etc., up to guiat as in No. 644. ... This is followed by the lines as under : 11 Il fagfra TT CAPHIETRIATE 11 8 11 3 11 st II 3 il sont le je kira bhavasiddhIA / parittasaMsAriA ya je bhana)za(rA) te kira paDhaMti ee| chattIsaM uttarajjhAe / 1 / This goes up to puvarisI eva bhAsaMti // 4 // (the last line of the 4th verse which is the same as in No. 00m) saft. Reference. This Ms. is referred to by Charpentier in his in troduction (p. 63 ) to Uttaradhyayanasutra. There, while comparing this Ms. with No. 644 he observes: "The first' is dated samv 1651 (= 1595 A. D.), the other2 has no date ; the first has been rather ill used 1-2 By the first he means the Ms. here se rially numbered as 644, and by the other, this very Ms.

Page #49
Jaina Literature and Philosophy 1647. and has numerous worm-holes, the other is well-preserved and clearly written ". N. B.- For other particulars see No. 644. uttarAdhyayanasUtra Uttaradhyayanasutra No. 648 733. 1899-1915. Size.-- 104 in. by 44 in. Extent.-- 77 - 1 = 76 folios ; 12 lines to a page ; 40 letters to a line. Description.-- Country paper rough and grey ; Jaina Devanagari .. . characters; sufficiently big, clear and fair hand-writing; borders ruled in four lines in black ink; red chalk used; yellow pigment, too; most of the foll. numbered in the right-hand margin only; a piece of paper of the size of a fol. pasted :o fol. 776; condition very good; fol. 776 blank; the 1st fol. is missing; otherwise complete; extent 2100 slokas; fol. 1a seems to have been kept blank; for, fol. . 2deg starts with a portion of the 12th verse of the Ist adhya yana ; the last two lines seem to be laterly added. Age. - Not later than Samvat 1686. Begins. - fol. 2a H T (T) PES GUT I guott) -!! * TETAPE-a ararni(si) TRAFAT I 3R etc. no: Ends.- fol. 77* TU TIETTE etc., up to #ag as in No. 644. This is followed by the lines as under: // 70 jIvAjIvavibhattI sammattA 36 chattIsa uttarajjhayaNANi ___sammattANi ( 1 ) 'tapAgaNe paMDitazrIvarasiMgagaNiziSyagaNizubhavijaya-aM0 7200 (1) Then in a later hand we have :

Page #50
. Malasatras saMvat 1686 phAguNasudi 14 zrI vikrama'nagareM A parati samArI maha urajai / paMDitazrIkamala(vijayagaNivAcanArtha / cuka bhUla dubaha So het die HARPUTH fat giyi al t ri ? N. B. - For further particulars see No. 644. uttarAdhyayanasUtra Uttaradhyayanasutra 4. . . ... No. 649 1880-81. Size. - 134 in. by 24 in. Extent.- 134 + 1 = 135 leaves; s lines to a leaf; 45 to 56 letters to a line. Description.- Palm-leaf; Jaina Devanagari characters with quar; small, quite legible and good hand-writing; this Ms. presents an appearance of the work having been written into two separate columns; but, really speaking, it is not so, since the lines of the first column extend to the second ; borders of each of the columns ruled in two pairs of lines in black ink; the space between these pairs coloured red; eaf 1* blank; leaves numbered in both the margins; in the .. . right-hand margin as 3, R, etc., and in the left-hand one as Fondi 1,, 3, 5, and etc., i. e. to say in letter-numerals ; leaf 101 repeated ; leaves 47, 63, 75, 79, 83, 120(?) and 121(2) seem to be subsequently added ; some portion of leaves to8 to 118 worn out ; even the numbering and a part of the text gone ; several leaves. more or less worm-eaten ; the last three leaves are awfully damaged ; condition on the whole unsatisfactory; the work is incomplete so far as the 36th adhyayana is concerned; otherwise complete. Age. - Fairly old. Begins,-,-. leaf 1. & II FAT(A:) peato il HIT pamagat etc. as in No. 644

Page #51
Jaina Literature and Philosophy Ends.- leaf 1346 ur ...... 2. Afort 3 rear grant a..... Reference.-- Charpentier remarks in his introduction (p. 63) to Uttaradhyayanasutra that this Ms." has no date and is very incomplete". Kielhorn has described it on p. 4 of his Report for 1880-81. N. B.- For further particulars see No. 644. asaMskRtAdhyayana Asanskrtadhyayana (SVEETEHTUT) (Asarkhayajjhayana ) No. 650 39 (b). 1877-78. Extent.- fol. 28" to fol. 28\ i. e. to say i folio. Description.- Complete so far as it goes. For the title see p. 4. For additional particulars see Mrgavatirasa No. 39 (a). 2 1877-78. Age.-- Samvat 1751; this is the date mentioned for No. ned for No39 (a). "1877-78. : ct. This is a work in Prakrit in 13 gathas and it forms the 4th adhyayana out of the 36 of the Uttaradhyayanasutra. It advises the aspirants for liberation to shake off carelessness and to see that anger, pride etc., are overcome by them. Begins.- fol. 28 asaMkhayaM jIviya mA pmaape| jarovaNIyasta hunasthi taannN| evaM viyANAhi jaNe pmtte| (-3) faight FT97 Pomia etc. .. 1-2 These are respectively the 203th and 208th verses of the 36th (last) fer of Uttaradhyayapasutra..

Page #52
658. ] 1. 4 Malasatrast Ends. fol. 286 #serer Tegnarfi te pijjadosANugayA prnmaa| eya(e) ahammu tti dugaMchamANo / kaMkhe guNe jAva sarIrabheDa afH 33 . STEGT (Egnateurera argeti Reference.- For description of an additional Ms. having this adhyayana see Keith's Catalogue No. 7492. N. B.- For further particulars see No. 644. namipravrajyAdhyayana Namipravrajyadhyayana (namipavvajajjhayaNa) (Namipavvajjajshayana ) 579 (c). No. 651 1895-98. Extent.- fol. 12. Description.- Incomplete as it contains 9 verses and a part of the Toth. All of them belong to the ninth adhyayana and are the opening verses of the same. For other details see No. 423 (D. C. J. M. vol. XVII, pt. I, p. 380 ) where this work is styled as Navasloki through oversight. Subject.-The ninth chapter deals with the life of king Nami. Char pentier observes that it belongs to a vast cycle of legends concerning the four pratyekabuddhas, the four kingly saints very famous amongst the Jainas and the Bauddhas, and to some degree known even to the Vaidika Brahmanas.' He looks upon this chapter as a legendary one. 1 See p. 44 of his introduction. . 2 Chapters XII-XIV, XVIII-XXIII and XXV are placed in the same category by him. Ibid., p. 44

Page #53
16 Begins. fol. 12a Ends. A - Jaina Literature and Philosophy caI (i) UNa devalogA (o) ubavanno mANusaMmi loyaMbhi / vasaMtamohaNijjo saraI porANiyaM jAI // 1 // etc. fol. 12a No. 652 22 'mihilAe' ceie vatthe (cche ) sIyachA (cchA ) e maNorame pattapuSphaphalovee bahUNaM bahuguNe sayA // 9 // arer etaria ca (ce) iyaMmi ma // thus. SIMA N. B. For other details see No. 644. mokSamArgagatyadhyayana ( mokkhamaggagai ajjhayaNa ) ALL Size 98 in. by 4 in. (1) AgamikavastuvicAraprakaraNa (2) bandhazataka ( 3 ) bhaktapratijJA (No. 301 ) (4) saMstAraka (,, 314)2 (5) dvAdazabhAvanA (6) pratyAkhyAnabhASya cha // This work ends Moksamargagatyadhyayana (Mokkhamaggagaiajjhayana) (y Extent. 29 folios; 12 lines to a page; 38 letters to a line. Description. Country paper thin and grey; Jaina Devanagari characters; bold, big, clear and good hand-writing; borders ruled in four lines in black ink; foll. numbered in the right-hand margin; in the centre of the numbered and unnumbered sides as well, there is some space kept blank so that it forms a design; edges of almost every fol. slightly worn out; condition tolerably fair; complete; this Ms. contains the following additional works : fol. 2a to 6a 6a,, 10b dr d. "" 193 rob 17b 22a dw 768 (8) 1892-95, [,651. 22 "3 17b 22a 272 27" 29b. 1-2 For description see D. C. J. M. vol. XVII, pt. I, pp. 283 and 289 espectively. Anybull cale, pa 95

Page #54
653.1 1. 4 Malasatras Age.-- Old. Subject. This forms the 28th chapter of Uttaradhyayanasutra, and it deals with Jaina philosophy. This seems to have served as a basis for Tattvarthadhigamasastra. For, it deals with dogmatical questions or matters of doctrines and gives us philosophical information as is mostly the case with chapters XXIV, XXVI, XXIX--XXXI, XXXIII, XXXIV and XXXVI and with introductory portions to chapters II and XVI. Begins.-- fol. 1a 11 mukkhamaggagaI tacca suNeha jiNabhAsiyaM / 75#TUTHT AUCHUICHET ( 1 ) 13 ll etc. Ends.-- fol. 2a khavittA puvakammAI saMjameNa taveNa ya / sabvadukkhappahINatthA pakkamaMti mahesiNo // 36 // iti mokkhamagga(ga)I nAmajjhayaNaM sammattaM // cha / N. B. - For other details see No. 644. uttarAdhyayanasUtra Uttaradhyayanasutra sukhabodhAsahita with Sukhabodha 1098. No. 653 1887-91. Size.- 101 in. by 43 in. Extent.-- 329 folios; 15 lines to a page ; 46 letters to a line. Description.- Country paper thin, rough and greyish ; Jaina Deva nagari characters with A S ; bold, big, clear, uniform and good hand-writing ; borders ruled in four lines in black ink ; red chalk and yellow pigment used; numbers for foll. entered in both the margins; some foll. have stuck together probably due to the presence of gum in the ink used; some of them torn though slightly owing to 3 [ J. L. P. )

Page #55
Jaina Literature and Philosophy [653. ignorant and careless attempts made by some one to separate them ; condition on the whole very fair; this Ms. contains the text and the commentary ( vitti ) Sukhabod ba by name; both complete; extent of the commentary 14000 slokas; Sukhabodha composed in Samvat 1129 on the advice of the fellow-disciple, Municandra Suri; the text is divided into 36 adhyayanas; the extent of each of them together with the corresponding portion of the commentary is as under:Adhyayana with com. foll. Ib to 149 14a >> Sia no VII 898 , 976 976 ,, 102a 102a , 109h 1179 1362 VIII IX 147a XI 147* ,, 1516 1516 ,,1626 1816 1906 1936 1936 ,, 1976 XII XIII XIV XV XVI XVII XVIII XIX XX XXI XXII XXIII 2424 2446 ,, 2532 253,, 2682 268a ,, 2702 XXIV >> >>

Page #56
653 1. 4 Mulasatras Adhyayana XXV with com. foll. 2702 ,, 2726 XXVI 2725 , 2775 XXVII 2796 XXVIII 2796 ,, 2835 XXIX 283b ,, 2936 XXX 2936 ,, 298a XXXI 298a .. 3049 XXXII 304 ,, 3116 XXXIII 3116 ,, 3138 XXXIV 3132 3166 XXXV 3166 ,, 3186 XXXVI 3186 ., 329*. Age. - Samvat 1491 (?). Author of the commentary.- Devendra Gani', pupil of Amradeva Upadhyaya, pupil of Uddyotana Suri of the BIhad gaccha. It seems that this Devendra Gaoi was designated as Nemicandra Suri, on his being raised to the status of 'acarya'. This is what can be inferred from Mss. Nos. 659-661. Probably this is the reason why he is referred to as "Devendra Gani, alias Nemicandra Suri" in Keith's Catalogue in No. 7489. P. Peterson, too, is of the same opinion as can be seen from p. VII of his Report for 1884-86. But his entry viz. "By Nemichandra afterwards called Devandragani" is wrong; for, it should be rather just the reverse. 3 From p. 80% of the Appendix I to this third 1 He belongs to * Tapa' gaccha according to Klatt. See Indian Antiquary vol. IX. 2 In B. B. R. A. S. vols. III-IV, p. 421, the name of the guru of Devendra Gani is mentioned as Amradeva. It ought to be Amradeva unless there is a variant like a FET 6T cat in v. to given on p. 21. 3 This mistake is corrected by him in his fourth Report and there on pp. LIX-LX, he has given detailed information about him. " zrInemicaMdrasUrarya: karjA prastutaprakaraNasya sarvajJAgamaparamArthavedinAmagraNIH kRtinAM // 9 anyAM ca sukhAvagamAM yaH kRtvaanuttraadhyynvRrti| laghuvIracaritamaritnacUDacaritaM caturamatiH // 1."

Page #57
Jaina Literature and Philosophy [653. Report ( 1884-86 ), it follows that Nemicandra Suri, the author of Sukhavagama (Uttaradhyayanavrtti) is the author of Akhyayanamanikosaprakarana, Laguviracarita and Ratnacudacarita'. Subject. The text along with its explanation in Sanskrit. Thus this Sukhabodha of Devendra Gani differs from Sisyahita, the commentary by Vadivetala Santi Suri, who has explained the niryukti, too; but it agrees with it so far as the narratives are concerned. For, Devendra Gani, too, has given them in Prakrit as was done by Santi Suri, his predecessor, just on the lines followed by Haribhadra Suri. This points out an instance which somewhat contradicts the remarks made by E. Leumann about the evolution of Jaina com. mentaries in Z. D. M. G. vol. XLVI, p. 581ff. 20 Begins.-- ( text ) fol. 1 saMyo(jo ) gA vipyamukkassa etc. as in No. 644. . ( com. ) fol. rb e6 // namaH pravacanAya / praNamya vighnasaMghAta ghAtinastIrthanAyakAn / "" as For an account of Sukhabodha also known laguvrtti see Charpentier's introduction ( pp. 55-59 ) ta Uttaradhyayanasutra. " siddhAMzva sarvasAdhUMzva stutvA ca zrutadevatAM // 1 // AtmasmRtaye vakSye jaDamatisaMkSeparucihitArthe ca / ekaikArthanibaddhAM vRttiM sUtrastha sukhabodhA ( dhAM ) // 2 // bahvarthAdvRddhakRtAgaMbhIrAdvivaraNAtsamuddhRtya 1 adhyayanAnAmuttarapUrvANAmekapATagataM // 3 // arthAtarANi pAThAMtarANi sUtre ca vRddhaTIkAtaH / boddhavyAni yato ( 5 ) yaM prAraMbho gamanikAmAtraM // 4 // etc. Ends. - ( text ) fol. 3284 ii pAukare etc., up to bhavasiddhIya sa ( saM ) mae // 74 // (com.) fol. 328b yoga upadhAnAdivyApArA (ra) stadanatikrameNa yathAyogAmetyuttarAdhyayanaTIkAyAM sukhabodhAyAM SaD ( TU )triMzamadhyayanaM // samAptaM // cha // I This is the same work as Tilakanranjari-Ratnacudak.tha noted in Peterson, Reports III, p.66ff. 2 ' uttarAdhyayanAnAm ' ityarthaH /

Page #58
653.1 I. 4 Mulasatras ityuttarAdhyayanaTIkAyAM SaD ( TU ) triMzamadhyayanaM samAptaM // 36 // asti vistAravAmuruzAkhA samanvitaH / Asevyo bhavyasArthAnAM zrI'koTika' gaNadrumaH // 1 // taduttha' vaira 'zAkhAyAmabhUdAyatizAlinI / vizAlA pratizAkheva zrI ' caMdra 'kulasaMtatiH // 2 tasyAzvotpadyamAnacchadanicayasadRtkA (klA ) cakarNAnvayottha zrI ' thArApadra' macchaprasavabhara la saddharmakiMjalkapAnAt / zrIzAMtyAcAra (rya bhRMgapravaramadhusamAmuttarAdhyAyavRttiM vidvalokasya dattapramudamuda[muda] girayAM gabhIrArthasArAM // 3 // tasyA(:) samuddhRtA ve(cai ) SA sUtramAtrasya vRttikA / eka pAThagatA maMdabuddhInAM hitakAmyayA // 4 // AtmasaMsmaraNArthAya tathA maMdadhiyA mayA // ato ( s)parAdhamenaM me kSamaMtu zrutazAlinaH // 5 AsI'caMdra' kulodbhUto vikhyAto jagatItale / akSamArAjito'pyuccairyaH kSamArAjitaH sadA // 62 dharmo tu mUrtimAneva saumyamUrttiH zazAMkavat / varjitazvAzubhairbhAve ( ) rAgadveSamadAdibhiH // 7 // muninirmalaguNairnityaprazAMtaiH zrutA ( ta ) zAlibhiH pradyumnamAnadevAdiribhiH pravirAjitaH / 8 21 vizrutasya mahApIThe 'bRhad gacchasya maMDanaM / zrImAn bihAruka' : ] ( pra ) STa (Ta) sUrisa (rudra) dyoca (ta) nAbhidhaH // 9 tasya ziSyo'devo ( 5 ) bhUdupAdhyAyaH satAM mataH / guNadoSairlebhe padaM na tu // 10 // deveMdragaNizvedavRttavAn vRttikAM tadvineyaH / gurusaudarya zrImanmunicaMdrAcAryavacanena // (11) zodhayatu bRhadanugrahabuddhiM mayi vidhAya vijJajanaH / tatra ca mithyAduH (Sa) kRtamastu kRtamasaMgataM yadiha // / 11 (12 I This and the following one and a half verses are found in Sisyahita. 2 The substance of this and the verses 8-11 are given in English by Charpentier in his introduction ( pp. 56-57) to Uttaradhyayanasutra

Page #59
Jaina Literature and Philosophy [653. 'aNahillAla pATaka'nagare dohaTTizreSThisatkavasatau ca / saMtiSThatA kRteyaM navakarahara(1129 )vatsare ce(cai )va // 12 (13) // paTTikAmo(to')likhaJcemA sarvadevAbhidho gaNiH / AtmakarmakSayAyAtha paropakRtihetave // 13 (14) // dohArDaSThinA cAsyA lekhitA prathamA pratiH / jinavAkyAnuraktena (bhaktena) guNavajane // (15) anuSTa(STupA( bhAM) sahasrANi gaNitaprakriyA bhavet / caturdaza graMthamAnaM tu vRtterasya(syA) vinizcitaM // (16) zrI // zrIrastu // kalyANamastu graM. 14916 (?) zubhaM bhavatu // cha / cha ||shrii|| N. B.- For further particulars see No. 644. Reference.--Sukhabodha is not published so far as I knows. For extracts etc. from Sukhabodha see No. 5 (pp. 4-5) of F. Kielhorn's "Report on the search for Sanskrit Mss. in the Bombay Presidency during the year 1880-81.Bombay, 1881". For a notice of Sukhabodha and extracts from it see pp. 441-442 of R. G. Bhandarkar's "Report on the search for Sanskrit Mss. in the Bombay Presidency during the year 1883-84.-Bombay, 1887." For tales etc. see the appendix to Sthaviravali--charitra or Parisistaparvan (pp. I-28) by Hemacandra Suri edited by H. Jacobi ( Bibliotheca Indica), Calcutta, 1891. See also his article " Ausgewahlte Erzahlungen in Maharastri" 4 which contains ten of the longest and most interesting stories. This is translated into English by J. J. Meyer in his " Hindu Tales", London, 1909. 2. D. M. G. vol. LXIV, p. 397ff., vol. LXVI, p. 38ff., and vol. LXVII, p. 668ff., as well as "Paccekabuddhageschichten", Upsala, 1908 may be also referred to as these contributions come from the learned pen of Charpentier. ____ 1-3 These three verses are respectively quoted on pp. 105, 32 and 94 by Muni Punyavijayaji in his article "Bharatiya Jaina Samskrti ane Lekhanakala" published in Jaina Citrakalpadruma. There he says on these pages that they belong to laghu vrtti of Nemicandra. Furthermore, in his quotations, there is m.ention of Dohadi and not of Dohatti. 4 See p. 6.

Page #60
654.] 1. 4 Mulasatras 23 R. Fick's "Eine jainistiche Bearbeitung der Sagara-Sage", Kiel, 1888, H. Jacobi's " Die Jaina Legende von den Untergange Dvaravati's und von dem Tode Krishna's (Z. D. M. G. vol. XLII, p. 493 ff.), Leipzig, 1888, P. E. Pavolini's La novella di Brahmadatta tradotta ed annotata" (Giornale della societa asiatica italiana, vol. VI:), Roma, 1882, his article "Vicende del tipo di Muladeva "(G. S. A. I, vol. IX, ), Firenze, 1896, and H. Jacobi's article "Ueber die Entstehung der Cvetambara und Digambara Sekten (Z. D. M. G. vol. XXXVIII ), Leipzig, 1884 may be also consulted. For an additional Ms. see Limbdi Catalogue Nos. 290, and for description of a Ms. having only the ending portion of this Sukhabodha see Keith's Catalogue No. 7489. N. B.--Though Devendra Gani and Nemicandra are not different individuals, yet for the sake of convenience, references where Nemicandra Suri's name is specifically mentioned as the vsttikara of Uttaradh yayanasutra, are given in No. 659. The reader is therefore requested to refer for them to the " Reference " of this No. (pp. 30-31). uttarAdhyayanasUtra sukhabodhAsahita Uttaradhyayanasutra with Sukhabodha 3. No. 654 1881-82. Size.-- 334 in. by 19 in. Extent.-- 425 + 2 + 3 - 20 = 410 leaves; 3 to s lines to a leaf ; IIS to 120 letters to a line. Description.-- Palm-leaf durable and brownish; Jaina Devanagari characters with qualis; sufficiently big ; legible, and good hand-writing; the first two leaves written in slightly

Page #61
Jaina Literature and Philosophy 1654. smaller hand-writing; this Ms. presents an appearance of the work having been written into three separate columns; but, really speaking, it is not so; for, the lines of the first column extend to the remaining ones; borders of each of the columns ruled in four lines in black ink; red chalk used; there are two extra blank leaves ; leaves 79, 407 and 423 repeated; the following sets of leaves are numbered together:93 + 94 +95 + 96 + 97 +98; 342 + 343 + 344 + 345 ; 355 + 356 + 357 + 358; 370 + 371 ; 387 + 388 ; 399 + 400 + 401 + 402 + 403; 409 + 410; and 415-416; both the text and the commentary complete ; some leaves appear to be more modern than the rest ; leaves mostly numbered in both the margins; in the right-hand one as %, 2, 3 etc., and in the left-hand one as y , and then after about 99 as in other cases, in letter-numerals; condition good ; leaves placed between two wooden boards; the Ms. well preserved in a card-board box lined with oil cloth; the last leaf 425th wrongly sttung together; extent 14200 slokas. Age.-- Fairly old. Begins.- ( text ) leaf Ib For Peter etc., as in No. 644. , - (com. ) 011 leaf tb FAT foraturare gorie Fauta etc., as in No. 633. Ends.- ( text ) fol. 425* fa 75* etc., up to as in No. 653. ,, - (com. ) fol. 425a stor gratar etc., up to the farfarsari as in No. 653 followed by #31 juta N. B.- For further particulars see No. 653.

Page #62
655.1 uttarAdhyayana sUtra gedurarka No. 655 Size. 103 in. by 43 in. Extent. 2721 = 271 folios; 15 lines to a page; 55 letters to a line. wr - "" Description. Country paper rough and white; Jaina Devanagari characters with gas; small, quite legible and elegant hand-writing; only in the case of foll. 81 to 85; borders are ruled in three lines and edges in one, in red ink; in the case of the rest of the foll. they are unruled; red chalk and yellow pigment used; this Ms. contains the text as well as the commentary styled as Sukhabodha; foll. are numbered twice as usual; fol. 112 appears to be missing; but really speaking foll. 112 and 113 are numbered together; (see the 54 gatha of the 9th adhyayana); fol. 182 appears to be wrongly numbered as 183; if so, fol. 183 should be looked upon as repeated; practically edges of the first fol. slightly worn out; a small portion of fol. 272 gone; dition on the whole good; complete; lacking in colophon; extent 14000 slokas. con Age. Pretty old. Begins. I. 4 Malasatras -- (text) fol. 1b fag ( com. ) fol. 1 ai e6 vItarAgAya namaH | zrIsAradAi ( yai ) namaH // Ends.(text) fol. 2723 4 [J. L. P. 1 25 Uttaradhyayanasutra with Sukhabodha fa etc. as in No. 653. dw 87. 1872-73. etc. as in No. 644. // o ( ) namaH zrIgurubhyo namaH // zrI etc., up to af as in No. 644. (com.),, je kira etc. u ( pa ) dhAnAdivyApArastadataH (na) tikrameNa etc., up to sukhabodhAyAM SaTtriMzamadhyayanaM samAptaM as in No. 653. This is followed by the lines as under :

Page #63
26 uttarAdhyayanasUtra gediarenga No. 656 yadi akSarapada (daiH ) tat sarva kSama (m) tAM devi prasAdaH paramesva ( zva) rI chaH // zrIH graMthAgra 14000 saMpUrNaH // zubhaM bhUyAt // kalyANaM (Na) mastu|: // zrIrastu [:] | akSara kUTa AsAtanA hUMi hUi te ma (micchAmi dukkaDa: ( 6 ) // // zubhaM bhavatu [ : ] // zrIrastu [:] // cha // N. B.- For additional information see No. 653. Jaina Literature and Philosophy ( ) STaM svaravyaMjanavajjitaM Age.-- Fairly old. Begins. [655 dr Uttaradhyayanasutra with Sukhabodha Size.-- 10 in. by 4 in. Extent. 262 + 2 = 264 folios; 15 lines to a page; 56 letters to a line. Description. Country paper thin, tough and white; Jaina Devanagari characters; small, legible and elegant hand-writing; borders ruled in four lines in black ink; red chalk and yellow pigment used; numbers for foll. entered twice as usual; a piece of paper of the size of a fol. pasted to fol. 1a; strips of paper pasted to the edges of fol. 262b; condition on the whole very good; fol. 1a blank; foll. 51 and 78 repeated; this Ms. contains the text as well as the commentary Sukhabodha; both complete except that the latter is lacking in colophon; extent 14000 slokas, 260. 1833-84. (text) fol. 1b fag etc. as in No. 644. -- ( com. ) fol. 1 60 // namaH zrIpravacanAya // fara etc. as in No. 653.

Page #64
657.1 Ends.--- ( text ) fol. 2620 ii pAukare etc., up to bhavasiddhIya samae // 74 // ( com.) fol. 262b yoga upadhAnAdi etc., up to suSa ( kha ) bodhAyAM SaD ( TU ) triMzamadhyayanaM samAptaM as in No. 655. N. B. For other details see No. 653. dr - uttarAdhyayana sUtra gediaraica No. 657 dr I. 4 Malisatras (com.) fol. rb Size. 11 in. by 43 in. Extent.-256 folios; 15 lines to a page; 56 letters to a line. Description. Country paper thin and greyish; Jaina Devanagari characters with gears; small, quite legible and good handwriting; borders ruled in four lines in black ink; red chalk and yellow pigment profusely used; a part of fol. 1b kept blank probably with a view to decorate it with an illustration of a Tirthamkara; fol. 1a blank; a piece of paper of the size of a fol. pasted to fol. 1a; margins of some of the foll. slightly worn out; condition tolerably good; this Ms. contains the text as well as the commentary; both complete but the latter is lacking in the colophon to be found in No. 653. Age.- Pretty old. Begins. fa Ends.-(text) fol. 256 (text) fol. rb joge (gA ) [ saMyogA] vippamukkassa etc. as in No. 653. 49011 'namaH sarvajJAya // etc., as in No. 653. Uttaradhyayanasutra with Sukhabodha 1186. 1886-92. 45 27 etc., up to a as in No. 655.

Page #65
28 Jaina Literature and Philosophy (657. Engs.- (com. ) fol. 2566 Ho Gaya etc., up to ferui as in No. 653 followed by deveMdragaNiviracitAyAM SaD(da )triMzamadhyayanaM HATS 117 118 | Then in a different hand we have :'rAjalakSmIgA(ga)Ni zrI kharataraM gacche zrIjinacaMdrasUzivajayarAjyapra0. rAjalakSmIgaNinyA ziSyaNyA pra puNyazobhAgANinyA zrIuttarAdhya yanakA puNyArtha pradattA pUnAIpaThanArtha N. B.- For additional information see No. 653. uttarAdhyayanasUtra sukhabodhAsahita Uttaradhyayanasutra with Sukhabodha No. 658 164. 1871-72. Size.-104 in. by 45 in. Extent.-- 285 - 5 = 280 folios ; 15 lines to a page ; 55. letters to a line. Description.-- Country paper tough and white ; Jaina Devanagari characters with occasional ATATS; sufficiently big, legible and good hand-writing ; borders ruled in four lines in black ink ; numbers for foll. entered twice as usual; red chalk used ; this. Ms. contains the text as well as the commentary ; foll. 265 to 270 missing ; otherwise both complete.; of course, there is no colophon; extent 14452 slokas; fol. 1a blank; a few foll. slightly worm-eaten ; the last fol. ( 285th ) partly worn out; condition very fair ; in the lefthand margins, the title is written as efter at and Gieo qdeg. Age. - Old. Begins.- ( text ) fol. 1b FAITE faroqyasta etc. as in No. 644. -( com. ) fol. 1by & 011 975AT : 11 que faziara etc., as in No. 653. Ends.-- (text ) fol. 285" T arg etc., up to alh as in No. 655 followed by $4 1 This name seems to be added even later than the other lines.

Page #66
659.) 1. 4 Malasutras 29 Ends.- (com. ) fol. 2855 OTT gquale etc., up to FEDTETTI E fASTAEETTI FAIR as in No. 653 followed by glgi parat (? RTS ) Jorgo 38848 Il sfruta (:) ll ll sa may 11:113 N. B.- For further particulars see No. 653. uttarAdhyayanasUtra sukhabodhAsahita Uttaradhyayanasutra with Sukhabodha' 88. No. 659 1872-73. Size.-- 13} in. by s} in. Extent.-- 214+1+2=217 folios ; 15 lines to a page ; 70 letters to a line. Description.- Country paper thin and greyish; Jaina Devanagari characters; sufficiently big, legible and good hand-writing; borders ruled in two pairs of lines in black ink; the space between these pairs coloured yellow; numbers for foli. entered only once ; unnumbered sides have so to say a square in the centre only and the numbered, in each of the two margins, too; this Ms. contains the text as well as the commentary; both complete ; names of the 36 adhyayanas along with the Nos. of the foll. where each ends, are given on fol. 214; red chalk used; a piece of paper of the size of a fol. pasted to fol. 18 ; fol. 1deg blank; fol. 82 repeated ; fol 86 repeated twice ; almost all foll. more or less worm eaten ; condition very fair. Age.- Pretty old. Author of the commentary.-Nemicandra Suri alias Devendra Gani. Subject.-- The text in Prakrit along with its explanation in Sanskrit. Begins.-- ( text ) fol. 1b Fitr pas etc. as in No. 644 -( com. ) fol. 1 g & OUTH FORT TUFT ETT etc. This is styled as laghuvstti, too, See No. 661, p. 33.

Page #67
30 Jaina Literature and Philosophy [659. Ends.--- ( text ) fol. 214 iti pAukare buddha etc. , up to bhavAsaddhIya saMkhuDe as in No. 645. - ( com. ) fol. 214* yoga upadhAnAdi etc., up to padaM na tu // 6 // This is, however, No. To according to No. 6533; for, here the fifth verse is numbered as ). This is followed by the lines as under :-- zrInemicaMdrasUriruddhRtavAn vRttikA tadvineyaH guruso(saudaryazrImanmunicaMdrA(cAryavacanena / 7 zodhayatu vRhadanugrahabuddhiM mayi saMvidhyA(dhA)ya vijJajanaH / tatra ca mithyAduHkRtamastu kRtamasaMgataM yadiha // 8 // zrIuttarAdhya tti )pustikaM likhitaM / ch| paripUrNamiti // cha / / zubhaM bhavatu // cha // kalyANaM(Na)mastu / / ||ch| shrii|||| // shrii||ch| This is followed by the following lines written in a different hand :1 vinayAdhyayanaM patra 9 / 19 mRgAputraM // patra 150 2 parISahAdhyayana (,) 20 mahAni(pa)thaM (,) 153 3 caturiMgiyA 44 21 samudrapA. (,) 155 4 asaMkhayaM 22 rahanAmi (,) 160 5 akAmamaraNaM 23 kezigotama (,) 170 6 kSullakanigraM( thaM (,) 24 pravacanamAtA (,) 172 7 urabhI(zrI)yAdhya (,) 25 vijayaghoSaM (,) 174 8kapilIyaM. (,) 73 26 sAmAcArI (,) 177 9 namirAjapratyeka ,,) 27 Su(Sola(lokIyAdhya (,) 179 10 gautamacaritraM (,) 93 28 mokSamArga ( ka) 11 bahuzrutaM(?) (,) 97 29 samyaktvapa0 12 harikesiyaM patra 103 30 tpomaarg| (ka) 192 13 citrasaMbhUti 31 caraNavidhi (,) 196 14 iNu(Su)kAra patra 120 32 apramAda (,) 202 15 si( ? )adhyayanaM (,) 122 33 karmaprakRti (,) 203 16 brahmacarya patra 124 34 lezA(zyA) (,) 205 17 pApazramaNaM / (,) 126 / 35 anagAraguNaM (,) 207 18 sNytraaj| (,) 146 / 36 jIvAjIvaM . (,) 214 Reference.-- For description of an additional Ms. having both the text and Sukhabodha see B. B. R. A.S. vols. III-IV, patra

Page #68
660. 1. 4 Malasutras 31 p. 383. Here it is said that the author "may be Nemi. candra". Moreover, there is a query as under: "Is it an Avacuri extracted from santi Suri's Sisyahita ? " For description of a Ms. having the text and laghuvstti by Nemicandra Suri, see Keith's Catalogue No. 7488. For description of a palm-leaf Ms. at Cambay, which contains the text and Subodha (this commentary ) see Peterson, Reports III, p. 71 On pp. 71-72 extracts are given. For an additional Ms. having the text and laghuvstti corrected by Tejoraja in Samvat isso see Limbdi Catalogue No. 288. N. B.-- For other details see No. 653 ( p. ). uttarAdhyayanasUtra Uttaradhyayanasutra sukhabodhAsahita with Sukhabodha 690. No. 660 1899-1915. Size.-- 92 in. by 44 in. Extent. - 345 folios; 15 lines to a page ; 40 letters to a line. Description.--- Country paper rough and white; Jaina Devanagari characters; big, clear and good hand-writing: borders ruled in four lines in black ink; red chalk and yellow pigment used; a part of the first fol. torn ; several foll. more or less worm-eaten; condition unsatisfactory; this Ms. contains the text and the commentary, both complete, Age. - Fairly old. Begins.-- ( text ) fol. 1b FFTTT Racquete etc. as in No. 644. ,, - ( com. ) fol. 1b starta TA: 11 Other feata etc. as in No. 653.

Page #69
32 Jaina Literature and Philosophy [661. Ends. ( text ) fol. 345a ga 9734 etc., up to an as in No. 644. This is followed by // 265 // The mAhAtmya pointed out in verses by the niryuktikara is also given here. ,, -- (com. ) fol. : 458 IT AT etc., up to vite as in No. 659. The number of the last verse is mentiond as 12. Then we find the following lines :-- _anuSTubhyAM(bhAM) sahasrANi gaNita(pra)kriyAbhavana(t) dvAdaza graMthamAnaM tu / vRtterasyA vinizcitaM // 13 // grasf3FITTEJTAanal : ) FATA:(A) 1 sfi i etc. Eura - *HT: .....' APOTAN : FETTETA: F..... faceret grafi fr 11 R gfa : 11 N. B.- For other details see No. 659. uttarAdhyayanasUtra Uttaradhyayanasutra sukhabodhAsahita with Sukhabodha 635. No. 661 1892-95. Size.-- 101 in. by 43 in. Extent.- 360-2+1 = 359 folios ; 13 lines to a page ; 46 letters to a line. Description.- Country paper thin and greyish ; Jaina Devanagari characters with EAS; small, clear and very fair handwriting ; borders ruled in two to three lines in black ink; red chalk and yellow pigment used; numbers for foll. entered only once ; fol. 58 repeated ; foll. r* and 3600 blank; foll. iro and III numbered as 1010 and 1011; foll. 136 to 359 also numbered as 1, 2 etc. in the same (right-hand) margin ; a piece of paper of the size of a fol. pasted to fol. 360b, edges of the first fol. slightly worn out; several foll. more or less worm-eaten; some even very badly : condition very fair ; this Ms. contains the text and the commentary as well ; both almost complete ; for, only foll. 49 and 241 missing ; extent 14427 slokas. Age.-- Samvat 1479. 1-2 These letters are illegible owing to their being blurred ont

Page #70
*661.] 1.4 Malasntras Begins.- ( text ) fol. Ib saMjogA vippamukkassa etc. as in No. 644. ,, - (com. ) fol. 1 ||e 0||u (3) namo vItarAgAya nmH|| praNamya vighnasaMghAta etc., as in No. 653. Ends.- (text) fol. 359" iti pAukare up to saMvuDe as in No. 644. , - ( com.) fol. 359 yoga upadhAnAdi etc., practically up to yadiha // Cll as in No. 653. This is followed by the lines as under :-- saM(sa)mAptA // saMvat 1479 varSe jyeSTha zudi SaSThayAM ravau zrIzrI upakeza'gacche zrIsiddhAcAryasaMtAne kaH pUjyo vibudho budhaiH kimaparaM dhe(dhye yaM sabhAM(bhA)saMmataM kaH sarvatra gati[ryajane vada paraM kasmAcca tattvaM bhuvi? kasmin zAsati jAyate gatabhayA pRthvI prakAmonvatA vizvaM kastimiraiH karoti rahitaM zrIbhUpateH kena vA? // 1 // eteSAM kila zabdAnAmAdyatAkSaralopanAt saMjAyate 'bhidhA yasya sA(so'yaM mUriH zriye( 5 )stu vaH // 2 // prakAza(pra)bhAvaM pracaMDapratApaM _prazastaM praNaumi prabhAtapraveze prabhu taM prakRSTaM prasiddha pradhAna prarUDhagrahapuNyapraroha prasUriM // 3 // evaMvidhaguNopetabhaTTArakazrIzrIdevaguptasUrINAmAdezena ziSyANurU(?)pAdhyAyazrIvinayaprabheNa AtmapaThanArtha zrInemicaMdrasUriviracitA zrIuttarAdhyayana laghuvRtti(ni)nijasaMca(?)pustake nijagurvAjJayA lipApitA leSakena likhitA zrIuttarAdhyayanavRtti(:) saMpUrNA // graMthAna 14227 etc. Reference. This Ms. appears to be the same as numbered 135 of 1892-95 and referred to by Charpentier in his introduction (p. 64 ) to Uttaradhyayanasutra ; for, in the Government Collections there is no Ms. numbered as 135 of coll. 1892-95 containing Sukhabodha. N. B.-- For additional information see No. 653. 5 J. L.P.]

Page #71
Jaina Literature and Philosophy ( 662 sukhabodhA (3FITETTAPET) No. 662 Sukhabodha ( Uttaradhyayanasutravrtti ) 1881-82. Size.-- 26 in. by ng in. Extent.- 345 - 1 = 344 leaves ; 3 to 5 lines to a leaf ; 115 to 120 letters to a line. Description.-- Palm-leaf durable and brownish ; Jaina Devanagari characters with EasTS; sufficiently big, legible, uniform and good hand-writing ; this Ms. presents an appearance of the work having been written into three separate columns; but, really it is not so ; for, the lines of the first column are continued to the rest; borders of each of the columns mostly ruled in two lines in black ink ; leaves numbered in both the margins : in the right-hand one as %, etc., and in the left-hand one mostly in letter-numerals e. g. the ist as *}, the 2nd as , the 3rd as , the 4th as of etc., leaves 128 and 129 bracketted ; this Ms. contains gares of the text; complete ; condition good; well-preserved in a cardboard box lined with oil cloth ; leaves placed between two wooden boards ; leaves 218, 269 and 345 have artistic designs; leaves 19 and 3456 blank. Age.- Samvat 1164 i. e. to say 35 years after its composition. Author.- Devendra Gani. Subject.- Uttaradhyayanasutra explained in Sanskrit. Begins.- leaf 1 Q FA: TTTATI Ture latina etc., as in No. 653. Ends.- leaf 34 TTTT gevratie etc., up to farfarsani as in No. 653 This is followed by the lines as under :

Page #72
663.] I. 4 Malasutras saMvat 1964 mArgazudi 10 budhadine azvinInakSatre parighayoge 'Amalezvara' grAmAvasthitena paMDita mAdhavena uttarAdhyayanavRtti pustakaM likhitamiti // cha // cha / maMgalaM mahAzrI // cha // Reference. akSaramAtrapadasvarahInaM vyaMjana saMdhivivarjitarekaM / sAdhubhi... ma kSamitavyaM ko (S)tra na muhyati zAstrasamudre // ? Amongst the 6 Mss. written on palm-leaf and 23 on paper regarding Uttaradhyayanasutra and its commentaries seen by Charpentier, he looks upon this as the best. See his introduction (p. 62) to Uttaradhyayanasutra. See also Z. D. M. G. vol. LXVII, p. 665ft., where it has been described by him. A facsimile is also given there. According to Jacobi, the date given at the end here corresponds to Wednesday, November 27, 1107 A. D. N. B. For other details see Nos. 644 and 653. geatan No. 663 35 Sukhabodha 5. 1880-81. Size. 323 in. by 24 in. Extent. 393 + 1 + 1-2 = 393 leaves; 3 to 6 lines to a leaf; 125 to 130 letters to a line. Description. Palm leaf durable and greyish; Jaina Devanagari characters with as; big, legible, uniform and good hand-writing; this Ms. presents an appearance of the work having been written into three separate columns; but, really it is not so, since the lines of the first column extend to the remaining ones; borders of each of the columns mostly ruled in three lines in black ink; leaf ra blank; an extra I Letters are gone. They ought to be

Page #73
36 Jarna Literature and Philosophy [663. leaf at the end practically blank; leaves numbered in both the margins ; in the right-hand one as 1, 2, 3 etc., and in the left-hand one as zrI zrI zrI) ,8 , ut, etc.; condition good; well-preserved in a card-board box lined with oil cloth ; leaves placed between two wooden boards ; leaf 109 repeated; leaves I97, 198 and 199 numbered together, that is to say leat 197 also numbered as 198 and 199 ; this Ms. contains gates of the text ; it is lacking in prasasti ; otherwise complete"; bought in Samvat 1401 and presented to a Jaina saint Jinalabdhi by name; extent 1 2000 slokas, Age.- Samvat I342. Begins.- fol. : 6 ||nmH sarvajJAya / praNamya vighnasaMghAta etc. , as in No. 653... Ends.- fol. 393 jo(yo )ga upadhAnAdi etc., up to sukhabodhAyAM patriMzada dhyayanaM samAptaM and then from anuSTubhAM sahasrANi up to vinizcitaM // as in No. 653. This is followed by the lines as under : graMthAna 12000 // cha / sadanati........... uttarAdhyayanaTIkAyAM sukhabodhAyAM etc. up to vinizcitaM as above repeated followed by graMthAyaM 12000 cha saMvat 1342 kA varSe vaizASavadi 7 mai(?) dine uttarAdhyayanapusta ............. likhitaM / .........'cha Then we have on an additional leaf the following lines which are on the whole written in a different hand : saMvat 1401 varSe mAghamAse zuklatrayodazIdine sA0 dhIMdhAsatasA0mohaNasuzrAvakeNa svamAturdhAdhaladavisuzrAvikApuNyArtha zrIuttarAdhyayanasUtravRttipustakaM mUlyena gRhItvA zrI kharataragacche zrIjinapadmasUripaTTAlaMkArazrIjinalabdhimUrisugurubhyaH prAdAyi / pratidinaM ca vAcyamAnaM munibhizciraM naMdatAt // gotrA(?) 'kAMkarikA bhidhe bhuvi babhUvodAbhidhAnaH zu(su)dhIH zrAddhaM(ddhaH) zuddhanayastadIyatanayo dhaMdhAbhidhaH zrIlayaH 1-2 Charpentier says the same thing in his introduction (p.63) to Uttaradhyayanasutra. 3-5 Letters are gone.

Page #74
664.] ___1.4 Malasatras kAMtA dhAMdhaladevikA(s)sya tanujAratatkA jayaMti trayaH puNyAmohaNakRSNakAMkSaNa iti khyAtAH sutA muktikA // 1 // mohaNena nijamAtRsupuNyazrInimittamidamuttamapustaM zra(?zu)cyuttarAdhyayanasUtrasuvRtyoH saMpragRhya ghanamUlyadhaNena // zrIjinalabdhiyatIzvaragurave prAdAyi vAcanA( nAM ) vidhAya / yAvajjinamatametannadata munivAcyamAnamiha // 3 yugmaM ||ch|| N. B.- For other details see No. 662. uttarAdhyayanasUtra Uttaradbyayanasutra avacUrisahita with avacuri 633. No. 664 1892-95. Size.-- 104 in. by 41 in. Extent.- (text) 50 folios; 16 lines to a page ; 46 letters to a line. , -(com.), , ; 34' , , , ,; 14 " , "" Description.- Country paper thin and greyish ; Jaina Devanagari characters with pRSThamAtrAs%3 this is a pazcapATI Ms., the text written in a bigger hand as compared with that of avacuri ; small, legible and good hand-writing; ink faded at times : the central portion as well the margins decorated with nice small pictures ; borders ruled ; numbers for foll. entered only once, and that too, in the right-hand margin ; edges of the foll. slightly worn out ; this Ms. contains both the text and the commentary ; fol. rb decorated with mangalas like svastika, nandyavarta, etc., condition very fair ; com plete. Age.- Samvat I485. Author of the avacuri.- Not mentioned. Subject. -- The text along with a small commentary in Sanskrit. Begins.- ( text ) fol. I ahaM // saMjogA vippamukkassa etc. 1-2 These numbers refer to a column.

Page #75
38 Jaina Literature and Philosophy [664. Begins.- ( com. ) fol. 1 ahe nmH| saMyogAnmAtrAdi kaSAyAdi bAhyAbhyaMtarabhedAt vividhiH(? dhaiH ) prakAraiH jJAnabhAvanAdibhiH anagArasyeti vizeSaNaM etc. Ends.- (text ) fol. 50deg ii pAukare etc., up to bemi as in No 644. This is followed by // 67 // jIvAjIvavibhattI ajjhayaNaM saMmattaM / cha // niyuktikAra etanmAhAtmyamAha / je kira etc., up to punvarisI eva bhAsaMti ( 4 ) // as in No. 675. Then we have: -- saM0 1485 varSa AsA likhitaM ,, - ( com.) fol. 50deg ii0 ityetAn... prAduHkRtya kAMzcidarthata etc. This portion is not sufficiently legible. Reference. For a Ms. having this text and notes see the " Cata logue of newly discovered, rare and old Mss. in the Lahore Division", Lahore, I881. uttarAdhyayanasUtra Uttaradhyayanasutra vRsisahita with vrtti 1187. No. 665 1886-92. Size.-- 101 in. by 43 in. Extent.- 284 folios ; I3 lines to a page; 40 letters to a line. Description.-Country paper rough and white; Jaina Devanagari characters with pRSThamAtrAs; big, clear and good hand-writing%3B borders ruled in four lines in black ink ; yellow pigment used; numbers for foll. entered only once; fol. IN blank except that the title of this work is written on it; this Ms. contains the text and the commentary as well, both complete; condition excellent; extent 8260 slokas; the com mentary composed in Samvat 1525. Age.- Not later than Samvat 1710. Author of the commentary.-Kirtivallabha Gani, pupil of Jaya kesarin Suri.

Page #76
665.] I.4 Malasatras 39 Subject.- The text along with a commentary in Sanskrit. Begins.- (text ) fol. I' namaH zrIsarvajJAya namaH // saMjogA vippamukkassa etc. ,, -(com. ) fol. I' ahaM bhikSovinayaM prAduHkariSyAmi prakaTIkariSyAmi AnupUrvyA krameNa me mama etc. Ends.- ( text ) fol. 284" iti pAukare etc., up to bemi as in No 646. ,, - ( com ) ,, ,, samaMtAna iSTAn bhavasiddhikasamatAn // 272 iti :) samAptau bravImi sudharmasvAmI jaMbUsvAminaM prati Aha // iti u patriMzAdhyayanaM jIvAjIvavibhaktyAkhyaM // 36 iti zrIuttarAdhyayana vRttiH saMpUrNA // AsIda zrIvIrapaTTe pravaragaNadhara( ; ) zrIsudharmAbhidhAna statpaTTe svAmijaMbUprabhavamukhamahAmarirAjo babhUvuH / sarveSA....sphuTapaTupadavIbhAradhartI maheMdraH sUrIMdrANAmazeSakSititalAvadito merutuMgo munIMdraH // 1 tatpaDAMbujarAjahaMsasadra( dR zo vidyAvatAmIzvaraH zrImatzrIjayakIrtimariprabhugurustatpadRcUDAmaNiH / sUrizrIjayakesariprabhu (su)gurustatpaTTayane( ? )zvaraH siddhAMtAnugasAgaro vijayate sUrIzvaraH sAMprataM // 2 tacchiSyo nanu kIrtivallabhagaNirmugdhAgramI(? NI )ohato pRSTavyAkaraNoktivRttimalikhya( kha )nmugdhaprabodhapradAM pUrdhanirmitadIpikAdikamahAgraMthAnusArAtsvaka prajJAvedanatazca sauvasuguruprauDhaprasakteH punaH // 3 saMvat paMcadaze dvipaMca(1525)gaNita(te) varSe ca harSaprade suzrI ahmadavAda nAmni nagare dIpotsave nirmitA yAvaThIjinazAsanaM vijayate sarvotsavaiH sarvata stAvannadatu vRttikA kavijanairvAvacyamAnA sanA // 4 kAryosakyatayA mayA punariyaM saMzodhitA nAsti bho vidvadbhistu paropakAranirataiH zodhyA visa(zuddhAtmabhiH / buddhastucchatayA yadava kimapi nyUnaM tathA vA(adhika tatsarva kSAmitavyamuttamatAma( tamai )rbaddha viruddhaM ca yat // 5 //

Page #77
Jaina Literature and Philosophy [665. aSTau sahasrA dvizatI ca SaSTiH zlokAstatazvopari paMca vrnnaaH| pratyekavarNa parimANametad graMthasya vijJeyamameyazobhaiH // 6 // graMthAnaM 8260 // iti zrIuttarAdhyayanavRttiH saMpUrNA etc. uttarAdhyayanasUtra Uttaradhyayanasutra akSarArthasahita with aksarartha No. 666 1171. 1884-1887 Size.- 101 in. by 41 in. Extent.- ( text) 111 folios ; 12 to 19 lines to a page; 70 letters to a line. ,, - (com.) 111 folios ; 21' lines to a page ; 192 letters to a line. Description.- Country paper thin and white; Jaina Devanagari ch aracters with EATETIS ; this is a paret Ms.; the text written in the centre in a sufficiently big hand-writing ; legible, uniform and very good hand-writing; borders ruled in four lines and edges in one, 'in black ink ; red chalk used; white pigment, too; unnumbered sides have in red colour a disc in the centre only; the numbered, in each of the two margins, too; this Ms. contains the text and its commentary as well; fol. ra blank; numbers for foll. entered only once in the right-hand margin; corners of some of the last foll. slightly worn out; edges of the fol. IIIth partly gone ; condition on the whole very good ; complete. Age. - Samvat 1701. Author of the aksarartha.- Not mentioned. Subject. - The text along with a small commentary in Sanskrit containing narratives. 1-2 These numbers refer to a column.

Page #78
666.] I. 4. Malasatras Begins.- ( text ) fol. I" e saMjogA vippamukkassa etc. ,, - (com. ) fol. I OM namo vItarAgAya // arhatsiddhAcAryopAdhyAyamunIn praNamya vivRNomi smRtyarthamuttarAdhyayanAnAM gAthAkSarArtha( 2 ) kathaM // 1 // saMjo saMyogAnmAtrAdi bAhyAbhyaMtarabhedAt vividhaiH prakArAnabhAvanAdibhiH / avidyamAnaM dravyabhAvabhedabhinnama'gAramasyetya'nagArastasya / etc. kUlavAlakazramaNavat dRSTAMto / yathA // ekasyAcAryasya durvinItaH ziSya: etc. Ends.-( text ) fol. III ia pAukare etc., up to bemi as in No. 644. This is followed by the lines as under : jIvAjIvavibhattinAma ajjhayaNaM 36 uttarajjhayaNasayakkhaMdho sammatto niyuktikAramAhAtmya je kira etc., up to putvarisI eva bhAsaMti // 71 // zubhaM bhavatu // 36 // iti zrIuttarAdhyayA(yanA)ni likhApitAni 'DIsAvAla jJAtIyasaMgoiMdabhAryAsutasa jogAkena bhAryAbhrAtRbhogAdikuTuMbayugena paMDitaprakAMDapaM0 merurAjagANiziSyavibudhamaMDalIspRhaNIyazIlapaM0. jJAnazIlagaNivAcanArtha saMvat 1527 varSe // ||ch // etc. saMvat 17010 (?) varSe zrI kRSNagaDha'nagare pratilAbhitA pratiriyaM bha zrIvijayadevamUriziSyapaM0kapUravijayagaNInAM // muM0 zrIrAyacaMdakena zrIrUpasiMghajIrAjye - ( com. ) fol. III guruprasAdAd gurucittaprasannatArUpAddhayetAH / adhIyeta paThenna tu pramAdaM kuryAditi bhAvaH // guruprasAdAditi adhyayanArthinA'vazyaM guravastoSyAstadadhInatvAttasyeti // 3 / 4 / 5 / zivamastu naH // cha / followed by the following lines in a very big hand:_lipItaM paM0zrIpaM jayavijayagaNidi(dI)pavije(ja)yagaNIni(nI) A parata cha 'devasu(sAraM gacche. 6 J. L. P.]

Page #79
42 uttarAdhyayana sUtra akSarArthalavalezasahita Jaina Literature and Philosophy " [667. Uttaradhyayanasutra with aksararthalavalesa No. 667 Size.- 1o++ in. by 4g in. Extent. - 143 folios; 16 lines to a page ; 44 letters to a line. Description.-- Country paper thin, rough and white ; Jaina Deva nagari characters; small, legible and very fair hand-writing; borders ruled in four lines in black ink; red chalk used; numbers for foll. entered only once ; fol. ra blank ; a bit of paper pasted to fol. 4; condition very good; this Ms. contains the text as well as its explanation in Sanskrit which is further elucidated in Gujarati; complete; extent 6598 slokas. Age. -- Samvat 1592. Author of the aksarathalavales' a. - Not mentioned. Begins.-- (text) fol. 1 OM namaH zrIvarddhamAnAya svAhA // saMjogA viSpamukkassa etc. Subject. The text along with a commentary in Sanskrit and its explanation in Gujarati. 22 261. 1883-84. (com) fol. rb arthaH / bhikSorvinayaM prAduH kariSyAmi / AnupUryA me mama kathayata / zRNuta / AnupUrvI anukramadaM kahitAM sAMbhAla etc. Ends. -- ( text ) fol. 1435 iya ( pAu ) kare buddhe etc., up to bemi as in No. 666. This is followed by // 82 // 31 ( com. ) fol. 143deg iti etAn SaTUtriMzat uttarAdhyena yena uttarAdhyayanAni prAdukRtya kAMzcit arthataH / sUtrataH prakAzya buddhakevalI jJAtayo jJAtaputraH zrIvarddhamAnasvAmI parinirvRta (:) nirvANaM prAptaH / kiMviziSTAn uttarAdhyAyAn bhavasiddhikA bhavyajIvAsteSAM saMmatAn iSTAn // 82 iti SaD ( TU ) triMzana (tU) zrIuttarAdhyayanAkSarArthalavaleza (:) smaaptH|| saMvat 1592varSe AsaujamAse zuklapakSe dvAdazyAM tithau zukravAsare / zrI ' caitra' gacche gacchanAyaka bhI harSarAjasUrIsva ( zva) rANAM / tatza (cchiSyaza ( ziSyAnza ( zi ) Sya

Page #80
668.] I. 4 Malasatras 43 munimuniratnena lililiSitaM // zrIrastu // rANAzrIvikramAdityarAjye 'kaThADagrAmamadhye liSitA etc. kalA yasyaikaiva tribhuvanaguromaDanamabhUt sudhA sarve yasya tridazavaravRndAnyatithayaH / kRto(s)sau yeneduH sakalajanavastrAMcaladazA [so yaM] pratigrAhI kAlaH sakalanahi kiM kiM na kurute // 1 graMthAnaM 6598 uttarAdhyayanasUtra akSarArthalavalezasahita Uttaradhyayanasutra with aksararthalavalesa No. 668 1320. 1891-95. Size.-- 104 in. by 4} in. Extent.-- 138 folios ; 15 lines to a page ; 48 letters to a line. Description.- Country paper rough and greyish ; Jaina Devanagari characters with occasional PAES; small, legible and good hand-writing ; borders ruled in two pairs of lines in black ink ; the space between these pairs coloured red ; foll. num. bered in the right-hand margin only; small discs in red colour to be found in the centre and the margins as well, both in the case of the numbered and unnumbered sides; this Ms. contains the text as well as the commentary ; a piece of paper of the size of a fol. pasted to foll. ja and 138b; each of them decorated with designs in red colour ; this Ms. seems to be exposed to rain ; perhaps that is why a few foll. in the beginning are not quite legible; red chalk and yellow pigment used; some of the foll. somewhat torn ; strips of paper pasted to fol. 138b; condition very fair ; both the text and the commentaries complete except that the Gujarati commentary does not seem to go up to the end.

Page #81
44 Jaina Literature and Philosophy [668. 1668. Age.- Samvat 1621. Author of the aksararthalavalesa.- Not mentioned. Subject.-- A Jaina agama with its explanation in Sanskrit and Gujarati as well. Begins.- ( text ) fol. & namaH sarvajJAya // saMjogA vippamukkassa etc. , -- ( com. ) fol. I' bhikSoH vinayaM prAduHkariSyAmi / AnupUrvyA me mama kathayataH shRnnut| ,, -- (Guj. com.) fol. I bhikSu mahAtmyanaI vinayamArga prakaTa karisu Anu pUrtyA anukramiI mujanai kahatAM etc. Ends.- ( text ) fol. 137deg iti pAukare etc., up to bemi // as in No. 646. " -- (com.) ,, ,, iti etAn SaTtriMzataM uttarAdhyAyAn etc. saMmatAn iSTAn / 270 / iti jIvAjIvavibhAktinAmA patriMzat uttraadhyynaakssraarthlvleshH| je kira bhavasiddhiyA etc., up to guruppasAyA ahijijA / 2 / Then we have as under : saMvat 1621 varSe vaizASazudi 15 ravI zrI aMcalaM gacche zrIzrImerutuMgamUrizA( ? )tyeya( ? )ziSyaupAdhyAyazrI3dharmAnaMdanatatsa(cchi)SyapaM0 zrIdharmAvardhanagANitatsa( cchi vyapaM zrIvinayazIlagaNitatsa( cchi )Syi( Sya )paM zrIvidyAzIlagaNiza( zi )Syamunivivekameruza(zi )vyasahijA svayameva vAcyamAnArtha liSApitaM / yAdRzaM etc. , - ( Guj. com. ) fol. 84 kezakumAra gautama pratii boliuM pAza kehA kahyA etc.

Page #82
669.1 1. 4 Malasatras 45 uttarAdhyayanasUtra Uttaradhyayanasutra akSarArthalavalezasahita with aksararthalavalesa 847. No. 669 1895-1902. Size.- Ingin. by 4 in. Extent.-- 132 folios; 15 lines to a page ; 54 letters to a line. Description.-Country paper thin, rough and greyish ; Jaina Deva nagari characters with HATTIS; small, legible and good hand-writing ; borders ruled in two pairs of lines in black ink; the space between these pairs coloured red; red chalk used; yellow pigment, too; foll. numbered in the right-hand margin only ; unnumbered sides have a small disc in red colour, in the centre only; the numbered, in each of the two margins, too; fol. 1a blank; each of the foll. rb and 22 has an illustration of a Jina in various colours ; edges of of the first two foll. slightly damaged ; several foll. more or less worm-eaten; some very badly; a strip of paper pasted to fol. 1325; condition on the whole fair ; both the text and the commentaries complete. Age.- Pretty old. Author of the aksararthalavalesa.-- Not mentioned. Subject.-- The text in Prakrit together with its elucidation in Sanskrit and Gujarati as well. Begins.- ( text ) fol. 1b FA: HTTT 11 FTTT lagaF etc., as in No. 644. ,, - ( com. ) fol. 1b PaT: laad urg: Gurih etc. ,, - (Guj. com. ) fol. 15 pares her arag etc. Ends.- ( text ) fol. 1325 grat qr3* etc. , up to atA as in No. 668. ,, -- (com.), ,, gra gara gerasta up to para ser !! etc., practically as in No. 667 followed by the lines as under:

Page #83
46 "" Jaina Literature and Philosophy 1669. iti SaTtriMzatauttarAdhyayanAkSarArthalavalezaH // cha // je kira bhavasiddhi (ddhI) yA etc., guruppasAyA ahijjijjA // 2 // as in No. 668, Then we have : iti zubhaM bhavatu leSakavAcakazca / kalyANamastu zrIzramaNasaMghAya bhadraM // // Then some letters are not legible owing to the paper being pasted over them. devagaNita ( letters scratched ) SyapaM vAcaka (?)maMdira muni leSayitA // zubhaM bhavatu // -- ( Guj. com.) fol. chapter. uttarAdhyayana sUtra vRttisahita No. 670 1134 savihuM karma taNuM pradezAgra pa ( pu )gula paramANu etc. This is just about the end of the 33rd Uttaradhyayanasutra with vrtti 1097. 1887-91. Size. 10 in. by 42 in. Extent. 346 1 + 1 - 14 = 332 folios; 17 lines to a page; 42 letters to a line. Description. Country paper tough and white; Jaina Devanagari characters; small, quite legible and good hand-writing; borders ruled in three lines and edges in one, in red ink; ; the 1st fol. lacking; foll. 2 to 20 more modern than the rest; fol. 297 repeated; red chalk and yellow pigment used; numbers for only foll. I to 20 entered twice as usual; these foll. are followed by older foll. 'starting with the 15th number; so that foll. I to 14 missing; condition very good; the text and the commentary almost complete; the latter composed in Samvat 1689; extent of the text 2000 slokas, that of the vrtti 14255 and that of both 16255. Age. Not modern. Author of the commentary. Upadhyaya Bhavavijaya Gani, pupil of Mahopadhyaya Munivimala Gani of the Tapa gaccha.

Page #84
670.] 1.4 Malasutras Subject.- The text in Prakrit together with its elucidation in Sanskrit. Begins.--- (text) fol. 23 ANANI(ni)de( )sayare gurUNamuvavAyakArae iMgiAgArasaMpanne se viNIe tti vuccai' ,, -- (com.) fol. 2* sakAzAt zRNuta zravaNaM prati sAvadhAnA bhavaMtu anena vAkyena dharmamabhidhAtukAmena dhIdhanena pUrva zrotA'bhimukhaH kartavya iti sUcita etc. --- (com.) fol. 154deg zrIvimalaharSagaNimahopAdhyAyazrImunivimala[harSa] gaNiziSyopAdhyAyazrIbhAvavijayagaNi etc. ,, -- ( text ) fol. 345 ii pAukare buddhe etc., up to bemi as in ___No. 644. ,, -( com.) fol. 345 uttarAH pradhAnA adhyAyA adhyayanAni uttarAdhyAyA stAna bhavasiddhikAnAM bhavyAnAM saMmatAnabhipretAn itiH parisamAptau bravImIti prAgvaditi sUtrArthaH // 266 // iti zrI tapA 'gacchIyamahopAdhyAyazrIvimalaharSagaNimahopAdhyAyazrImunivimalagaNiziSyAzravo( ? )pAdhyAyazrIbhAvavijayagaNisamArthatAyAM zrIuttarAdhyayanasUtravRttau SaTtriMzamadhyayanaM saMpUrNam // 36 // dharmakalpadrumaskaMdhasyAsya zrataskaMdhasya niyuktikAro()pyevaM mAhAtmyamAha je kira bhavasiddhIA etc. iti saMpUrNA zrIuttarAdhyayanasUtravRttiH // cha / ahe // anaMtakalyANaniketanaM taM namAmi zaMkhezvarapArzvanAthaM / yasya prabhAvAharasiddhisaudha madhyAsta nirvighnamasau prytnH||1|| zriyA jayati dyutamaiMdavIM drAg mudA()obhivaMde zrutadevatAM taaN| prasAdamAsAdya yadayimeSA ttirmayA maMdadhiyA(s)pitene // 2 // satkIrtilakSmIparivarddhamAnaM zrIvarddhamAnaM jinraajmiidde| I This is the second verse.

Page #85
Jaina Literature and Philosophy [670. punAti lokaM surasArthazAlI yadAgamo 'gAMga' iva pravAhaH // 3 // tAcha(cchi)SyamukhyaH sakalarddhipAtraM zrIgautamo me zivatAtirastu / gaNI sudharmA ca satAM sudharmA vaho(s)stu viirprbhudttpttttH||4|| 'jaMbUdvIpe 'suragiri'riva 'caMdra'kulaM vibhAti tdvNshe| 'merauM' 'naMdanavanamiva tasminnaMdati 'tpaa'gcchH|| 5 // satra manoramasumanorAjivirAjI rarAja munirAjaH // zrIANadavimalagururamaratarunaMdana' ivoH // 6 // zuddhAM kriyAM dadhau yaH sudhAvratavratatimiva mruvRkssH| kalpataroH saurabhAmiva yasya yazo vyAnaze vizvaM // 7 // tatpadRgaganadinamaNirajAnaSTa janeSTadAnadevamANaH / zrIvijayadAnamanimaNiranaNuguNAdharitarajAnamANaH // 8 // zrImAn jagadgururiti prathitastadIya. paTTe sa hIravijayAhvayamUrirAsIt / yo'STaga(TA)pi siddhilalanAH samamAliliMga tasya(? spa) yeva digibhAMzca ydiiykiirtiH||9|| zramiAna(s)kabbaranRpAMbudharo(S)dhigamya zrIsUrinirjarapateriha yasya vAcaM / jaMtuvrajAnabhayadAnajalairanalpa raprINayat paTahavAdanagArja pUrva // 10 // tatpadRsUSaNamaNirgaNilakSmikAMtaH mArirbabhau vijayasena iti pratItaH yo'kabbarAdhipasabhechijapairyadIya gobhirjitairgururapi yutimAnamAni // 11 // vijayatilaka sUriH paTTaM tadIyamadIMdipan dinakara iva vyomastomaharaMstamasA kSaNAta / prasRmaramahAH padmollAsAvaho jaDatApaho vidAlatamahAdoSa kaptodayaH sudinazriyAM // 12 // dhiSaNAdhiSaNAdezyAprekSA giraH zravaso(6) sudhA adharitadharaM dhairya yasya kSamA(anukRtakSamA / /

Page #86
670.] 1, 4 Malasatras jagati mahimA hemakSoNIdharavayaso yazaH zazijayakaraM nAbhUtkasyAdbha(dbhutAya muniprbhoH||13||..... tIye paTTe sadguNagaNamaNizroNinidhayaH kSamApIyUSAMbhodhI nidhaya ucitaacaarvidhyH| svabhaktecchApUrtitridazataravo buddhiguravo jayaMti zrImaMto vijayivijayANaMdaguravaH // 14 // teSAM 'tapA'gaNapayonidhizItabhAsAM vizvatrayIjanamanoramakIrtimAsA vAgvaibhavAdharitasAdhusudhAsavAnAM rAjye ciraM vijayini vrativAsavAnAM // 15 // itv| ziSyAH zrIvijayAdidAnasuguroH siddhAMtabArAnidheH zrIkAMtAH prtiirthikvrjrjaapuNjekpaathodhraaH| pUrva zrIvimalAdiharSaguravaH zrIvAcakA jajJire yaivairAgyaratiM vitIrya viratiM cakre mamopakriyA // 16 // vineyAsteSAM ca pramRmarayazaHpUritAdazaH zrutaM dattvA maadRgjddjnmhaanugrhkRtH| mahopAdhyAyazrImunivimalapAdAH samabhavana bhavodanvanmajjajjananivahabohitthasadRzaH // 17 // vairaMgikANAmupakArakANAM vacAsvanAM kIrtimatAM kviinaaN| adhyApakAnAM sAdhayAM ca madhye dadhuH sadA ye prathamatvameva // 18 // teSAM ziSyANurimAM bhAvavijayavAcako()likhada vRtti svaparAvabodhavidhaye svalpadhiyAmapi sukhAvagamAM // 19 // nidhivasurasavasudhA 1689 miteta varSe zrI rohinnii'mhaapuryaa| so'syAH prathamAdarza svayameva prApayasiddhiM // 20 // guNagaNasuratarusuragirikalpaistasyAgrajaiH satIyazca / zrIvijayaharSakRtividadhe sAhAyyamiha samyak // 21 // anusRtya pUrvavRtti(ttI)likhitAyAmapi yadatra duSTaM syAt / tacchodhyaM mAya kRtvA kRpAM kRtIMdreH prakRtisaralaiH // 22 // zrIzaMkhezvarapArzvaprabhuprabhAvAtprabhUtazubhabhAvAt / AcaMdrAke(ke) naMdata vRttirasau modayaMtI jJAn // 23 // 7 A.S. N I...

Page #87
50 Jaina Literature and Philosophy [.670. zAMtiM tuSTiM puSTiM zreyaHsaMtAnasAkhyakamalAzca / vyAkhyAtRzrotRNAM vRttirasau dizatu maMgalaikagrahaM // 24 // prazastiH // sasUtrAyAmiha zlokasaMkhyA saMkhyAya nirmitA paMcapaMcAze zate dve sahasrANi ca SoDaza // 25 // zrIsUtragraMthAnaM 2000||vRttigrNthaayN 14255 // ubhayaM 16255 // zrIrastu etc. paMDinazrIzrIzrIbhAkticaMdragaNI tazi(cchi )jyapaMDitazrImayAcaMdagaNI tatAza( cchi vyapaMraMgacaMdagaNili. AtmArtha sthavAcana // Reference.-- Charpentier makes the following remark regarding this Ms. in his introduction to Uttaradhyayanasutra (p. 64):-- "one of the best written Mss. I ever saw." For description of additional Mss. having both the text and this commentary see B. B. R. A. S. vols. III-IV, p. 383 (Nos. 1414-1415). From the first four introductary verses given here we learn that this commentary is styled as vyakhya by Bhavavijaya, and there were several commentaries composed prior to this. uttarAdhyayanasUtra Uttaradhyayanasutra dIpikAsahita with dipika No. 671 ____1095. 1887-91. Size.- IoT in. by 5 in. Extent. - 389 +2+101 +I-I=492 folios; 13 lines to a page ; 44 ___letters to a line. Description.-Country paper rough, tough and white; Jaina Deva nagari characters; big, quite legible and very good handwriting ; borders ruled in two lines and edges in one, in red ink ; numbers for foll. I to 247 entered twice as usual; the rest numbered only once ; foll. 228 and 282 repeated :

Page #88
671.] I. 4 Malasutras ST separate foliation for adhyayanas 30 to 363; fol. 38th repeated; fol. 72 missing; fol. 46th wrongly numbered as 45; red chalk used; this Ms. contains the text as well as its commentary; practically complete ; condition excellent; a portion not required blurred out with black ink ( vide fol. 584); yellow pigment used at times (see fol. 2514); foll. 368 to 389 also numbered as I, 2 etc.; foll. 11 and 389 blank. Age.- Samvat 1907. Author of the coinmentary. - Laksmivallabha Gani, pupil of Upa dhyaya Laksmikirti Gani. Subject. - The text along with its explanation in Sanskrit. Begins.- ( text) fol. Ib __ saMyo( jo )gA vippamukkassa etc. , -(com.) fol. I zrIgurubhyo( bhyo) namaH // arhato jJAnabhAjaH suravaramahitA siddhisaudhasthasiddhAH paMcAcArapravINAH praguNagaNadharAH pAThakAzcAgamAnAM loke lokezavaMdyAH sakalayativarAH sAdhudharmAbhilInAH paMcApyete sadA(5)tAH vidadhatu kuzalaM vighnanAzaM vidhAya 1 zrIvIraM kSIrasiMdhUdakavimalaguNaM manmathAripraghAtaM zrIpArzva vighnavallIvanadalanavidhau visphuratkAMtidhAraM sAnaMda caMdrabhUtyAdRtavacanarasaM dattadRkkarNabodhaM / vaMde(5)haM bhUribhaktyA tribhuvanamahitaM vAGmanaHkAyayogaiH 2 uttarAdhyayanasUtravRttayaH saMti yadyapi jagatyanekazaH mugdhahRtsadanabodhadIpikA _dIpikAmiva tanomyahaM punaH3 prAptacAruvibhavo girAM giraH zrIgurozva vizadaprabhAvataH vAkti lakSmyupapadastu vallabhaH sajanA mayi bhavaMtu sAdarAH 4 . yugmaM etc. bhIsudharmA( ma )svAmI jaMbUsvAminaM vakti etc.

Page #89
52 Jaina Literature and Philosophy [671. Ends.-- ( text ) fol. 1000 g 175* etc., up to afh as in No. 644. , -(com.), ,,H aa: grpha(a) faffet gat AETTTT: Agurf bhavaMti yataH "zreyAMsi bahuvighnAni bhavaMti mahatAmapi" ityukteH 4 ___ iti zrImaduttarAdhyayanasUtrArthadIpikAyAM upAdhyAyazrIlakSmIkIrtigaNiziSyalakSmIvallabhagANavigacitAyAM jIvAjIvavibhaktinAma SadatriMzamadhyayanaM saMpUrNa // saM. 1907 varSe // Reference.- Charpentier says on p. 64 of his introduction to Utta radhyayanasutra that "this is very recent Ms. dated samv. 1907 ( = 1851 A. D.), but very well written ". For a notice of the Ms. having the text and this dipika see No. 1534 of Rajendralala Mitra's "A Catalogue of Sanskrit Mss. in the library of His Highness the Maharaja of Bikaner", Calcutta, 1880. P. E. Pavolini's Appunti di novellistica indiana (G. S. A. I. vol. XII), Firenze, may be also consulted. uttarAdhyayanasUtradIpikA Uttaradhyayanasutradipika 89. No. 672 1872-73 Size.-- 109 in. by 3 in. Extent.- 190 folios ; 14 lines to a page : 60 letters to a line. Description.- Country paper thin, rough and greyish; Jaina Devanagari characters with ES; small, legible and good hand-writing ; borders ruled in four lines in black ink; red chalk used ; numbers for foll. written twice, but in one and the same margin ; unnumbered sides have a disc in red colour, in the centre; the numbered, in each of the two margins, too; strips of paper pasted to the corners of foll. 126 to 174 ; some of the last foll. seem to be new ; some of the foll. slightly worm-eaten; condition good; complete ; this Ms. contains only the states of the Uttaradhyayanasutra.

Page #90
673.! 1.4 Malasatras Age.-- Fairly old. Author.-Not mentioned. Subject. - A commentary to Uttaradhyayanasutra, containing kathas. Begins.- fol. I arha // zrIuttarAdhyayanasya kiMcidarthaH kathAzca likhyante / iha 'uttarAdhyayanazabdArthaH / uttarANi pradhAnAni pUrva zrIzayyaMbhavaM yAvaccaturdazapUvi(vi)kAlo(le) AcArAMgAdanu paThyamAnatvena tato dazakAliko paThyamAnatvena zreSThAni adhyayanAni uttarAdhyayanAni / etc. Ends..- fol. 190" zrutajinAdibhiH prajJaptAn prarUpitAn anaMtaiga(ga )mairarthabhedaiH paryavaiH zabdArthaparyAya(yai): saMyuktAn adhyAyAn yathAyoga(gaM upadhAnAyucitakriyA tadanatikrameNa uttarAdhyAyAn gurUNAM prasAdA(t dhyAyeta uttarAdhyayanayogyatAyAM pAThadaH(1) pramattaH / etadadhyayanArthinA'vazyaM guravaH prasAcA ityrthH|| u // iti samAptA zrIuttarAdhyayanadIpikA samAptamitiH etc. uttarAdhyayanasUtradIpikA Uttaradhyayanasutradipika No. 673 634. 1892-95. Size.-- 104 in. by 4} in. Extent.-- 266 folios ; 13 lines to a page ; 40 letters to a line. Description.- Country paper thin and white; Jaina Devanagari characters with pRSThamAtrAs%3; big, quite legible and good handwriting; borders ruled in four lines in black ink ; foll. I to 152 numbered only once; most of the rest twice as usual; fol. 104 to 114 also numbered as 1, 2 etc. ; fol. 1* blank; edges of the first and the last foll. slightly worn out; yellow pigment used ; complete; extent 8600 Slokas ; condition good. Age.- Samvat 1683. Author.- Not mentioned. Subject.- A commentary to Uttaradhyayanasatra.

Page #91
Jaina Literature and Philosophy [673. Begins.- fol. I. OM ahana(aham) ___ zrIuttarAdhyayanasya kiMcidartha(:) kathAzca likhyate / / ) iha 'uttraadhy| yana' zabdArthaH uttarANi pradhAnAni pUrva zrIzayyaMbhavaM yAvaccaturdazapUrvikAle AcArAMgAdanu paThyamAnatvena tato dazakAlikorva paThayamAnatvena zreSThAni adhyayanAni uttarAdhyayanA(ni) nirvANakAle etc. Ends.- fol. 266 yathAyogaM yoga upadhAnAdhucitakriyA tadanatikrameNa uttarAdhyayAn gurUNAM prasAdAdadhIyat(ta) uttarAdhyayanayogyatAyAM paThedapramatto yenArthinA(s)vazyaM gurava(:) prasAdyA ityarthaH / iti samAptA zrIuttarAdhyayanadIpikA ||ch / jogavihIe etc. and jassA daDhatA etc., up to evaM bhAsaMti.. This is followed by the lines as under : 2 zrIrastu / saMjJayAMdhatamaso(5)pahAriNI satprakAzaparamopakAriNI u(tta )rAdhyayanadIpikA ciraM pradhyatAM munijanaini(? zci )raM // 1 / gacchAdhipazrIjayakItisUrI zvaropadezazravaNena dU(ha)STAH sadbhAvasArAH paramArthahetu malIlikhat pustakaratnametat 2 SaDazapiti zatAnyA(nya )trAnuSTupa saptatistathA pratyakSaraM nirIkSyaivaM graMthamAnaM vinizcitaM // 3 graMthAyaM 8670 // zrI saMvat 1683 varSe bhAdrapadavadi 4 dine badhe // zrIrastu etc. uttarAdhyayanasUtra bAlAvabodhasahita Uttaradhyayanasutra with balavabodha No. 674 259. 1883-84. Size.-- Iolin. by.4t in.

Page #92
674.1 I.4Malasatras 55 Extent.- 233 - 3 = 230 folios ; I lines to a page; 38 letters to a line. Description.- Country paper thin and grey ; Jaina Devanagari characters with pRSThamAtrAs; quite bold, big, clear, uniform and good hand-writing; borders ruled in four lines in black ink; foll. I, II and 212 missing; edges of the first and the last few foll. slightly damaged; dandas or vertical lines in red ink ; numbers for the adhyayanas marked in the left-hand margin, whereas those for foll. as usual in the right-hand margin ; red chalk used; foll. 215 to 225 more or less worm-eaten ; condition on the woole good; this Ms contains the text and its balavabodha as well; the text practically from the second hemistich of the fourth verse of the first chapter and the balavabodha from the 4th. Age.- Samvat I575. Begins.- ( text ) fol. 2* vvso| evaM dussIlapaDi( Da )NIe muharI nikkAsajjaI / 4 kaNakuMDagaM caittANaM viTuM bhuMjai sUyare / evaM sIlaM caittANaM dussIle ramaI mie / 5 etc. ,, - ( bala - ) fol 2a jima......jihAM jAi tihAM thakI kADhIi / eNa dRSTAMti ima dusIla anAcArI // etc. Ends.- ( text) fol. 233b iti(ya) pAukare buddhe NAyae pazinabbue / chattIsa uttarajjhAe bhavasiddhIya saMmae tti bemi / 73 (273) / , - ( bala0 ) fol. 233deg e chatrIsa zrIuttarAdhyayana vimala nirmala guNi karI jayavaMtA / je mAhaMta sakalazAsana mAhi AcArya upAdhyAya kRta bAlAvibodha / tehanai anasAriMi e bAlAvibodha sAdhu sAdhvI e vAcyamAna huM. tu suSa zreya kalyANa heti hui / chaH // graMthAnaM 6250 // chaH // // saMvata(ta) 1575 varSe pauSavadi 9 ravau likhitaM zrIgaMdhAsAMdiresAdasiMgha 2|(?raa)jstpNcaaynnptthnaarth[ : ] // //

Page #93
56 Jaina Literature and Philosophy 674. Reference. For Mss. having the text and anonymous balavabodhas see Limbdi Catalogue Nos. 276, 280 and 281. No. 280 records only one Ms., and that is dated as Samvat 1792, where as No. 281, three, out of which two are dated as 1594 and 1764 respectively. uttarAdhyayanasUtra TabbAsahita Uttaradhyayanasutra with tabba 160. 1871-72. No. 675 Size.-- 10 in. by 4 in. Extent.-( text ) 263 folios ; 4 to 17 lines to a page ; 30 letters to a line. , - ( tabba ) 263 folios ; 6 lines to a page ; 59 letters to a line. Description.- Country paper sufficiently thick and white; Jaina Devanagari characters with occasional HATETS; bold, clear, and elegant hand-writing ; this Ms. contains both the text and its explanation in Gujarati; four lines of the text written on each side in big hand; over each line, there is the corresponding explanation written comparatively in much smaller hand-writing: there is only text on foll. 6 to 65; the space left blank for the corresponding explanation; borders ruled in three lines in red ink ; foll. 1 and 263 blank; from the 66th fol. onwards the hand-writing for the text is still bigger than before and the paper grey ; numbers for foll. entered in two different margins on one and the same side; over and the above the text, this Ms. contains 4 verses of the rafft wherein the importance of this work is pointed out; condition very good ; both the text and the explanation complete, Age.- Samvat 1695.

Page #94
575. I. 4 Malasatras Author.- A pupil of Parsvacandra and a devotee of Ajitacandra. Subject.- The text along with its explanation in Gujarati.. Begins.- ( tex1 ) fol. I aiM namaH saMjogA vippamukkassa etc., as in No. 644. , - (com. ) fol. 10 varddhamAnaM jinaM natvA pArzvacaMdraM ca madguruM ajitacaMdramunIMdaM ca TabArtho likhyate mayA 1 ___ pUrva saMyoga mAtAdikano pazcAt saMyoga sva(zvasurAdikano athavA bAhya saMyoga dravyAdikano abhyaMtara saMyoga viSayAdikano etc. Ends..- ( text ) fol. 2622 ii pAukare buddha nAyae parinivvue chattIsaM uttarajjhAe bhavasiddhIya sa(saM)mae - tti bemi 270 36 iti jIvAjIvavibhattiajjhayaNaM 36 atha niyukikAra etadvaMthamAhAtmyamAha je kira bhavasiddhIyA parittasaMsAriyA ya je bhavA ti(te) kira paDhaMti ee chattIsaM uttarajjhAe 1 tamhA jiNapaNNate aNaMtagamapajjavehiM saMja(jutte ajjhAe jaha(hA)jogaM guruSpasAyA ahijjijjA 2 jogavihIi va(vi)hittAe ehiM jo lahai suttaM(tta) atdhaM vA .. bhAsei bhaviyajaNo so pAvai nijjaraM viulaM 3 jassADhattA ee kahA vi samappaMti vidhe(ggha)rahiyassa so lakkhijai bhanyo puvArasI eva bhAsaMti 4' cUliyA sammattA iti zrIuttarAdhyayana 36 samApta viNayaparIsahacauraMgijjhaM saMkhaakAmakhuDDaniggaMthaM urabbhI kAvaliyaM namipavajjA dumapattaM 1 bahussuyahariesijjaM cittasaMbhUijha(jjha)yaNa usuyAraM sabhikkhU baMbhaguttI pAvasamaNijja saMjjaijaM 2 miyAputtaM niyaMThaM samuddapAlIyaM nAma rahanemI kesIgoyamapavaNasAyara janaijjA samAyArI 3 ISee pp. 10 and IL. . U.L.P.I

Page #95
Jaina Literature and Philosophy [615. SP khalukiyaM sivamaMggaMgaisammataparakkama sugamaM taM(ta)vamaggaM caraNavihI pamAyaThANaM ca kramayapaTTI 4 lesANagAramaggaM jIvAjaviAvibhatti chttiisN| jiNagahaharamuNibunne uttarAyaNe paNivayAmi 5 // cha // saMvat 1695 varSe mAgraseramAse kRSNapakSe 11 dine laSitaM. Ends.- (com.) fol. 2624 chatrIsa uttara pradhAna vinayazrutAdika adhyayana bhavya jIva jeha chai tehanai eha 36 uttarAdhyayana samata vAlhA hui eha vacana satya jANichau ehavau sudharmasvAmI jaMbU pratii kahai 270 jIvAjIvavibhatI adhyayana atha kAu chai mii lezamAtra thakI etc., up to eha uttarAdhyayamanI cUlikAnau artha kahyauM miiM iti zrIuttarAdhyayana sUtraTabArtha 36 samAptaH / cha / graMthA0 sarvato(5)pi 1000 mubhaM bhavatu. Reference.-- For Mss. having the text and an anonymous tabba see Limbdi Catalogue No. 291. Its Nos. 292, 293 and 283 refer to Mss. having the text and the tabbas by Megharaja Vacaka, Ajicandra Suri and Dharmamandira Upadhyaya respectively. The tabba in the last case is styled as Makaranda. uttarAdhyayanasUtra Uttaradhyayanasutra TabbA tathA kathA sahita with tabba and kathas 161. No. 676 1871-72. Size.- 94 in. by 4 in. Extent.-- 316 + 1 = 317 folios ; 14 lines to a page ; 38 letters to a line. ,, - (tabba ) 317 folios; 17 lines to a page; 48 letters to a line. Description.- Country paper thin and white; Jaina Devanagari characters with occasional T ES; the text written in a bigger. hand as:compared with the tabba ; legible and good

Page #96
676.] Age. -- Samvat 1761. 1. 4. Malasutras hand-writing; borders ruled in three lines and edges in one, in red ink ; numbers for foll. entered twice as usual ; fol. 6th repeated; fol. 1a blank; so is the fol. 316b; yellow pigment used; condition very good; both the text and the tabba complete ; extent of the text 2000 slokas, that of the tabba 7000, that of the kathas sooo and total extent 14000 slokas. Author of the tabba. Pasacanda ( Sk. Parsvacandra ). kathas. Padmasagara. Subject. The text together with its explanation in Gujarati and stories in Sanskrit. " l "" 29 Begins.- ( text ) fol. rb - "" wr saMjogA vippakkassa etc. ( tabba ) fol. rb namvA zrI arha namaH // prathama zrIuttarAdhyayana graMthanuM zabdArthaH kahIi chi || zrImahAvIrasiM ThA ( ? ) prathama zrIAcArAMga bhaNIniM pachi / uttarAdhyayana bhaNatA etc. saMjoganu vipramukta je sAdhu te saMyoga bihuM prakAre eka dhana dhAnyAMdika bIja rAgAdika kaSAyAdika etc. ( kathas ) fol. 24 zrIsadgurubhyo namaH / / praNamya zrImahAvIraM namrAkhaMDalamaMDalaM / Arabhyate kathAH kartumuttarAdhyayanasthitA ( : ) // 1 // uttarAdhyayanara (bRha ( draTa ) ttigatAH kathA ( : ) saMskRtAH kartumArabhyate // etc. Ends. --- ( text ) fol. 315b ii pAukare etc., up to bemi as in No. 644. This is followed by jIvAjIvavibhatti ajjhayaNaM sammattaM // 36 // cha iti zrIuttarAdhyayanazrutaskaMdha saMpUrNa // cha // yAdRzaM etc. saMvat 1761 varSe kArtika vadi 14 bhome laSitaM // lekhakapAThakayoH zubhaM bhavatu // graMthAgra sUtra 2000 // cha // etc. - * ( kathas ) fol. 224 paMcaviMzAdhyayane vijayaghoSacaritaM lezato likhyate / 'bANArasyAM' nagaryo dvau bibhau bhrAtarau jayaghoSavijayaghoSoM

Page #97
Jaina Literature and Philosophy 676. abhUtAM etc. paMcaviMzAdhyayane kathA 98 samAptAH // etAvatA uttarAdhyayanabRhadvRttigatAH prAkRtakathAH sarvA (a)pi saMskRtA(:) kRtAH paMDitazrIpadmasAgaragaNinA kRtAH // -(tabba ) fol. 316* etalI jIvAjIvavibhAtta nAmA adhyayana chatrIsamArnu Tabu iti zrIarthavivaraNa saMpUrNa havai 36 // iti zrIuttarAdhyayanazrutaskaMdhaH samApta // sUtrasaMkhyAgAthAsaMSyA zloka 2000 pAsacaMdasUrikRta Tabu tenAnI) zlokasaMkhyA 7000 kathA padmasAgarI zloka 5000 evaM miline(te) sarvazlokasaMSyA 14000 jehavu pustaka etc. , saMvata 1761 varSe zAke 1626 pravarttamAne mArgaziSa mAse zurUpakSe caturthI 4 ravivAsare lipIkRtaM / laSanArAni bhaNanArAni sAMbhalanArAni zreya kalyANa hayo / jJAnasAgarajInI parati cha sahI 3 uttarAdhyayanasUtra akSarArthalavalezasahita Uttaradhyayanasutra with aksararthalavalesa No. 677 1096. 1877-91. Size.-94 in. by 44 in. Extent.-- 192 folios ; 12 lines to a page ; 34 letters to a line. Description.- Country paper thin, smooth and white ; Jaina Deva nagari characters with pRSThamAtrAs; bold, big, clear, uniform and good hand-writing; borders ruled in three lines in red ink ; red chalk and yellow pigment used; foll. I. and 192b blank; every fol. numbered twice, on one and the same side but in different margins; this Ms. contains both the text and its explanation mostly in Gujarati ; complete ; a small strip of paper pasted to the first fol.; condition very good. Age.- Not very old. Author of the balavabodha.-Not mentioned.

Page #98
61 677: 1 Subject. The text along with its explanation styled here as balavabodha, too. Begins. -- ( text ) fol. rb "" saMjogA vippamukkassa etc., as in No. 644. -- ( balavabodha ) fol. 1 bhikSoraMhaM vinayaM prAduH kariSyAmi / AnupUrvyAmeva me ma(ma) kathayataH zRNuta bhikSu mahAtmAnai vinayamA mArga pragaTa karisuH AnupUrvI anukrama majhanai kahitAM hUMtAM sAMbhalu etc. Ends. -- ( text ) fol. 1924 i. 4 Malasatras iti (i) (pA) ukare budhe (ddhe ) NAyae parinivbuDe (e) chattIsaM uttrjjhaae| bhavasiddhi (ddhI )ya saMbu ( bu ) De ti 82 (282 ) bemi // - ( balao ) fol. 1922 iti etAn padvatriMzat uttarAdhyAyAn / uttarAdhyAprAdu ( )tya kAMzvit arthataH kAMzvit sUtrataH prakAzya budhaH kevalI jJAtajo jJAtaputraH zrIvarddhamAnasvAmI parinivRtaH nivrvANaM prAptaH // kiMviziSTAn uttarAdhyAyAn bhavisiddhikA bhavyajIvAsteSAM saMmatAna iSTAn // 82 // iti SaTtriMzata / zrIuttarAdhyayanAkSarArtha (rtha) lavalezaH " cha // iti zrIuttarAdhyayanabAlAvibodha saMpUrNaH // cha // yAdRzaM pustake etc. This is followed by two verses, one in Gujarati and one in Sanskrit as under : re prAMNI suNi bappaDA / jima nArInUM dhyAMna / tima kari paramezvara taM / jima lAbhai svargavimAna // 1 // kalyANamastuH // gItazAstravinodena / kAlo gacha (ccha ) ti dhImatA ( m ) / visanneneha mUrSANAM / nI( ni )dvAyA kulaheni ca // 2 // cha // zrIH // zru // cha //

Page #99
62 uttarAdhyayanasUtra bAlAvabodha tathA kathA sahita Description. Jaina Literature and Philosophy No. 678 Size. 1og in. by 41 in. Extent.- 254-3=251 folios; 15 lines to a page; 31 to 50 letters to a line. Bak Age. Not quite modern. Subject. - dw Uttaradhyayanasutra with balavabodha and kathas 8, 1869-70. Country paper rough, white and not very thin Jaina Devanagari characters; bold, big, uniform, legible and elegant hand-writing; borders ruled in four lines in red ink, and edges, in two; this Ms. contains the text, its explanation in Gujarati and narrations in Sanskrit illustrating the prescribed rules; this Ms. seems to be incomplete; for, the text contains only 22 adhyayanas and the illustrations up to the 23rd; the 24th adhyayana requires no illustrations and the 25th has only one small illustration needed; later on, no stories are to be found so far as the remaining adhyayanas are concerned; that may be the reason why this work ends here; numbers for foll. written in two different margins on one and the same side; foll. 113 to 115 missing; fol. 127b kept blank; fol. 6 slightly torn; fol. 245 torn; condition fair. [ 678. Begins. (text) fol. 2a fene #2 | saMjogA vipakSas as in No. 644. Stories illustrating the gathas of Uttaradhyayanasutra along with a Gujarati explanation of these gathas. - - ( balavabodha ) fol. 1 zrIgurubhyo namaH // gra etc., as in No. 684. This first verse is followed by the lines as under : uttarAdhyayana kahatAM syo artha zrImahAvIranaI bAraha // AcAraMga bhapani pachai uttarAdhyayana bhaNatA etc.

Page #100
679.] 1. 4 Malasutras Begins- ( kathas) fol. 2' bIjI gAthAyAM kUlavAlakakathA // 1 // yathA __ ekasya AcAryasya kSullako'vinItaH / tasya AcArya zikSArthe tADayati etc. Ends.- ( text ) fol. 2490 evaM karaMti saMbuddhA / paMDiyA pavipakkhagA // viNi(ya)dRti bhogesu // jahA se( so) purisottamo ti(ti) bemi // 51 // __ rahanemijjhaM samattaM // ,,- (balavabodha) fol. 249" iti zrIrahaneminAmAdhyayana bAvIsamAno artha TabA mAtra graMthaprakAra ihAM likhyo saMpUrNa 22 .. -- fol. 250 ( kathas ) zakrAdibhistatraiva hita iti / evaM prsNgtH| zrIpArzvacaritrava(ma)bhidhAyatatpraziSyazrIkesicaritrasaMbaddhamidamadhyayanamiti / trayoviMzatitamadhyayanakathA samAna zrI zrI ||shrii| uttarAdhyayanasUtra Uttaradhyayanasutra (adhyayana 18-21) ( Adhyayanas XVIII-XXI) TabbAsahita with tabba 463. No. 679 1882-83. Size. -- 101 in. by 41 in. Extent.- (text) is folios ; 6 lines to a page; 48 letters to a line. , -(rabba),, , , I3 to 16 lines to a page ; 65 to 70 letters to a line. Description.-- Country paper thick, rough and white; Jaina Deva nagari characters with occasional pRSThamAtrAs; the text written in a bigger hand as compared with the tabba which is written in a very small hand; legible and good hand-writing; borders ruled in two lines and edges in one, in red ink; this Ms. contains the text of chapters 18 to 21 and the corresponding tabba ; foll. numbered in the Left-hand margin only ; red chalk used ; both the text and

Page #101
64 Age.-- Old. Author of the tabba.-- Not mentioned. Subject. Jaina Literature and Philosophy [ 679. the tabba complete so far as 18 to 21 adhyayanas are con cerned ; condition very good. " Begins.-- ( text ) fol. r aiM The text along with its explanation in Gujarati. The former deals with the life of Samjaya, that of Mrgaputra, characteristics of a true saint and the life of Samudrapala. Each of these topics occupies one adhyayana. dr 'kaMpille' nayare rAyA udinnabalavAhaNe nAmeNa saMjaya nAma migavaM ubaniggae 1 etc. - ( tabba ) fol. r' 'kaMpilya' nAmA nagaranai viSaha rAjA desAdhipati udaya Avyau bala caturaMga sainya athavA zarIranau bala vAhana etc. Ends. -- ( text ) fol. 15 * duviha ( haM) khaveUNa ya punnapAvaM niraMgaNe savvao vippamukke / taritA samuhaM ca mahAbhavohaM samuddapAle apuNAgamaM gai ( ? e ) // tti bemi 24 iti zrIsamuddapAliyajjhayaNaM samattaM 21 --( tabba ) fol. 15 ehabuM huM kahuM sudharmasvAmi jaMbU prataI ima kahai 24 // iti zrIsamudrapAlIya adhyayananar3a artha lezamAtra thakI jANiva u saMpUrNa kAuM 21 // Reference.-- See No. 644. mahAniryanthIyAdhyayana ( mahAniyaMThijjajjhayaNa ) TabbAsahita No. 680 Size, 19++ in. by 4g in Mahanirgranthiyadhyayana (Mahaniyanthijjajjhayana ) with tabba 676. 1899-1915.

Page #102
680.1 Extent. - 9 folios; 5 lines to a page ; 32 letters to a line. Description. Country paper thin and greyish; Jaina Devanagari characters ; bold, clear and good hand-writing; borders ruled in three lines in red ink; edges of the first fol. slightly damaged; condition tolerably good ; yellow pigment used ; fol. 9b blank ; this Ms. contains the text and its .explanation in Gujarati known as tabba; both complete. Age.-- Samvat 1761. -- 1. 4 Malasatras Author of the tabba. -- Not mentioned. Subject. This twentieth chapter of Uttaradhyayanasutra along with its explanation in Gujarati deals with the life of Anathi muni, with whom Srenika discussed why he had renounced the world. This chapter throws much light on the rules and regulations meant for a Jaina saint. So it is named as Mahaniyanthijja (Mahanirgranthiya). Begins.-- ( text ) fol. 1b Ends. -- ( text ) fol. 9a siddhANaM namo kiccA saMjayANaM ca bhAvao / atthadhammagai(I) taJcaM aNusaTTi (TTi) suNeha me / 1 // etc. 65 ( tabba ) fol. rb siya arihaMta / siddhanaI na0 namaskAra ki0 karInahaM saM0 saMyatI AcArya upAdhyAya sarva sAdhunaI bhAvathI etc. iyaro viguNasamiddho tiguttigutto tidaMDavirao ya / vihaga iva vimuko viharai vasuhaM vigayamoho / tti bemi // 60 // iti zrI anAthi / saM0 1761 poSa zu0 5 budha paM0 zrIjJAnavijayatacchiSya paM0 zrIvRddhivijayazi : mahimA vijaya bhrAtA deveMdrAvijaya lipIkRtA /

Page #103
66 Jaina Literature and Philosophy [ 681. uttarAdhyayanasUtraniyukti (uttarajjhayaNasuttanijjutti) Uttaradhyayanasutrariryukti ( Uttarajjhayanasuttanijjutti) No. 681 1094, 1887-91. Size.- 104 in. by 41 in. Extent.-- 13 folios ; 17 lines to a page ; 52 letters to a line, Description.- Country paper thin, rough and greyish ; Jaina Deva nagari characters; small, legible and fair hand-writing; borders ruled in two lines; yellow pigment and red chalk used; numbers for foll. entered only once, and that, too, in the right-hand margin ; some of the foll, slightly worm eaten; condition good; complete ; 600+4=604 verses in all, Age.- Pretty old. Author.- Bhadrabahusvamin according to the vstti on Dharma ghosa's Rsimandalastotra etc. Jarl Charpentier does not endorse this opinion especially because he says that in v. IIO Sthulabhadra, the successor of Bhadrabahusvamin is styled as bhagavam-Thulabhaddo ? and such a thing cannot have been said by his far older predecessor Bhadrabahusvamin. For other objections raised by him see pp. 48 and 49 of the introduction to Uttaradhyayanasutra. Subject.- A commentary in verses in Prakrit, elucidating Uttara. dhyayanasutra. From the two verses 3 of Avasyakasutraniryukti we learn that this is the 3rd niryukti out of ten. 1 For the meaning of the word nijjutti' see my article "The Jaina Commentaries " (pp. 295-296 ) published in the " Annals of the Bhandarkar Oriental Research Institute " ( vol XVI, pts. III-IV). 2 See p. 67. 3 They are as under : " Avassayasma dasakAliyassa taha uttarajjhamAyAre / Erote agli alaggire JET CHIT 116 11 kappassa ya nijjuttiM vavahArasseva paramaniuNassa / sUriyapaNNattIe vocchaM isibhAsiyANaM ca // 83 // "

Page #104
681.1 1. 4 Malasutras Begins.- fol. IOM namaH kayapavaNappaNAmo bo( vo )cchaM dhammAAogasaMgahi / uttarajjhayaNaNuogaM gurUvaesANusAreNaM // 1 etc. viNayasuaM ca parIsaha / cauraMgijja asaMkhayaM ceva / akAmamaraNaM NiaMThijjaM / urabhaM kAvilijjaM ca / 15 / NamipanvajjA dumapattayaM ca / bahusuabu(pu)jjaM taheva hariesaM / cittasaMbhUha usuArijjaM sabhikkhu samAhiThANaM ca / 16 / pAvasamaNijja taha saMjaijja / miacAriA niaNtthijjN| samuddapAliajjaM rahanemiyaM / kesigoamijjaM ca / 17 / samiIo janmaijjaM sAmAyArI tahA khluNkijjN| mokkhagai(I) appamAo tava caraNa pamAyaThANaM ca / 18 / kammappagaDI lesA bodha(ddha)ve khalu aNagAramagge a| jiivaajiivvihttii| chattIsaM uttarajjhayaNA / 19 / - fol. I' bhagavaM pithUlabhaddo tikkhaM ca kammiUNa puNa chinno aggiAsahAe vuttho cAummAse na puNa dtttto(ddho)| 12 etc.. . Ends. - fol. 136 bhAvaMmi vibhattI khalu NAyavvA chavihami bhAvami / ahigAro etthaM puNa davvavibhattIe ajjhayaNe / 1(601) / jIvAjIvavibhattInijjuttI sammattA // 36 // etc. tamhA jiNapannatte aNaMtagamapajjavahiM saMjutte / ajjhAya jahAjogaM guruppasAyA ahinjijjA // 4 // iti zrIuttarAdhyayananiyukti: saMpUrNA // Reference.- For a survey of the niryukti see Jarl Charpentier's introduction to the Uttaradhyanasutra (p. 48 ) and the following. ___ In connection with this Ms. there it is said on p. 63 by him that "the hand-writing reminds me slightly of that in the Berlin Ms. No. 1341. 1 See p. 57

Page #105
Jaina Literature and Philosophy 1 682. uttarAdhyayanasUtra Uttaradnyayanasutra(adhyayana 3). (Adhyayana III). niyukti niryukti TIkAsahita with tika 1337. No. 682 1891-95. Size.-- 104 in. by 43 in. Extent.-29 - I = 28 folios ; II lines to a page ; 34 to 40 letters to a line. Description.-Country paper thin, rough and greyish; Jaina Deva nagari characters with occasional Centers; sufficiently big, clear and good hand-witing ; borders ruled in four lines in black ink ; red chalk used; fol. 296 blank; a strip of paper pasted to fol. 29deg; condition on the whole good ; fol. I9th missing; otherwise complete. Age.- Old. Subject.-- Ten typical narratives in verses in Sanskrit pointing out the difficulty of attaining birth as a human being. These are based upon the 16th gatha or the 19th of the 3rd adhyayana 'of Uttaradhyayanasutra. Begins.- (text) fol. I'e cullaga 1 pAsaga 2 dhanne 3 jue 4 rayaNe ya 5 sumiNa 6 cakke ya 7 camma 8 juge 9 parimANa 10 dasa guyalaMbhe // 1 // . tatra cullagazabdena dezabhASayA bhojanamucyate // tatra dRSTAMte zrIbrahmadattacakrikathA // tathAhi / sAketasvAmicaMdrAvataMsasya tanayo vrataM / / purA' 5)dAnmunicaMdrAkhyo muneH sAgaracaMdrataH // 1 etc. ,, - com.) fol. 140 api nAma se jIyeta kadAcidaparairnaraiH / manuSyakAtparibhraSTo mAnuSyaM labhate nanu // 86 / see D. C. J. M.; vol. XVII, pt. I, p. 102 I For this verse with variants (No. 108).

Page #106
682.1 1. 4 Malasutras iti pAzakadRSTAMtaH // cha / adhunA dhAnyadRSTAMtaH // etc. Begins --fol. ISrAjyaM labheta mAnuSyaM na mAnuSabhavacyutaH // iti tdRssttaaNtH|| cha / atha ratnadRSTAMtaH // etc. ratnAni na punaH prApuH / prApnuvaMtyapi tAnito devatAdiprasAdena mAnuSyaM tu suda(durlabhaM // 7 // atha svapnadRSTAMtaH // etc. ,, - fol. 25 kadApi prekSate svapnaM so'pi devaniyogataH / / na tu jaMturmanuSyatvabhraSTo mAnuSyakaM punaH // 50 iti svapnadRSTAMtaH // cha // // atha cakradRSTAMtaH // etc. , - fol. 28b yathA sudurvidhaM cakrASTakaMThava()snu durlabhaM / nRjanmani vya(?)tepyAyamaparaM tu na labhyate // 180 iti cakradRSTAMta ||ch / / , - fol. 29 pracaMDavAtIcibhiH preritA sA kathaM punaH yugena labhate yogaM jaMtuna tu janu nRNAM // 3 // atha pari(ra)mANa(Na)dRSTotaH / / etc. Ends.--(com.) fol. 298 duSkarmavazato bhraSTastathA mAmuSajanmanaH / nistuSaM mAnuSaM janma janmI na labhate punaH // 5 iti manuSyabhavasya durApatA bahunidarzanadarzanataH kRtaaH| samadhigamya ca samyagidaM budhAH saphalatAkalitaM kalayaMtu taM // 6. iti manuSyabhavasya dasa(za)dRSTAMtakathAnakaM saMpUrNa samAptaH ||ch||

Page #107
70 faina Literature and Philosophy 1 683. ziSyahitA Sisyahita (uttarAdhyayanasUtra (UttaradhyayanasutraTECER) brbadvrtti ) 258. No. 683 1883-84. Size.-- 114 in. by 43 in. Extent.-- 392 + 3 -- 3 = 392 folios ; 15 lines to a page ; 53 letters to a line. Description.-- Country paper thin, rough and greyish ; Jaina Deva nagari characters with AES; sufficiently big, quite legible and elegant hand-writing ; borders ruled in four lines in black ink ; 'red chalk used; numbers for foll. entered only once, and that, too in the right-hand margin ; foll. I to 8 numbered twice in the right-hand margin ; foll. 18, 26 and 29 repeated; foll. 53 to 56 bracketed together ; a piece of paper of the size of a fol. pasted to fol. ra; fol. 1a blank; fol. 392 equally so, except that the title GFTIETT(a) Tia: and its extent written on it; edges of the first and the last foll. slightly worn out; condition on the whole very good ; almost half the portion of fol. 1b blank; it appears that the scribe wanted to decorate it with an illustration propably of a Tirthamkara ; complete ; extent 18000 slokas; the entire work is divided into 36 sections. Age.-- Samvat 1667. Author.-- Santi Suti, pupil of Sarvadeva of the Tharapadra gaccha. For his life see Prabhavakacaritra (pp. 216-224 )' As stated therein (pp. 236-237 )2 he revised Tilakamanjari. He attained svarga in Samvat 1096. See C. M. Duff's " The Chronology of India" (p. 120), Westminster, 1899. Subject.- A very big commentary explaining Uttaradhyayanasutra and its niryukti. The nihnava-vada is very beautifully treated here. Its treatment seems to surpass even the ex position given in the Visesavasyaka-bhasya. Prior to the I See the introduction (pp. 79-81 ) of the Gujarati translation of Prabhavakacaritra. 2 See Prabhavakacaritra (p. v. 201-202.

Page #108
683.] 1. 4 Malasatras 71 composition of this Sisahita also known as Paiya tika? there was already exegetical literature consisting of curni and several vsttis. The colophon given at the end of Sisyahita is summarized by Charpentier in his introduction (pp. 53-54) to Uttaradhyayanasutra.. Begins.-- fol. Ib namo'hate // zivadAH saMtu tIrthazA vighnsNghaatghaatinH| bhavakUpoddhRtau yeSAM vAk varatrAyate nRNAM // 1 etc. adhyayanAnAmeSAM yadapi kRtAzcUrNivRttayaH kRtimiH / tadapi pravacanabhaktistvarayati mAtra vRttividhau // 5 // iha khala sakalakalyANanibaMdhanaM jinAgamamavApya vivekinavaM vivecanIyaM etc. Ends.-fol. 391 guruprasAdAditi cAbhidhAnamadhyayanArthinA'vazyaM guravaH prasAdanI yAstadadhInatvAttasyeti khyApanArthamiti gAthArthaH ||ch|| iti (6) parisamAptI bravImIti pUrvavat / ukto(5)nugamaH saMprati nayAste(5)pi prAgvadeva ||ch / ityu. tarAdhyayanaTIkAyAM ziSyahitAyAM jIvAjIvavibhaktinAmaka patriMzamadhyayana samAptamiti // cha // etc. Asti vistAravAnA guruzAkhAsamanvitaH // AsevyA(byo) bhanyasArthAnAM zrI kauTika'gaNadrumaH // 1 taduttha vaira 'zAkhAyAmabhUdAyAtizAlinI / vizAlA pratizAkheva zrI caMdra'kulasaMtatiH // 2 // tasyAzvotpadyamAnacchadaniva(ca)yasadRkkavA(? kA )yakarNA(rNAnvayottha- zrI thArApadra'gacchaprasavata(?bhoralasaddhamakiMjalkapAnAt / zrIzAMtyAcAryabhRgo yadidamudagiransanmadhu zrotrapeyaM tadbho bhavyAstridoSaprazamakaramato gRhyatAM lihyatAM ca // 3 // . .. zrI bhillamAla'kulazekharazAMtyamAtya__ nirmApitA (5)nnhilpaattk'caitygehe| bhrAtRvyabhUpakamahattamakAritAru sauvarme(? moramyakalazAndhayamUrtakI? // 5 // zrIzAMtisUrirakarod guNasenari. vAcottarAdhyayanazAsanAttamenAM prakhyApitA tadanu tadguNasarvadeva __....gunngnnksushissyvrgH||6 I See Peterson III, p. 63. 2 See this very page v. 5 and p.72 (v.7).

Page #109
72 Jaina Literature and Philosophy [683 siddhAMtasvAdhyAyavyasanatayA(5)nyAsa vRttiSu satISu / padviraciteyamaparA tatsadbhirmarSaNIyaM me // 7 pasyAbhUd gururAgame guNanidhiH zrIsarvadevAhvayA __ sUrIzo(5)bhayadevamUriracitakhyAtapramANo(s)pi ca tasyeyaM sugurudvayAdadhigata(? tA)dalpAtmAvidyAguNa pratyAkhyAya ciraM bhuvi pracu(ca)ratu zrIzAMtisUreH kRtiH // 8 // zrI / / etc. saMvata 1667 varSe mahApadi 14 dine 'tapAgacchAlaMkArabhaTTArakapuraMdara'savAIjamaguru'birudadhArakazrIvijayasenasUri( rI )zvaratAtsa(cchi )dhyamahopAdhyAyazrInayavijayagaNitatsi(cchi)vyapaMDitazrIkItivijayagaNibhiH zrI Reference.- Published. See No. 644. For description of addi tional Mss. see Weber II, pp. 126-157, 311-466 ( Nos. 1907-1910). On p. 440 of R. G. Bhandarkar's "Report on the search for Sanskrit Mss. in the Bombay Presidency during the year 1883-84, Bombay, 1887," an extract of the prasasti is given, whereas on p. 129 its substance is given. See also his Report for 1884-85, p. 277. Consult E. Leumann's "Die alten Berichte von den Schismen der Jaina " (Indische Studien vol. XVII, pp. 44 and 97, Leipzig, 1885. J. Kirste's Hamsakhyayika (W. Z.K. M. vol. XVIII, pp. 130-131), Wien, 1904 may be consulted for ascertaining its bearing on this commentary. uttarAdhyayanasUtra UttaradhyayanasutrabRhadvRttigatakathA brhadvrttigatakathapratisaMskRta pratisarskrta No. 684 245. A.1882-83. Size.-98 in. by 41 in. Extent.- 73 folios ; 18 lines to a page ; 57 letters to a line. Description.- Country paper somewhat thin and greyish; Jaina Devanagari characters with qatats; hand-writing neither too big nor too small, clear, uniform and good; ink faded at times; borders ruled in two lines in red ink;

Page #110
684] 1. 4 Malasutras 73 red chalk and yellow pigment used; foll. numbered twice on one and the same side but in different margins; a piece of paper of the same size as the fol. pasted to the first fol.; same is :he case with the last fol.; small bits of paper pasted to fol. I54; the original I9th fol. missing; another in different hand and on a white paper is substituted in its place; condition good; complete; composed in Samvat 1657. Age.-- Samvat 1799. Author.- Padmasagara Gani, pupil of Vimalasagara Gani. Subject.- Sanskrit rendering of the narratives given in Prakrit in Sisyahita, the brhadvitti on Uttaradhyayanasutra. Thus this work simply deals with stories required to illustrate some of the gathas of the different adhyayanas. After the 25th adhyayana, there is nothing which requires illu strations by way of narratives. Begins.- fol. 1 zrIjinAya namaH // praNamya zrImahAvIraM namrAkhaMDalamaMDalaM bhArabhyate ta(ka)thA(ka) karttamuttarAdhyayanasthitAH 1 uttarAdhyayanabRhadvRttigatA kathAH saMskRtA() kartumArabhyaMte ANA'nidesakare3 gAthAyAM kUlavAlakakathA 1 yathA ekasya AcAryasya kSullako'vinItaH etc. Ends.- fol. 73deg iti ciMtayanneba pratibuddhaH 'gaMgA'muttIrya sAdhusamIpe pravajitaH agragaH saMbaMdha mUtra eka prokto 5)stIti paMcaviMzAdhyayane kathA samAptA // etAvatA uttarAdhyayanabRhadvRttigatAH prAkRtakathA(:) sarvA (mopi saMskRtA(:) kRtA'stapAgacche bhaTTArakacakravartI(ti)zrIvijayasenasUArirAjye saMvat 1657 barSe 'pIpADapure' paMDitaprakAMDazrIvimalasAgaragaNiziSyapaNDitapAsAgaragaNinA prabarapremasAgaravAkyena kathA (:) kRtAH paNDitapadmasAgaraiH ____svaziSyavAkyapraNayena saMskRtAra 'pIpArDi'puryA jinapArzvanAyaka prasAdataH satkusa(za)lAya saMtvimAH 1 zodhayaMtu sajjanA svarUpastu sajjanebhyo yeSAM hRdayAni darpaNAnibhAni durvacanabhasmasaMgAda dhikataraM nirmalAni syuH // 2 // 0 [J.LP.]

Page #111
74 Jaina Literature and Philosophy [684. graMthAgraMtha 4500likhitaM zrI mehatA'nagare // saMvat 1799 varSe caitravadi prayodazyAM tithau / zubhaM bhUyAt / zrIrastu. This is followed by a line as under in a different hand : gumAnAbAI velasakaramedInI che parata uttarAdhenahI. Reference. See pp. 240-241 of Rajendralala Mitra's " Notices of Sanskrit Mss. published under orders of the Government of Bengal" vol. VIII, Calcutta, 1885. Here 25 legends are given. For an additional Ms. see Limbdi Catalogue No. 285. For a narrative of Harikesi-bala in Gujarati and some verses connected with the life of Jayaghosa and Vijayaghosa see "Prasthana" Vol. XV, No. 2, pp. I2I-123. uttarAdhyayanasUtra UttaradhyayanasutrabRhRvRttiparyAya brhadvrttiparyaya 736 (23). No. 685 1875-76. Extent.- fol. 28a to fol. 304. Description.- Complete. For other details see Pancavastukaparyaya No. 1875-76. 736 (1).. Author.--- Not mentioned. Subject. -- Explanation in Sanskrit regarding some difficult words. etc. occurring in the bihadvitti of Uttaradhyayanasutra. Begins.- fol. 28 namo'hate __ UrdhvarathikA iti dramakAnenamiti jinAgamanidhiM tadavAptAviti / etc. Ends.- fol. 30 avyavahArikA nityaM nityaM nigodA eva / udAharaNamiti badriyA dInAM / uttarAdhyayanabRhadvRttiparyAyAH samAptAH /

Page #112
687.] I.4Malasatras 75 uttarAdhyayanasutra UttaradhyayanasutrabRhadvRttiparyAya behadvittiparyaya 789 (23). No. 686 1895-1902 Exrent.- fol. 45b to fol. 49*. Description.- Complete. For other details see Paicavastuka 789 (1)... paryaya No. 1895-1902. Begins.- fol. 45 namo(s)hate // UrdhvarathikA iti etc., as in No. 685. Ends.- fol. 49* avyavahArikA etc., as in No. 685. N. B.-- For other details see No. 685. uttarAdhyayanasUtra UttaradhyayanasutrahavRttiparyAya brhadvrttiparyaya 332(6). No. 687 A. 1882-83. Extent.-- fol. 29* to fol. 34. Description.--Complete. For other details see Nandisutravisama pada paryaya No. 623. Begins.- fol. 29 yAvatyailokyazAlaH kamaThapativapulajAlapratiSThA naageNdrkhNdhbNdhstridshptindiipllv'shcNdr'gcchH| AzAkhAprazAkhAzivasadanazilAsatphalodhilpapuSpau bhAtAmeSo(s)pi tAvahAlitakAlamala pustaka(:) paThyamAnaH ||ch| namo arhte| uddhvaraghekA iti etc., as in No. 685. Ends.- fol. 33deg avyavahArikA nityaM etc. ___N. B.--- For other details see No. 685.

Page #113
76 Jaina Literature and Philosophy [688. usarAdhyayanasUtrAvacUrNi Uttaradhyayanasutravacurni 284. No. 688 A. 1883-84. Size.- 104 in. by 43 in. Extent.--- 45 folios ; 23 lines to a page ; 8 letters to a line. Description.- Country paper thin and greyish; Jaina Devanagari characters with pRSThamAtrAs; very small, quite legible and good hand-writing ; borders ruled in four lines in black ink; red chalk and yellow pigment used; diagrams about yugmapradezaprataravRtta etc. given on fol. 20; condition very good; complete ; extent 5250 slokas; composed in Samvat 1441. Age.-- Fairly old. Author.- Joanasagara, pupil of Devasundara of the Tapa gaccha. Subject.-- A small commentary in Sanskrit elucidating Uttara dhyayanasutra and its niryukti as well. This is based. upon the bihadvrtti of Santi Suri. Begins.- fol. I namaH shriiprvcnaay|| kaya0 // eSA pUrvAcAryagAthA // prakRto( 5 )yamuttarAdhyayanAnuyogo'sya ca nAmanikSepe uttarAdhyayanazrutaskaMdha iti nAma etc. Ends.- fol. 45deg anaMtAzca te gamAzcA'rthaparicchittiprakArAH paryavAzca zabdaparyavA arthaparyavarUpAstaiH saMyuktAna adhyAyAn prakramAduttarAdhyAyAn yoga upadhAnAdi. ru(ra)citavyApArastadanatikrameNe(Na) yathAyogaM // 12 jiivaajiivaavbhaaktH|| ch| iti zrIuttarAdhyayana avacariH samAptA: ||ch|shubhN bhavatu // cha / zrImat'tapAMgaNanabhoMgaNabhAskarAt zrI. (? mad )devasuMdarayugottamapAdukAnAM / ziSyairjinAgamasudhAMbudhilInacittaiH zrIjJAnasAgaragurUttamanAmadheyaiH // 1 bhUvArdhimanu 1441 mite'bde kRtottarAdhyayanagA(s)vacUrNiriyaM / zrIzAMtyAcAryabhuvastadvivRteH svaparahitakRtAya // 2 // graMthAgraM 5250 anumitAH // cha / etc. 1 It is probably on this basis that Charpentier styled this commentary as avec euri in his introduction (p. 64) to Uttaradhyayanasutra.

Page #114
690. ] uttarAdhyayanasUtrAvacUri I. 4 Mulasutras 7.7 Uttaradhyayanasutravacuri 165. 1871-72. No. 689 Size.-- 1o++ in. by 4g in. Extent.-- 21 - 1 = 20 folios; 19 lines to a page; 78 letters to a line. Description.- Country paper thin and white; Jaina Devanagari characters with gas, very small, legible, uniform and elegant hand-writing; borders ruled in four lines in black ink; red chalk used; this Ms. contains the rates of the text ; foll. numbered in the right-hand margin only; the 20th fol. missing ; otherwise complete; condition very good. Age.-- Pretty old. Author.-- Not mentioned. uttarAdhyayanasUtrAvacUri Subject. A small commentary in Sanskrit explaining Uttaradhyayanasutra. This is based upon the brhadvrtti. Begins.-- fol. r* zrIjinAgamAya namaH // zrIvarddhamAnamAnamya bRhadvatsyanusArataH / zrIuttarAdhyayanAnAmavacUriM likhAmyahaM // 1 // saMjogA 0 // saMyogAnmAtrAdiviSayAd bAhyAt kaSAyAdiviSayAdabhyaMtarAcca etc. Ends. fol. 2rb adhyAyAna prakramAduttarAdhyAyAna / yoga upadhAnAdiru (ri) citavyApArastadanatikrameNa yathAyogaM guru 0 // tazcittaprasannatArUpAddhetoradhIyeta na tu pramAdaM kuryAditi bhAvaH // 3 // cha etc. Uttaradhyayanasutravacuri 579. 1884-86. No. 690 Size.-- 10++ in. by 42 in. Extent. - 36 folios; 11 lines to a page 8o letters to a line.

Page #115
78 Jaina Literature and Philosophy [690. Description.-- Country paper thin and greyish ; Jaina Devanagari characters with THAT ITS; exceedingly small, legible, uniform and good hand-writing ; borders ruled in three lines in red ink; red chalk used; this Ms. contains only the gates of the text; foll. numbered in the right-hand margin only; a few foll. slightly worm-eaten ; condition tolerably good; complete. Age.- Samvat I SI02 (? ISI2). Author.-- Not mentioned. Subject.--- A small Sanskrit commentary on Uttaradhyayanasutra. Begins.- fol. ( zrIpaMcajJAnebhyo namaH // ___ saMyogAnmAtrAdi kaSAyAdi bAhyAbhyaMtarabhedAt vividhaiH prakAraijJAnabhAvanA dibhirvinayamUlatvAddharmasyAdAvadhyayanaM etc. Ends.- fol. 36deg adhyAyAn prakramAduttarAdhyAyAna yoga upadhAnAdiracitavyApAra tadanatikrameNa yathAyogaM // cha / SaTtriMzadapyuttarAdhyayanAni kiMcid vivRtAni // cha / etc. saMpUrNAni // cha / etc. saMvat 15102(?) varSe jyeSTavadi 12 bhaume likhitaM / / cha / zrIsarvajJAya namaH // cha // zrIH // etc. uttarAdhyayanasUtrAvacUri Uttaradhyayanasutravacuri 1158. No. 691 1887-91. Size.- 104 in. by 48 in. Extent.--- 23 folios; 23 lines to a page ; 96 letters to a line. Description.- Country paper very thin and white; Jaina Deva nagari characters; very small, quite legible and fair handwriting; borders ruled in three lines in black ink; red chalk used; numbers for foll. entered in the right-hand margin only ; this Ms. contains the gatras of the text ; complete; edges of some of the foll. slightly worn out; condition on the whole very good.

Page #116
692..] I.4Malasutras 79 Age.-- Fairly old. Author.-- Not mentioned. Subject.- A small commentary in Sanskrit to Uttaradhyavanasutra. Begins.- fol. I zrIjinAgamAya nmH|| saMjogA0 saMyogAnmAtrAdi kaSAyAdi bAhyAbhyaMtarabhedAt vividhaiH etc. Ends.- fol. 23deg ii0 ityetAn sUtratvAtprAduHkRtya kAMzcidarthataH kAMzcitsUtrato (5)pi / baddhaH kevalI jJAtakaH zrIvIraH / uttarAH pradhAnA adhyAyA adhyayanAni bhavasiddhikAnAM saMmatA abhipretAstAn // 267 jiivaajiivaavbhktiH|| 36 // ch|| citrasambhUtIyAdhyayana Citrasambutiyadhyayana (cittasaMbhaijjajjhayaNa) (Cittasambuijjajjhayana)vyAkhyA vyakhya No. 692 1620 1871-72 Size.- Iog in. by 4 in. Extent.-- 16 folios; 12 lines to a page ; 43 letters to a line. Description.- Country paper tough and white; Jaina Devanagari characters with pRSThamAtrAs; big, legible and good hand-writing%3B borders ruled in three lines in black ink; yellow pigment used; numbers for foll. entered only once, and that, too, in the right-hand margin as usual; some of the foll. slightly worm-eaten; condition good; complete so far as it goes%3B the entire work is mostly in Prakrit. Age.-- Pretty old. Author.-Not mentioned. He does not seem to be Santi Sari; for, the opening lines etc. do not tally with Sisyahita. Subject.- A narrative of Citra and Sambhuta. For a reference see p. 7.

Page #117
Jaina Literature and Philosophy [692. Begins.-- fol. I* OM namaH / vyAkhyAtaM dvAdazamadhyayana adhunA trayodazamArabhyate / te'sya cApamabhisaMbhaMdha ihAnaMtarAdhyayane tapasi yatno vidheya inyuvyA(cyate tacca kurvatA nidAnaM parihartavyaM // iti darzayituM yathA tanmahApApahetustathA citrasaMbhUto. dAharaNena nirdizyate etc. citrasaMbhUtavaktavyatA tAvaducyate / sA ceya 'sAgee' magare caMDavahiMsa. ssa raNNo putto muNivaM(ca)dA nAma Asi so ya niviNakAmabhogo sAgara caMdassa aMtie patvatiu etc. Ends.- fol. 160 eyassa silogassa pacchimaddhaM pUrei tassa rAyA niyayarajja saaddhaM deatti / evaM ca patidiNaM payattamA ghosaNaM laMbiu bahusu paesesu pAu / atrAdhasare pUrvabhavikazcitrAbhidhAnastatsahodarajIvaH 'purimatAla'na / samAptaH zrIrasta // lakSitaM Thakara blraajsutsssiidaasH||shubhN bhavatu // Reference.- This Ms. is referred to by Jarl Charpentier in his in troduction (p. 64) to Uttaradhyayanasutra. uttarAdhyayanasUtrakathA Uttaradhyayanasutrakatha No. 693 1295. 1887-91. Size.- sofin. by 44 in. Extent.-- 20 folios; 17 lines to a page ; 60 letters to a line. Description.-- Country paper rough and greyish ; Jaina Deva nagari characters with very rare AES; small, legible and very fair hand-writing ; borders ruled in four lines in black ink ; red chalk used; numbers for foll. entered only once ; edges of some of the foll. slightly worm-eaten ; condition good ; complete so far as it goes. Age.- Sarivat Is20. Author.- A Jaina sadhu, a devotee of Munisundara Sari.

Page #118
694.j 1.4 Malasatras 81 Subject.-Narratives in Sanskrit perraining to laghuvrttir of Uttara dhyayanasatra. Begins.- fol. I' a // arha hai)taH sarvasiddhAvA(cAryopAdhyAyasAdhavaH / bhavaMtu varadA mahyaM suzra(zru )tAraMbhasiddhaye // zrIuttarAdhyayanAnAM laghuvRttigayA?tAH) svayaM prAyaH kaizvina budhyate yAH kAzcitprAkRtAH kathAH // 2 // munisuMdarasUrIMdrAn sarvAgamavido gurun / pRSTvA pRSTvA svabodhAya likhyate saMskRtena tAH // 3 // prathamaM vinayAdhyayane / ANAnidesakare0 aba kUlavAlakathA // tadAha etc. Ends-- fol. 20deg viviktacaryA dhRtimatAH kartuM zakyA'ta utpannavizrotakenApi racA (?)namiva ccaraNe dhRtiH kAryA // 22 // zubhaM bhavatu lekhkpaatthkyo|| cha // saMvat 1520 varSe bhAdrapadasudi 12 dine guruvAre zrI maMDapadugeM zrI'tapAgacche paM0jJAnaharSagaNinA likhApitaM // cha / shrii| This is follow. ed by the following lines in a bigger hand-writing : __ saMvat 1520 zrAvaNa zudi 3 dine 'tapAgacchanAyakazrIlakSmIsAgarasUriziSyapaM jJAnaharSagaNInAM sA sA0 sonAmA sUDIpramukhakuTuMbayutena zrIsiddhAMtArAdhanAya nijanyAyopArjitavittavyayena zrIuttarAdhyayanakathA likhApitA ||ch||shriiH|| uttarAdhyayanasUtrakathA Uttaradhyayanasutrakatba 1319. No. 694 1891-95. Size. -- 104 in. by 44 in. Extent.- 37 - 2 = 35 folios ; 14 lines to a page ; 48 letters to a line. I Perhaps this is Nemicandra Suri's composition. 2 This word "aham" forms the very first sutra of Siddhahaima. It is defined as under:___" 'aham' iti sAnunAsikaM mAntaM vA'vyayaM sakalAgamarahasyabhUtaM yogajanAGgIkRtaM mahAprabhAvaka mntraakssraamti|" HIJ. L. P.]

Page #119
Jaina Literature and Philosophy [694. Description. Country paper thin and greyish; Jaina Devanagari characters ; big, legible, uniform and good hand-writing ; borders ruled in four lines in black ink; red chalk and yellow pigment used; foll. numbered in the right-hand margin only; a piece of paper of the size of a fol. pasted to fol. r+- ; same is the case with fol. 370; foll. ra and 37b blank ; corners of some of the foll. torn; a strip of paper pasted to fol. 154; condition on the whole very fair ; foll. 29 and 34 missing ; otherwise complete. Age.-- Samvat 1552. Author.-- Not mentioned. Subject.- Narratives in Sanskrit pertaining to the laghuvrtti of Uttaradhyayanasutra. Begins. fol. 1 OM namo vItarAgAya namaH // 82 zrIuttarAdhyayanalaghuvRtti etc., up to siddhaye as in No. 695. This is followed by prathame vinayAdhyayane ANAniddesA'kAragurUNamaSuNuva. 'tra kUlavAlakakathA yathA ekasya sUre: etc. Ends. fol. 374 zrIdharmaprati pratikrameNa sukhaM kha ( rA ? )jyaM ca prAptaM / puNyAkarasya sarvatrAjJA jAtA bahuni puNyakarttavyAni kRtAni // cha // zrIuttarAdhyayanAkSarazravaNamahimAkathane puNyAkarakathAnakaM zrIuttarAdhyayanaprAraMbhana kasamarthanaM // || devAdhidevazrI I cha // cha // etc. autsukyAdviparItArthakathanyA ( ? )spada vismRteH yatpApaM me(s) stu tanmithyA zrutokto saMghasAkSikaM / 4 (1) / bahvarthamatiga (? gaM) bhIraM samIraM pApapAdape / jinoktaM sUkSmadhIgamyamuttarAdhyayanazrutaM // vAcitaM puNyalAbhAya duSTakarmakSayAya ca / bodhAya budhaye duHkhapraNAzAya jayAya ca // 2 zrImadguro ( : ) prasAdAt zrIsaMghasAMnidhyatastathA / bAlo(s) pi vijJamAnyaH sthAnayA ( ? )tra vAcayati zrutaM // saMvat 1552 varSe mahopAdhyAya 'zrIlabadhi (bdhi) samudragaNizikSapUjyapa0 saMva (ve ) ge (gi) hemagaNinA laSArpitA / leSaka etc. Letters are illegible; for, yellow pigment is applied here.

Page #120
695.1 uttarAdhyayanasUtrakathAsaGkSepa No. 695 1. 4 Mulasutras 83 Uttaradhyayanasutrakathasarksepa Size.--- rog in. by 44 in. Extent.-- 29 folios; 14 lines to a page ; 48 letters to a line. Description. Country paper thin and white; Jaina Devanagari characters ; small, legible and good hand-writing; borders ruled in four lines in black ink; red chalk used; for ra blank ; almost all the foll. slightly worm-eaten ; condition very fair; complete; composed not earlier than the date of Hemacandra Suri; for his work triSaSTizalAkApuruSacaritra is quoted on fol. 29a. Begins. - fol, 1deg zrIuttarAdhyayanalaghuvRttikathA likhyate / arhataH sarvasiddhAzrvAcAryA (yoM )pAdhyAyasAdhavaH bhavaMtu varadA mahyaM suzrutAraMbhasiddhaye / agappabhavA jiNabhAsiyA ya patteyabuddhasaMvAyA / baMdhe mukkhe ya kayA chattIsaM uttarajjhayaNA // 2 // aMgaprabhavaM yathA / parISahAdhyayanaM vakSyati hi C 163. 1871-72. Age.-- Not modern. Author.-- Not mentioned. Subject. Narratives illustrating some of the gathas of Uttaradhyayanasutra, the 1st story being that of Kulavalaka. kammapavAyavve sattarase pAhuDaMmijaM sutaM taM iha sodAharaNaM baddhaM tu parIsahajjhayaNe // 3 // etc. - fol. 292 siMdhusauvIra' dezezazrI udAyanarAjarSikathA triSaSTIyazrIcIracaritA (tU) jJeyA etc. Ends.-- fol. 29deg jayaghoSavijayaghoSau yamalabhrAtarau / jayaghoSaH snAtuM 'gaMgA' gataH / pecchai sappeNa maMDuko gasijjai ssa ( sa ) ppo vi majJA ( jjA ) reNa'kaMto / tahAvi ma ( sa ) ppo maMDukkaM ciMciyaMtaM khAi / majjAro vi savyaM taDaphaDataM khAi taM aNNamaNNaghAyaM pAsittA aho saMsArasta asArayA jo jassa pabhavaDa so tamintha

Page #121
Jaina Literature and Philosophy [695. gasai ! kayaMto puNa sambassa pabhavai tti savvaM gasai / to dhammo cevettha tANaM viciMtiya 'gaMga' muttariya mA(sA)hupAse pavvaiu ti // zeSa sUtre // xfat saists ATTETUE R IT: FATATAP [:] etc. uttarAdhyayanasUtra kathAsakSepa Uttaradhyayanasutra kathasarksepa No. 656 1321. 1891-95. Size.- 104 in. by 4g in. Extent.-- 54 folios ; 11 lines to a page ; 40 letters to a line. Description.- Country paper thin and greyish ; Jaina Devanagari characters with occasional TSHTEITS; big, legible, uniform and good hand-writing; borders ruled in two pairs of lines in black ink; the space between these pairs coloured red; foll. numbered in the right-hand margin only; unnumbered sides have a small disc in red colour, in the centre; the numbered, in each of the two margins, too ; fol. ra blank; fol. 545 is practically so; for, the title viz. 37TTETTHET etc. written on it; red chalk used; yellow pigment, too; complete ; condition very good. Age.- Pretty old. Begins. fol. 10 STITIETOT E etc., as in No. 695. Ends.- fol. 536 FTTETTE FTO STG Thurait etc., practically up to the end as in No. 695. N. B.- For further particulars see No. 695.

Page #122
673.] I.4 Malasatras 85 uttarAdhyayanasUtra (adhyayana 1-9) kathAsahita Uttaradhyayanasutra ( Adhyayanas I-IX) with kathas No. 697 1324. 1887-91. Size.- 101 in. by 48 in. Extent.-77 - I = 76 folios ; 16 lines to a page; 42 letters to a line. Description.- Country paper rough and white; Jaina Devanagari characters; small, clear and good hand-writing; borders ruled in two lines and edges in one, in red ink; red chalk used; the Ist fol. lacking; this Ms. contains some portion of the text ( chapters I-IX ) as well as its commentary most ly in Sanskrit ; condition very good. Age.- Old. Author of the kathas etc.-Not mentioned. Subject.- This Ms. starts with the katha of Kulavalaka and ends with those of the 4 Pratyekabuddhas (kingly saints). At times there is given a portion in Gujarati. Begins.- ( text ) fol. 20 jahA suNI paikaNNI nimasijjai sabbaso evaM dussIlapaDiNIe muharI nikksijji||4|| ,, - ( com. ) fol. 2* zApo'smai kSulakAya dattaH he durAtman tvaM strIto vini (nakSyasi atha sa kSulako AcAryo(5)yaM mithyAvAdI bhavatu iti vicitya pRthakta tApasAzrame gatvA tiSThati / etc. - fol. 24 samaNe jaha kUlavAlae mAgahi gaNiaM raamsse| rAyAya asogacaMdae 'veve)sAliM' nagariM gAhassae // 1 // etc. ,, -(com.) fol. 77deg evaM catvAro'pi parasparaM saMbaddhAH satyavAdinaH sarvathA saMyama mArAdhakAH kevalajJAnamAsAdya zivaM jagmuH / iti pratyekabuddhacatuSTayakathAH samAptAH / navamAdhyayanakathA samAptA / atha navamAdhyayanasUtra prAraMmaH / .

Page #123
86 Jaina Literature and Philosophy [697 Ends.- (text ) fol. 770 caiUNa devalogAo uvavaNo mANusaMmI loya?gomi / uvasaMtamohaNijo sarati ya porANiyaM jAtiM / 1 // ,, -(com.) fol. 77deg namirAjA devalokAt cyutvA manuSyaloke utpannaH paurA NikIyAM jAti(tiM ) smarati nami rAjA devalokathI cavI manuSyaloki utpanna bhaNIyai jAno paurANikIyAM jAti bhaNai gata janmAMtara jAti smarai kiMviziSTo namirAjA upazAMtamohanIyaH pratyekabuddhacatuSTaya Pratyekabuddbacatustaya" caritra caritra 293. No. 698 A. 1883-84. Size.-9.in. by 44 in. Extent.-- 18 folios ; 15 lines to a page ; 33 letters to a line. Description.-- Country paper thin and white; Jaina Devanagari characters with occasional pRSThamAtrAs; big, legible but poor hand-writing; borders ruled in red ink; foll. numbered as usual; foll. I and I8b blank ; every side is decorated with three small discs in red colour, one in the centre and two in the margins ; complete ; yellow pigment used ; con dition good. Age.- Fairly old. Author.- Not mentioned. Subject. - Narratives about 4 Pratyekabuddhas. For comparison etc. see Charpentier's introduction (p. 44) to Uttaradhyayana sutra. Begins.- fol.rb uktamaSTamamadhyayanaM sAMpratiM nAmivaktavyatAbaddhaM namipravrajyAkhyaM navamamArabhya vA(cA)yamabhisaMbAMdhAnaMtarAdhyayane nitve(?)bhitvamuktAmaha tu tadanuSThita ihaiva deveMdrAdi prajAyata iti dayate etc. 1 This is the first verse of the ninth chapter known as amipavvajja (Namipravrajya). etc.

Page #124
699. 1. 4. Matasatras Ends.---fol. 18deg imAmanuzAsti karakaMDakRtAM pratipannAH kAlena ca catvAroM'pi mokSaM gatA iti / saMprati sUtramanuzriyate / ,, -- ( text ) fol. 18 caiUNa devalogA uvavaNo mANusaMmi logaMmi / uvasaMtamohaNijjo sarai porANeyaM jAyaiM cyutvo(?)de iti pratyekabuddhacatuSTayaM // samAptaM // cha // etc. Reference.- See "Sulla leggenda die quattro Pratyekabuddha" by P. E. Pavolini published in " Actes du XIIe congre's international des Orientalistes", vol. I, pp. 129-137, Firenze, 190I. pratyekabuddhacatuSTaya caritra Pratyekabuddhacatustaya caritra No. 699 296. A.1882-83. Size.- 94 in. by 41 in. Extent.-- 23 - I = 22 folios; 11 lines to a page; 31 letters to a line. Description.- Country paper rough and white; Jaina Devanagari characters; bold, big, legible and fair hand-writing; borders ruled indifferently ; yellow pigment used; foll. numbered in the right-hand margin; the Ist fol. lacking; practically incomplete; fol. 5 blank; but the matter is continuous%3B condition good. Age.- Not modern. Author.-Not mentioned. Subject.- This Ms. starts with Karakandakatha which ends on fol. 4.

Page #125
88 Jaina Literature and Philosophy Begins.- ( abruptly ) fol. 24 yA dRDhaM / rAjJA gRhItA dakSeNa tasthau rAjJI tathaiva hi / / 7 / kiMkartavyatayA mUDhaH sazoko'gA gRhaM nRpaH / nirmAmu (nuSAM (SA) va nItA tenebhena nRpapriyA // 8 // etc. 'paMcAla 'desaahivo puyamayupaM ca iMdaM keussa / da virattakAmo pavaio domuhanariMdo // 66 // Ends. -- (text) fol. 23b puSpa (ppha) ttarAu cavaNaM pavvajjA tahaya tesi samakAlaM / patteyabuddhakevali siddhigayA egasamaya ( ye ) NaM / 65 / (com.) -- fol. 4b etayorgAthayorakSarArtha ukta (:) kathAnakAMzAdevAvaseyaH navara akarimiti akArSuH / tathA pravrajyA teSAM samakAlaM yugapadeva pratyekabuddhatvaM ca gatAH prAptA ekena samayena paramanikRSTakAleneti gAthArthaH / iti zrInigattityaM ( ? ) catuHpratyekabuddhacaritraM / yAdRzaM etc. paMDita zrI saMjamavizAlapaTha ( nArthe ) // [ 700. Reference. -- See No. 698. manuSya bhavadurlabhatA - sUcakadazadRSTAnta No. 700 Size-- 1o in. by 4g in. Extent. - 13 folios; 19 lines to a page; 56 letters to a line. Description. Country paper thin and grey; Jaina Devanagari characters with occasional gears; small, clear and fair hand-writing ; borders ruled in four lines in black ink ; red chalk used; foll. numberd in the right-hand margin; a corner of almost each of the foll. slightly worn out; this seems to be a part of some other Ms. as its first fol. is numbered as 13; complete; condition tolerably good. Manusyabhavadurlabhatasucakadasadrstanta 794. 1895-1902.

Page #126
701.j 1.4Malasatras 89 Age.-- Samvat 1501. Author.- Not mentioned. Subject. Ten typical illustrations narrated in Sanskrit pointing out the difficulty of attaining birth as a human being. Begins.- fol. 14 // 5 // // zrIsarvajJAya namaH / saMsAre catasRSu gatiSu mAnavagatireva zlAghyA / ytH| suranArayANa dunna vi tiriyANa gaI ya huMti cattAri / maNuyANaM paMca tathA teNaM ciya uttamA maNuyA // 1 // etc. Ends.- fol. 25 atha pari( ra )mANadRSTAMto yathA / tathAhi kazcitridaza ArAzana dRSaNmayaM staMbhamutpATya pUrya(?)dRSTinikSepanibhaM cUrNa kRtavAn / taccUrNa samAdAya 'meru parvataM gatvA etc. punaH pari(ra)mANumelanAt staMbhapunarnavIkaraNAya ciMtitaM / melayati paramAtAn yAvattAvanna milati te / vAtAhatAste paramANavo girinadIsamudreSu nipAtitAH / sa devo'pi na puna staMbhaM cakAra tathA mAnavaM janma nirarthakaM gataM punaH prAptuM na zakyate jIvena / iti paramANudRSTAMto dazamaH / 10 // cha // etc. ___ saMvanu(t ) 1501 zAkye 1366 samaya pravartamAne vaizApazudi 15 tithau sa(za )nivAsare liSitA daza diSTAMta zrI yoginIpure 'DhilikAyAM / zrImahaMmadasAhirAjye / lideg meghacaMda kAistha kaulasIsutaH // zubhaM etc. manuSyabhavadurlabhatA ManusyabhavadurlabhatasUcakadazadRSTAnta sucakadasadrstanta No. 701 1307. 1887-91. Size.-- 104 in. by 44 in. Extent.-- 19 folios; 15 lines to a page; 53 letters to a line. Description.- Country paper very thin and white; Jaina Deva nagari characters; small, legible and good hand-writing; borders ruled in two pairs of lines in black ink ; the space i For a brief exposition of these narratives see my explanatory notes (pp. 12-15 ) on Vairagyarasamanjari. 12 [I.L.P.]

Page #127
faina Literature and Philosophy ( 701. between these pairs coloured red; red chalk and yellow pigment used; unnumbered sides decorated with a small disc in red colour in the centre only, whereas the numbered, in each of the two margins, too; the 19th fol. partly torn; edges of several foll. partially worn out; condition very fair ; complete. Age.-- Samvat 1558. Begins.- fol. 19 AFIT TTTT stang etc., as in No. 700. Ends.-- fol. 199 379 (Argreutat ger etc., practically as in No. 700 up to sfat TATUENTI TETA: 201. This is followed by the lines as under : wa 244c star(fa) falaleia CHHIA goh TOana I TH yra I etc. N. B.- For further particulars see No. 700.

Page #128
702. ] dazavaikAlikasUtra ( dasaveyAliyasutta ) ( adhyayana 1-4 ) No. 702 II. 4 Malasutras THE SECOND MULASUTRA Begins. fol. 14 zrIgurubhyo namaH // Ends. fol. 7a Dasavaikalikasutra (Dasaveyaliyasutta) (Adhyayanas I-IV) Size. 97 in. by 4 in. Extent. 7 folios; II lines to a page; 28 letters to a line. Description. Country paper thin, rough and whitish; Jaina Devanagari characters with frequent ; big, quite clear, uniform and good hand-writing; borders ruled in two lines in red ink; the space between these pairs coloured yellowish; black ink and red ink as well used for writing the text; foll. numbered in the right-hand margin only; fol. 7 blank; yellow pigment rarely used; complete so far as the first four adhyayanas are concerned; condition very good. Age.- Old. Author.-- Sejjambhava (Sayyambhava) Suri. For details No. 704. 91 Subject. This forms a part of the second mulasutra which contains 10 adhyayanas. For detailed information see No. 704. etc. as in No. 704. 723. 1899-1915. icceyaM chajjIvaNiyaM / sammaddiTThI sayA jae / dulahaM lahiu sAmannaM / kammaNA na virAhijjAsi see ti bemi // 29 chajjIvaNiyA nAma cautthamajjhayaNaM samattaM likhitta (taM) harSacaMdre(Na) zrAvikAjaitUpaThanArtha

Page #129
92 Jaina Literature and Philosophy [703. Reference.-- Published. See No. 704. For additional Mss. having only four adhyayanas of this text see Limbdi Catalogue Nos. IISI and II52. The latter contains tabba, too. Gujarati anuvadana is published by Mahavirasahityaprakasanamandira, Sabarmati, Gujarat in A. D. 1935. dazavakAlikasUtra (adhyayana 1) Dasavaikalikasutra ( Adhyayana I) No. 703 1372(b). 1891-95. Extent.-- fol. 7* to fol. 7". Description.- Only the five gathas of the first chapter of Dasavaikalikasutra are given here. For other details see Tirtha ____1372 (a). mala No. . 1891-95. Age.-Samvat I717. Begins.- fol. 7* dhammo maMgalamukTuM etc. Ends.--- fol. 7b vI(vi)yaM ca vittaM labhA( bbhA )mo / na ya koi sa(?u)vahama(mma)I ahAgaDesu rIyaMte puSka( pphe )se bhamarA jahA // 4 // mahukArasamA buddhA je bhavaMti aNusayA // nANApaMDarayA daMtA teNa vuccaMti sAhUNo tti bemi // 5 // iti zrIpuSkI(pI)yAadhyayana saMpUrNaH // saMvat 1717 varSe kAtImAse zuklapakSe dazamIdine zukla(ka)vAre likhitaM muzrIvairAgyasAgareNa // zrI 'akabarAvAda'vAstavya // sAhapannajIbhAryAzrAvikAjeThUpaunArtha // Reference.- For Mss. having only one adhyayana see Limbdi Cata logue No. 1156. No. 1155 of this Catalogue refers to a Ms. having the first 17 gathas. For additional particulars see No. 704.

Page #130
704. II. 4 Malasatras 93 The fagot is mentioned in the svopajna laghuvstti (p. 25 ) of Siddhahaima (V-2-25 ) as under : dhArayan AcArAGgam, adhIyan drumapuSpIyam / " N. B.-- For author' and subject' see Nos. 702 and 704. dazavaikAlikasUtra Dasavaikalikasutra tathA and cUlikAyugala Culikyaugala (greerige) (Culiyajuyala ) 36. No. 704 1869-70. Size.-- 101 in. by 4a in. Extent. -- 19 folios ; 15 lines to a page ; 44 letters to a line. Description.--Country paper thick, durable and greyish; Jaina Deva nagari characters; clear, uniform and good hand-writing; borders ruled in three lines in red ink, whereas edges, in two; fol. 1a blank; numbers for gathas etc., written in red ink; yellow pigment used; numbers for foll. circumscribed by different figures; complete ; ink faded; condition very good. Age. Samvat 1785, Saka 1650. Author of the text (Dasvaikalikasutra ).-Sayyambhava Suri, father of Managa (Manaka) for whom he composed this work. He is praised by Muniratna Suri in his Amamasvamicaritra as under: "zayyambhavo'stu vo bhUtyai cakre sarvAGgamUttibhRt / yenAduHprasabhAcAryakAlikaM dazakAlikam // 14 // " For other details see Indian Antiquary vol. XI, p. 246 and Peterson Reports IV, p. CXVIII, and V, pp. 4, 121 andji 30.

Page #131
94 Jaina Literature and Philosophy ( 704. Author or the two Culikas.- Simandharasvamin according to the Jaina tradition. See p. 96 as well as Haribhadra Suri's com mentary (p. 279 ) on Dasavaikalikasutra. Subject. The text which is styled as Dasakaliya and Dasaveya liya' as well, has ten chapters. Their significant titles are as under: ( 1 ) stagr@q7T, ( 2 ) Threes, ( 3 ) aru, (4) Testteamet, (5) fue qurt, ( 6 ) AETEKET, ( 7 ) argie, (8) Terefore, ( 9 TOFATH and ( 10 ) A . Eulogy of dharma, firm faith in it, the code of discipline, ahimsa, rules and regulations pertaining to bhiksa, rules of conduct in details, purity of speech, advertedness, discipline and the qualities of a good saint respectively form the main topics of these.chapters. For a summary of the contents of these ten chapters in Sanskrit see Keith's Catalogue No. 7503 which deals with a Ms. styled as" pranoko faqat: ". In a Gujarati article published in " Jaina prakasa" (vol. XXII, No. 14, dated 17-2-35), we find the following information : In the first chapter there is a detailed exposition of the twelve upamas given to a Jaina ascetic in Anuyogadvara. The second chapter resembles the 22nd chapter of Uttaradhyayanasutra, and that some of the gathas are also common to both. The third chapter seems to be based upon Nisitha etc. The fourth agrees with the 24th chapter of Acaranga. The fifth appears to be a paraphrase of Pindaisana, the ist chapter of the 2nd part of Acaranga. The sixth deals with the 18 siksas referred to in Samavaya (XVIII). The seventh is an exposition of bhasa dealt with in the 13th chapter of the 2nd part of Acaranga. The eighth has several topics in common with the eighth chapter of Sthananga. The ninth can be compared with the 1 Some interpret this as "ten chapters preached at the time of evening ". Compare "The Dasavaikalikasutra, a study" (p. 9) Patwardhan, 1933.

Page #132
704.] 11. 4. Malasatras 95 first chapter of Uttaradhyayanasutra. The tenth resembles the Isth chapter of Uttaradhyayanasutra and has some gathas in common with it. The ist Culika deals with the problem of the stability of a Jaina saint shaken in faith while the second, with the question of secluded residence. Thus on the whole the entire work deals with the life a Jaina saint is expected to lead. Begins.- (text) fol. I' zrIvItarAgAya nmH|| dhammo maMgalamukka(kki), // ahiMsA saMjamo tavo // devA vi taM namasaMti // jassa dhamme sayA maNo // 1 // etc. ., -- ( Ist Calika) fol. 18' iha khalu bho pavvaieNaM // uppannadukkhaNaM // saMjame araisamAvannacitteNaM etc. ,,-( 2nd Culika ) fol. 19 caliyaM tu pavakkhAmi / suyaM kevalibhAsiyaM / jaM suponu sa(sa)punnApAM dhamme uppajaI maI // 1 // Ends.- ( text ) fol. 186 taM dehavAsa asaI asAsayaM sayA cae / nizcahiyaTTiyappA // chidittu jAI maraNassa bNdh(nnN)|| ubei mikkhU apuNAgamaM gae() tti bemi // 21 // samikkhuajjhayaNaM dasamaM samattaM // 10 // ,,-( Ist Calika) fol. 19 icceva saMpassia buddhimaM nro|| / AyaM uvAyaM vivihaM viyANiyA / / kAraNa vAya(yA) adumANaseNaM // tittiyutto jiNavayaNamahidvijjAsi te(tti) bemi||ch| rahavakA saMmattA //

Page #133
Jaina: Literature and Philosophy [ 704. Ends.-- ( 2nd Culika ) fol. rgb appA [hu] khalu samayaM rakkhiyavvo / savvidiehiM susamAhihiM // arakkhiujjA ( o jA ) ipahaM uvei // surakkhiu ( o ) savvaduhANa muccaitti bemi / dasaveyAliyasuyakkhaMdho sammatto // 96 maNagaM pahucca sejjaMbhaveNa nijjUhiyA dasajjhayaNA || veyAliyAi ThaviyA tamhA veyAliyaM nAma // 1 // sijjaMbhavaM gaNaharaM // jiNapaDimAdaMsaNeNa paDibuddhaM [ ] piyaraM dasakAliyassa || nijjUhagaM vaMde // 2 // eyAo do calAu || ANIya jakkhiNAi ajjAe // sImaMdharapAsAe // bhaviyANaM bohaNatthAe // 3 // iti zrIdazavaikAlikasUtraM samAptaM // saMvat 1785 varSe zAke 1650 pravarttamAne // kArtitradi 2 dine budhavAre zrI. The subsequent letters are illegible as ink is applied here. Then we have:liSitaM... paThanArtha // Reference.-- Edited with Bhadrabahusvamin's niryukti in Z. D. M. G. (vol. 46, pp. 581-663) by E. Leumann, with introduction dealing with the different strata of Jaina commentaryliterature in general and the stories connected with the text, in special. The text along with two Culikas, this niryukti and Haribhadra Suri's commentary is published in the D. L. J. P. F. Series in A. D. 1918 and that with Samayasundara Gani's commentary by Hiralal Hamsaraj, Jamanagar, in A. D. 1915. Dasavaikalikasutra along with two Culikas, their sabdaratha and bhavartha, too, is published in Samvat 1987, by Jaina-mahila-mandala, Santinatha Upasraya, Bombay. Banarasi Das Jaina has given in his Ardha-MagadhiReader the 8th chapter of the text on pp. 74-78, along with its English translation on pp. 167 172. The text together with the Culikas has been edited and translated into English by K. V. Abhyankar. He has made 1-2 These are respectively the 15th and the 14th gathas of Dasavaikaliksutraniryukti. 3 With the help of this edition Jivraj Ghelabhai Dosi has published an edition in Devanagari characters.

Page #134
704.) 11. 4 Malasatras 97 certain allegations against the Jainas and Jainism." W. Schubring, too, has edited the text with the two Culikas and has given the English translation of the same. This edition of his is published by Sheth Anandji Kalyanji Pedhi. In this edition he has referred to the question of flesh-eating For description of a Ms. having the bare text see Keith's Catalogue No. 7498 and for other Mss. see Limbdi Catalogue Nos. 1150-5152, 1154-1157 and 1160-1168. For description of additional Mss. see B. B. R. A. S. vols. III-IV, p. 382 and G. O. Series vol. XXI, p. 25. For contents etc. see Weber II, pp. 807-813, Indische Studiep vol. XVII, pp. 77-80, Indian Antiguary vol. XXI, pp. 339ff., Winternitz, Geschichte (vol. II, p. 315), La Religion Djaina (pp. 43, 79 & 81). A History of Indian Literature (vol. II, pp. 429, 433n., 470 f., 474, 476n., 481, 484 and 509 ) and Die Lehre der Jainas ( p. 80 ). See also G. Buhler's "Two lists of Sanskrit Mss. together with some remarks on my connexion with the search for Sanskrit Mss. " (Z. D. M. G. vol. XLII, p. 553). See also Mitra, Notices vol. VIII, pp. 119-120. 1 See p. 249 of my article " xr E lega" published in " Citramayajagat " ( vol. 18, December 1932 ) and also another article of mine " resta TFS A the feat" published in the issue of " Jain ", a weckly dated 25th December 1932. For other articles of mine having the same title see the issues of this "Jain " dated 21-5-33, 28-5-33, 4-6-33 and 23-7-33 respectively. 2 In this connection he informs me in his letter dated the 7th September 1936 as under: "Through the kindness of Mr. Gode I received your article concerning fleshcating in Jainism, partly based upon Professor Jacobi's brilliant suggestions. I appreciate it very ry.uch and it is now on the part of the managers of Sheth Anandji Kalyanji, Ahinedabad, to make use of what I wrote then after having reconsidered certain places in my translation of the Dasavaikalikasutia on the ground of those investigations." 13 [J. L P.

Page #135
Jaina Literature and Philosophy [705. dazavaikAlikasUtra Dasa vaikalikasutra cUlikAyugalasahita with Culikayugala 613 (b). No. 705 1884-86. Extent.- fol. 5* to fol. 216. Description. Both the text and the two Culikas complete. For .. other details see Paksikasutra No. - 613 (a). Kasutra NO. 1884-86. . Begins.- fol. 5*dhammo maMgalamukkaTuM etc., as in No. 703. fol. 5 sAmanapugviyaM nAmajjhayaNaM sammattaM // cha / fol. 8 chajjIvaNiyA sammattA // cha / fol. II piMDesaNAe paDhamo uddeso sammatto // cha / fol. 12* piMDesaNA(e) bIo uddesao sammatto // cha / fol. I3' dhammatthakAmajjhayaNNaM(Na) chadraM sammattaM // cha / fol. IS" vakkasu(ddhi)ajjhayaNaM sattamaM sammattaM // cha / fol. 16deg viNayasamAhIe paDhamau uddesau ||ch|| fol. I7* AyArapaNi(hi) aTTamaM ajjhayaNaM sammattaM // cha / fol. 17 viNayasamAhIe paDhamau uddesau // cha / fol. 18 viNayasamAhIe bIu uhesau ||ch|| fol. 18deg viNayasamAhIe taIu uddesau // cha / fol. 19* viNayasamAhIe navamajhayaNaM sammattaM // cha / fol. 19 sabhikkhuajjhayaNaM samaM sammattaM // cha / fol. 20deg raivakkA sammattA // cha / Ends.- fol. 214 maNagaM paDucca sijjabhaveNa nijjUhiyA dasajjhayaNA / ' veyAliyAyadRSiyA tamhA dasakAliyaM nAma // 12 // cUliyA sammattA dasaveyAliyasuyakkhaMdho sammato // cha / N. B.-For other details see No. 704. Just as this work is composed by sayyambhava Suri for his son so it is said Dharmadasa Gani has composed Upadesamalaprakarana for his son Ranasimha, Sce Ramavijaya's vivarana on this prakarana. 2 According to the printed edition this is the 13th gatha of the Dasavaikalikasutraniryukti.

Page #136
(99 706.] * II. 4 Mulasatras dazavaikAlikasUtra Dasavaikalikasutra cUlikAyugalasAhita with Culikayugala No. 706 434 ( a ). 1882-83. Size.--Iljin. by 43 in. Extent. 14 folios; Is lines to a page ; 56 letters to a line. Description.- Country paper thin and grey; Jaina Devanagari charac ters with occasional Thris; bold, legible, uniform and good hand-writing ; borders ruled in two pairs of lines in black ink; the space between these pairs coloured red; unnumbered sides have one small disc in red ink in the centre; the numbered have two more such discs, one in each of the two margins; a piece of paper of almost the same size as the fol. pasted to the first fol.; edges of some of the foll. worn out: condition very fair; red chalk used; at times letters have been made illegible by applying red and black ink, instead of applying the yellow pigment; this Ms. contains the Dasavaikalikasutra and the two Culikas as well; all complete ; extent 700 slokas ; this Ms. has an additional work viz. Paksikasutra beginning and ending on fol. 146 thus having 7 complete verses plus a part of the 8th. Age.- Pretty old. Begins.--( Dasavaikalika ) fol. 16 JFAT g etc., as in No. 704. ,, - ( Ist Culika ) fol. 135 e ag ut etc., as in No. 704. ,, -(2nd , ) fol. 14deg reci =( )Falla etc., as in No. 704 Ends.- ( Dasavaikalika ) fol. 13b zag har SgOTTA TEIT OP sabhikkhuajjhayaNaM dasamaM sammattaM // cha / , - ( ist Culika ) fol. 14 FUTETUTAIETEHTIT PT WH 1186 TECEDET TEATROT AFT I J ! >> - (2nd ,, ) fol. 14 plenit HEETT ETT FII A II 16 bIA calA smmttaa|| cha /

Page #137
[ 706. Jaina Literature and Philosophy sijjabhavaM gaNaharaM jiNapADamAdaMsaNeNa paDiba (bu) ddhaM / maga piyaraM dasakAliyasya nijjUhagaM vaMde // 1 ( This is the 14th gatha of dazavaikAlikaniyukti ) maNagaM paDuca sijjaMbhaveNa nijjUhiya (yA) dasajjhayaNA / veyAliyAya ThaviyA tamhA dasakAliyaM nAma // 2 ( This is the 15th gatha of daza * niryukti ) chammA seNa ahi (hI) yaM ajjhayaNamiNaM tu ajjamaNageNa ( 1 ) chammAsA pariyAo aha kAlagao samAhIe // 3 (This is the 37oth gatha of daza niyukti ) ANaMdayaM supAyaM kAhI sejjaMbhavA tahi therA / jasabhaddassa ya pucchA kahaNA ya viyAlaNA saMghe // 4 ( This is the 371th gatha of daza niryukti) ta (tu) mhAsi ( sa ) risA vi muNivara mohapisAeNa jai chalijjati / tA sAhu tumaM ciya dhIramAkaM samAllIyao // 5 dasa ajjhayaNasamaya sijjaMbhava sUriviraithaM eyaM / lahuyAoyaM vanAuM ahAe maNagasIsassa || 6 yA udo cUlA ANIyA jakkhiNIi ajjAe / sImaMdharapAsAo bhaviyaNajaNavibohaNaTTAe // 7 khullA saNadImmI ahiyaM kArAvio ya ajjA / rayaNIe kAlagao ajjA saMvegamAvannA // 8 kahameyaM saMjAyaM zisiMhaccA pAviyA mae pAve / to devayAvinIyA sImaMdharasAmiNo pAse // 9 sImaMdhareNa bhaNiyA ajje khullo gao mahAkappo / mA jjharasu appANaM dhammaMmi ya niccalA hosu // 10 iti dazavaikAlikaM samAptamiti // cha // graMthAgraM 700 zubhaM bhavatu zrIsaMghasya // 1 N. B. For additional particulars see No. 704. 100

Page #138
708. dazavaikAlikasUtra cUlikAyugalasahita No. 707 Extent. fol. 12a to fol. 24a. Description. Both the text and other details see No. " II. 4 Malasatras 122 ahe namaH // Begins.--- ( Dasavaikalika ) fol. dhammo maMgalamukkaTuM etc. as in No. 704. - ( 1st Culika ) fol. 23 iha khalu etc. as in No. 704. -(2nd ),, 23" cUliyaM tu etc., as in No. 704 . Ends.-- ( Dasavaikalika ) fol. 224 uvei etc. as in No. 704 . 33 - dazavekAlikasUtra ( adhyayana 2 - 10 ) cUlikAyugalasahita IoI Dasavaikalikasutra with Culikayugala 1269 (e). 1887-91. ( Ist Culika) fol. 23b jiNavayaNama hiTTijjAsa (si) tti bemi 18 // raivakkAcUlA sammattA // - ( 2nd 5 // ) fol. 230 savvaduhANa muccaI tti bemi / 16 cUliyA ajjhayaNaM sammattaM // cha // zrIH This is followed by ro verses beginning with sijaMbhavaM gaNaharaM and ending with the line dhammaMmi ya niJcalA hosu // 10 as in No. 706. Then we have:iti zrIdRzavaikAlikaM paramAgamaM samAptamiti // cha // N. B.-- For further particulars see No. 704 . the two Culikas complete. For 1269 (a ). 1889-91. Dasavaikalikasutra ( Adhyayanas II-X ) with Culikayugala 1171 (a). 1887-91. No. 708 Size.5 in. by 31 in. Extent.-- 46-1 = 45 folios; to lines to a page ; 44 letters to a line.

Page #139
To2 Jaina Literature and Philosophy [708. Description.- Country paper thick, smooth and grey ; Devanagari characters with pRSThamAtrAs: quite bold, legible, uniform and very beautiful hand-writing; borders ruled in two pairs of lines in black ink ; unnumbered sides have one circular diss in the centre ; the numbered have two more, one in each of the two margins ; red chalk used ; numbers for foll. twice entered on one and the same side in one and the same left-hand margin and also once in the right-hand margin as sti, zrI, rka, t etc.; the 46th numbered as ta ; condition very good; the Ist fol. missing so this Ms. commences with the last word of the 6th gatha of the 2nd adhyayana ( see pp. 95-96 D. L. J. P. F. Series, No. 47 ); otherwise complete. This Ms. contains two additional works as under : (i) pAkSikasUtra foll. 30 to 42b (ii) zramaNasUtra ,, 42b ,, 46". Age.-- Old. Begins.- (Dasavaikalika ) fol. 2a gaMdhaNe // 6 dhiratthu te jasokAmI jo taM jiiviykaarnnaa| baMtaM icchasi AveLa seyaM te maraNaM bhave // 7etc. ,, -( Ist Culika) fol. 27" iha khalu bho etc., as in No. 704. , - ( 2nd ,, ,, 29* cUliyaM tu paca(ba)kkhAmi etc., as in No.703 Ends.- ( Dasavaikalika) fol. 27 apuNAgamaM gai ti bemi // 21 ||ch // sabhikkhuajjhayaNaM dasamaM sammattaM // cha / ,, - (Ist Culika) fol. 29 jiNavayaNamahiTrijjAsi tti bemi // 18 raya(i)vakkA nAma paDhamA cUlA sammattA // cha / ,, - (2nd ,, ) fol. 30 savvaduhANa muccai tti bemi / 16) // cha / dasaveyAliyasuyakkhaMdho sammatto / ch|| This is followed by only one verse commencing with Horoga and going up to ThaviyA tamhA veyAliyaM nAma ||ch|| N. B.- For further particulars see No. 704.

Page #140
709.] dazavaikAlikasUtra, cUlikAyugala, fagfm (fasgia) tathA TIkA No. 709 ii. 4 Malasatras 103 Dasavaikalikasutra, Culikayugala, niryukti (nijjutti) and tika 721. 1875-76. Size.-9 in. by 44 in. Extent. 160 + 1 = 161 folios; 15 lines to a page; 49 letters to a line. Description.- Country paper very thin and greyish; Devanagari characters with gears; bold, legible, uniform and elegant hand-writing; borders ruled in three lines in red ink; this Ms. contains Dasavaikalikasutra, the Culikas, the niryukti and the commentary; edges of the first fol. somewhat worn out; all the same condition on the whole very good; fol. 36th repeated; complete. Age.- Pretty old. Author of the niryukti.-Bhadrabahusvamin, twin pupil with Sambhutivijaya of Yasobhadra Suri. He is looked upon as the author of ten niryuktis. The texts corresponding to these ten niryuktis are as under : (1) Avasyakasutra, (2) Dasavaikalikasutra, (3) Uttaradhyayanasutra', (4) Acarangasutra2, (5) Sutrakrtangasutra, (6) Dasasrutaskandhasutra, (7) Kalpasutra, (8) Vyavaharasutra, (9) Suryaprajnapti and (10) Rsibhasita.s Muniratna Suri in his Amamasvamicaritra (v. 15) compares these niryuktis with the ten mandalas of the RgVeda. 6 1-4 For a niryukti for each of these works see Nos. 681-682, 6-8, 48-50 and 485-487. 5 See Peterson I, App. p. 15. 6 Vide Peterson III, App. p. 90.

Page #141
104 jaina Literature and Philosophy ( 709. Devacandra mentions Bhadrabahusvamin as the author of Vasudevacariya, in 125,000 slokas. Bhadrabahu is referred to as one of the five srutaparagas ? and is looked upon as yugapradhana, too. Peterson in his Report IV, p. LXXXIV mentions Satrunjayakalpa as one of his works with a cross-reference to 3, App. p. 306. Malayagiri refers to him as the author of Pinqaniryukti. Ksemakirti praises him as the uddharaka of Brhatkalpasutra. Oghaniryukti has been composed by this Bhadrabahusvamin to whom the authorship of Upasargaharastotra is ascribed. For other details about Bhadrabahusvamin see Klatt, Indian Antiquary vol. XI, p. 246, Weber II, p. 999 and my Sanskrit introduction to Priyamkaranfpakatha. Author of the commentary.- Haribhadra Suri. He has named about 63 gathas as bhasyakrd-gathas which are usually included in the niryukti of Dasavaikalika. As regards this Haribhadra Suri A. M, Ghatage in his article " Dasavaikalika Niryukti " observes : "The commentator is clearly far-fetched and twisting in interpreting udaharanas as the drstantas of the logical syllogisms. (p. 637) ......... Haribhadra's opinion that a vauliya is a reference to the school of the Nastikas is not very accurate ( p. 638)." This Haribhadra Suri has composed a number of works, out of which the following are noted by Peterson in his Report IV, pp. CXXXVII-CXXXIX : 1 See leterson V, App. p. 73. 2-5 Vide Peterson III, App. p. 266 and 308 and V, p. 31 und V. p. 102 respectively, 6 This is published in The Indian Ilistorical Quarterly" vol. I, No. 4, fp. 627-639.

Page #142
709.] II. 4 Malasutras (1) Anekantajayapataka (III, App. p. 191), (2) Avasyakatika called Sisyahita ( III, App. p. 202), (3) Upadesapada (I, App. p. 34; III, App. p. 46), (4) Caityavandanavrtti called Lalitavistara (III, App. p. 148), (5) Jambudvipasangrahani (I, App. p. 49; III, App. pp. 213, 253 and 276), (6) Jnanapancakavivarana (III, App. p. 285), (7) Darsanasaptatika ( III, App. p. 13), (8) Dasavaikalikaniryuktitika, (9) Dharmabindu (I, App. p. 44; III, App. p. 53), (10) Nanacitrika (I, App. p. 48), (11) Pancasaka (I, App. p. 11), (12) Munipaticaritra, (13) Lagnakundalika (I, App. p. 88), (14) Vedabahyatanirakarana, (15) Sravakadharmavidhiprakarana (I, App. p. 16), (16) Samaradityacaritra (III, App. p. 118), (17) Yogabinduprakaranavrtti (III, App. p. 327 ) and ( 18 ) Pancasutravrtti ( IV, 104 ). tos In his Report V, p. LXXXIV, he mentions the following additional works:(1) Lokatattvanirnaya, (2) Yogadrstisamuccaya and its commentary. For a detailed discussion about Haribhadra Suri's life, date, works etc., see my introduction to Anekantajayapataka, which is being edited with its svopajna commentary and Municandra Suri's vivarana and which will be hereafter published in Gaekwad's Oriental Series. Subject. The text as usual. It is accompanied by a Prakrit commentary known as niryukti several gathas of which are found in Mulacara, a Digambara work. This niryukti is explained in the Sanskrit commentary which follows it. As stated in Ganadharasardhasataka (Weber II, p. 987) Haribhadra composed a brhadvrtti and a laghuvrtti to Dasavaikalikasutra. The commentary given here is a laghuvrtti, it being an epitome of the brhadvrtti. The niryukti above referred to is a metrical composition in Prakrit, and it consists of 447 verses (gathas) or so2. Out of them 62 gathas are styled by Haribhadra as Diksavidhipaficasaka is here excluded by me; for, it forms only a part of Pancasaka. 2 See p. 108. 14 []. L. P.]

Page #143
106 "" "" Begins.-- ( Dasavaikalika ) fol. 20 dhammo etc., as in No. 704 -- ( niryukti ) fol. 1 siddhigaimuvagayANaM etc., as in No. 710. ( com. ) fol. rb namaH zrutadevatAyai - [ 709. Jaina Literature and Philosophy bhasyakrt-gathas. They mostly occur in the niryukti of the fourth adhyayana and seem to supplement the original niyurkti-gathas. Haribhadra has noted one gatha as bhinnakartRkI. See the printed edition ( p. 842 ). " The niryukti explains the titles of the adhyayanas and some words from the body of the text. It deals with the subject-matter from various view-points wherein ( 1 ) niksepa, ( 2 ) nirukta, ( 3 ) ekartha, ( 4 ) linga and ( 5 ) pancavayava hold a promiment place. Out of them niksepa is given full scope in verses 8, 9 and 1781. Some of the words of which niksepa is given are duma, dhamma, samaNa, kAma, paya, AyAra, jIva, kAya, sayAra, bhikkhu vakka, suddhi, and paNihi. " Nirukta is noticed in connection with ajjhayana, ajjhina, aya, kama, jhavana etc., and ekartha for vakka in v. 270.2 Ends. -- ( Dasavaikalika ) fol. 159 appA khalu etc. jayati virji ( ji ) tAnya etc, up to practically mahArthagocarasya vyAkhyA prastUyate ( see No. 716 ). This is followed by tatra prastutArthapracikaTayiSayeSTadevatAnamaskAradvAreNa zeSavighnavinAyakApohasamarthA paramamaMgalAlayAmimAM gAthAmAha niyuktikAraH etc. vyAkhyA siddhigatimupagatebhyo etc. -- ( niryukti) fol. 1600 savvesiM pi nayANaM etc., up to sAhU // ( com. ) fol. 160deg zAstramupasa (saM) hara (n) upadeza sarvasvamAha appa tti sUtraM vyA / AtmA khalviti khaluzabdo vizeSaNArtha (:) zakto (ktau) satyAM paropi etc. nizamya zrutvA sarvanayavizuddhaM sarvanayasaMmataM vacanaM yaccaraNa ( guNa ) sthitaH sAdhu ( : ) yasmAtsarvanayA eva bhAvanikSepa micchatIti gAthArthaH followed by the following lines written perhaps by some one else : I These numbers refer to D. L. J. P. F. Series No. 47. 2 For details see Ghatage's article (above referred to) p. 635 and ff. Here he has remarked that in many cases the interpretation "is clearly wrong and much of it is based upon the mere similarity of sound or the possibility of a secondary sense".

Page #144
710. ] II. 4 Malasutras 107 namo varddhamAnabhagavate vyAkhyAtaM cUDAdhyayanaM tadvyAkhyAnAcca samAptA dazavaikAlikaTIkA yAkinIdharmasUnuzrIharibhadrAcAryakRtA dazavekAlikatai vidhAya yat puNyamarjitaM tena / mAtsaryadukkha ( duHkha ) virahAda guNAnurAgI bhavatu lokaH // Reference. For a fragment of the ending portion of Haribhadra's tika see Keith's Catalogue No. 7499. For a Ms. having the text and an anonymous commentary in Sanskrit see the same Catalogue No. 7501. No. 7502 of this Catalogue records a Ms. having an extract of the text with a Sanskrit commentary, on truth and falsity in the use of a language taken from Haribhadra's tika. In "A History of Indian Literature vol. II, p. 479 n., Dasavaikalika-niryukti-tika is mentioned. N. B. For other details see No. 704. dazavaikA likasUtra niyukti ( dasaveyAliyasuttanijjutti ) No. 710 21 Dasavaikalikasutraniryukti (Dasaveyaliyasuttanijjutti) 1261. 1886-92. Size. 103 in. by 4 in. Extent. 10 folios; 17 lines to a page; 56 letters to a line. Description.- Country paper thin, durable and greyish; Devanagari characters with gears; quite bold, perfectly legible, singularly uniform and very beautiful hand-writing; borders ruled in four lines in black ink; unnumbered sides have one circular disc in red ink, in the centre; the numbered have, over and above this, two more such discs, one in each of the two margins; red chalk used; foll. doubly numbered as 1 to 10 and also as 29 to 38; most probably this is done with a view to mark out a different work and at the same time not to disturb the continuity of the fol ation of the Ms. ; at least the few foll. prior to the 29th must be dealing with off as can be seen from the last

Page #145
108 Jaina Literature and Philosophy [710. lines written on this fol.: complete; this Ms. does not contain Dasavaikalikasutra ; condition very good. Age. - Samvat I492. Begins.- ( Oghanirukti) fol. I (or 294) ghnniymaautto| maraNArAhaNajutto caMdagavijjhaM samANei // 60 This is continued up to GHT OVEzt which goes up to saMgahiyA // 1164. Then we have :zrIodhaniyuktisUtraM navamapUrve tRtIyasAmAcArIviMzatitamaprAbhUtAni(ni) zrIbhadrabAhusvAminA // cha / Begins.-fol. I OM namo vItarAgAya // siddhigaimuvagayANaM kammavisuddhANa savvasiddhANaM / namiUNaM dasakAliyanijjuttiM kittaissAmi // 1 // etc. Ends.-- fol. 106 dave sarIrabhavio bhAveNa ya saMjao ihaM tassa / uggahiyA paggahiyA vihAracariyA muNeyatvA / / 43 (443) aNieyaM pairikkaM annAyaM sAmudANiyaM uch| appovahI akalaho vihAracariA isipasatthA // 44 (444) chahiM mAsehiM ahi(hI)yaM ajjhayaNamiNaM etc. as in No. 71I. ANaMdaaMsupAyaM kAsI sijjaMbhavA etc. as in No. 711. nAyami gihiyabve agihiyavvami ceva atthaMmi / jaiyabvameva iha jo uvaeso so nao nAmaM // 47 (447 ) ( See 285th page of D. L. J. P. F. Series, No. 47 ). savvesi pi nayANaM bahuvihavattavvayaM nisaamittaa| taM savvanayavisuddhaM jaM caraNaguNaddhi(TrI)o sAhU // 48 (448) dazavakAlikanijjuttI mammattA // (See ibid., p. 286). .||ch ||||ch|||| cha / evaM granthAgraM gAthA 448 zloka 558 cha / saMvat 1492 varSe a(A) zva( zci )namAse kRSNapakSe ekAdazyAyAM tithau paM0devaratnagaNibhiH dazavakAlikaniyukti.

Page #146
711.) 11. 4 Malasatras 109 Reference.- Published. See No. 704. In Peterson's Report for 1882-83 (p. 97 ), this niryukti is mentioned. As regards the question of the date of this niryukti see Vidyabhusana's "History of Indian Logic" II and A. M. Ghatage's article The Dasavaikalika-Niryukti" (p. 631). Both of them agree in assigning to it a date nearer the 4th century A. D. dazavaikAlikasUtraniyukti Dasavaikalikasutraniryukti 76 (1). 1880-81. No. 711 Size. -- 144 in. by 2 in. Extent.-- 190 + a few leaves; 3 to 6 lines to a leaf; 40 to 45 letters to a line. Description.- Palm-leaf thin, durable and greyish; Devanagari characters with AETS ; this Ms. presents an appearance as if the work is divided into two separate columns; but, really it is not so ; for, the lines of first column extend to the second ; borders of each of the columns ruled in four lines in black ink ; leaves numbered in both the margins ; in the left-hand one as far, saft, use etc.; several leaves worm eaten ; some very badly ; leat 153 and the following have a part worn out and leaves 191 etc., are in fragments; condition on the whole pretty fair; the ist leaf missing; otherwise complete; extent sso slokas ; this work ends on leaf 426; two extra blank leaves at the end ; ink spread out on leaves 49a and 915; red chalk used; there is one small leaf on which the table of contents is written. This Ms. contains the following additional works :

Page #147
Jaina Literature and Philosophy [7rt. (1) navatattvavicAsAroddhAra (2) vRttisahita leaves 42 to 556 (2) parigrahapra( ? pari )mANa , 56,, 58b (3) mahAvIrakalaza , 58deg ,, 61 (4) parigrahapramANa (zrIsiddhArtha0) ,, 61*,, 660 (5) janmAbhiSeka ,, 66deg ,, 68 (6) gurustuti ,, 68 ,, 700 (7) yatistuti ,, 70deg ,, 7I (8) pauSadhavidhi ,, 710,, 730 (9) manha jiNANaM sajjhAya (svAdhyAya), (10) praznottararatnamAlikA , 74deg,, 760 (1) dharmalakSaNa , 77* ,, 78 (12) catu-zaraNa (13) aSTAdazapApasthAna (14) sAkArapratyAkhyAna , 80deg ,, 8" (15) jinabhavanAdi (16) rAjapraznIyasUtrAvataraNa (17) yogazAstra ,, 83deg,, 122 (18) vItarAgastotra ,, 122deg ,, 139 (19) bhaktAmarastotra (4+ verses) ,, 139 ,, 1450 (20) prazamarasaMpadya leaf. 1456 ( 21 ) bhayahara(namiUNa stotra (23 verses) leaves I45,, I481 (22) vardhamAnastava 148* ,, ISO(23) triSaSTidhyAnakathAnakakulaka ,, I50deg ,, IS4 (24) bhayaharastotra ( 14 verses) ,, I540 ( 25 ) caturviMzabuddhAtizayastotra ,, I56deg ,, 158 (26) ajitazAntistava (40 verses) , 158,, 164 (27) kSetrasamAsa ___ , 164deg ,, I74 (28) ekaviMzatisthAnaka (caSaNavimANA) , 174, 18-* " 81*,, 82,, 82 1560

Page #148
712. J Begins.-leaf 2a ( 29 ) gautamapRcchA ( 30 ) arihaMtavinati ( 31 ) kevalanANasahANaM ( 32 ) micchattakulaya Ends. leaf 424 II. 4 Malasatras No. 712 leaves___1814(?),, cha // dazavaikA likasUtrAdivRhadvRttyavacUri "" 17 leaf ( kAla )o ya Niso / dasakAliya suyasaMdhaM ajjhayaNuddesa NikkhiviraM // 7 // NAmaM ThavaNA davie mAugapayasaMgahekkae ceva / pajjavabhAve ataH (? hA) sacce (te) e ekkagA hoMti // 8 // N. B. For other details see No. 710. chahiM mAsehiM ahIyaM ajjhayaNamiNaM tu ajjamaNaeNaM / chammAsA pariyAo aha kAlagao samAhIe // 186b 189b 189b,, 191(?) 191(?) " ANaMda supAyaM kAsI sejjabhavA tahiM therA / jasabhahassa ya putthA (cchA) kahaNA ya viyAlaNA saMghe // cha / vi (bi)ti (tI) yacUlANijjuttI sammattA || dasaveyAliyaNejjuttI sammattA // cha // zlokAnAM zatAni paMcapaMcAzatyadhikAni // aMko ( ? kataH ) zloka 550 // cha // maMgalamastu // cha // cha // zrIH 74 // -I-II 186b Dasa vaikalikasutradi brhadvrttyavacuri 1169. 1887-91. Size.-- rog in. by 42 in. Extent. --- 17 - 3 = 14 folios; 21 lines to a page; 76 letters to a line.

Page #149
II2 Jaina Literature and Philosophy [712. Description.-Country paper very thin, smooth and grey; Deva nagari characters with pRSThamAtrAs; clear though somewhat small, uniform and good hand-writing ; borders ruled in three lines in black ink; red chalk used ; yellow pigment also used, but very rarely; fol. 13 to 15 missing; otherwise the work is complete ; some foll. slightly worm-eaten; condition tolerably good. Age.- Samvat ISIO. Author.-Not mentioned. Subject..- Explanatory notes to Haribhadra Suri's commentary on Dasavaikalikasutra and two Culikas. Begins.- fol. I* sarvajJAya nmH| ihArthataH zrIvIrakRtasya sUtrato gaNadharakRtasya dazavakAlikasya vyAkhyA // zAstrANyAdimadhyAMtamaMgalabhAMji bhavaMti / iha cAdimaMgalaM drumapuSpikAdhyayanAdi dharmaprazaMsApratipAdakatvAt / tatsvarUpAdityarthaH / madhyamaMgalaM tu dharmArthakAmAdhyayanAdi prapaMcAcArakathAbhidhAyikatvAt / caramamaMgalaM tu sabhizvadhyayanAdi bhikSuguNAdyAlaMbanatvAt / ityevamadhyayanavibhAgato maMgala trayavibhAga uktaH / adhunA mUtravibhAgato dayate etc. Ends. --fol. 17deg kathitaM nAtra bhavatAM doSaH guruparisthApanaM vA vicAraNA saMgha iti / zayyaMbhavena alpAyuSamenamavetya mayedaM zAstraM niryudaM / kiM(kimatra yuktamiti nivedito vicAraNA saMdhe kAlahAsadoSAt / prabhUtasattvAnAmidamevopakArakamatastiSThatvetAdatyevaMbhUtA sthApanA ceti gAthArthaH // 20 // zrIharibhadrasUrikRtabRhadvatteravacUririyaM kRteti / cha / // 1 // saMvat 1510 varSe 'pattana'nagare likhitaM tri vinAyakena bhaTTArakaprabhuzrImunisuMdarasUrivacanAt / /

Page #150
714.] II. 4 Malasatras II3 dazavakAlikasUtrabRhadvRttiparyAya No. 713 Dasa vaikalikasutrabrhadvrttiparyaya 736 (19). 1875-76. Extent.- fol. 24* to 254. Description.-- Complete. For other details see Pancavastuka paryaya No. 736 (1). - 1875-76. Author.- Not mentioned. Subject.-Difficult words etc., occurring in the brhadvrtti of Dasa vaikalikasutra explained in Sanskrit. Begins.- fol. 24deg dazavaikAlikabahavRtteH paryAyAH / boMdIti tanuH guNasattvAMtara jJAnAditi guNAH sattvarajastamAkhyAH / etc. Ends.-fol. 25deg anulvaNayuktati abahudravyaM / ariSTamiti takraM / parisaMsthApaneti sAdhunAmasaMtoSanivAraNaM / sthApanA / dazavaikAlikaparyAyAH samAptAH / dazavaikAlikasUtra Dasavaika likasutrabRhadvRttiparyAya brhadvrttiparyaya 789 (19). No. 714 1895-1902. Extent.- fol. 38a to fol. 40'. Description.- Complete. For other details see Pancavastuka_paryaya No. 1895-1902. in N 789 (I). Begins.--- fol. 38deg dazavaikAlikabRhavRtteH paryAyAH / / etc. as in No. 713. Ends.- fol. 40 anulbaNayukteti etc. as in No. 713. ___N. B..- For additional particulars see No. 713. 15 J. L. P.]

Page #151
114 Jaina Literature and Philosophy 1725. dazavaikAlikasUtra Dasavaikalikasutra bRhavRttiparyAya brhadvrttiparyaya 332 (2). No. 715 A. 1882-83. Extent.-- fol. (?) to fol. 226. Description.-- Since the folios have stuck together, it is not possible to mention where it begins. This work appears to be the same as Nos. 713 and 714. For other details see Nandisutra visama pada paryaya No. 623. Ends.- 3 autofa etc. as in No. 713. N. B.- For further particulars see No. 713. dazavaikAlikasUtra, Dasavaikalikasutra, cUlikAyugala Culikayugala tathA TIkA and tika 104. No. 716 1872-73. Size.- 9; in. by 43 in. Extent.-( text) 62 folios ; 6 lines to a page ; 53 letters to a line. >>-( com.), ,, ; 9 >> >>>> >> ; 69 >> >> >> >> Description.- Country paper thin and greyish ; Devanagari cha racters with occasional TEATS ; this is a grei Ms. ; so the text containing Dasavaikalikasutra and Culikayugala is written as usual in the centre and the commentary above and below it; legible, bold, uniform and beautiful handwriting ; borders ruled in four lines in black ink ; fol, 1 blank; this Ms. contains Dasavaikalikasutra, the two Culikas and their small commentary; all complete; red chalk and yellow pigment used; condition very good.

Page #152
716.] 11. 4 Malasatrds ins Age.-Samvat 1745. Author of the commentary. - Sumati Suri, pupil of Bodhaka. Subject. The text along with the two Culikas and their explana tion in Sanskrit. Begins.- (text) fol. 10 OM zrIvItarAgAya nmH| dhammo maMgalamuktiTuM etc. as in No. 704. ,, - Ist Culika ) fol. 55deg iha khalu bho etc. ,, ,, , , , - ( 2nd ,, ) fol. 59* cUliyaM tu paca( va )kvAmi etc. as in No. 704. ,, - ( com.) fol. 1. namo jinapatibhyaH jayati vijitAnyatejAH surAsurAdhIzasevitaH zrImAn / vimalastrAsavirahitastrilokacintAmaNirvIraH1 / (See p. 106. Cf. the 28th verse of Sakalarhat ) ihArthatastatpraNItasya sUtrato gaNadharopanibaddhapUrvagatodadhRtasya zArIramAnasAtikadukaduHkhasaMtApavinAzahetodezavaikAlikAbhidhAnasya zAstrasyAtisUkSma mahArthagocarasya vyAkhyA prasU( stU yate / tatra etc. Ends.- ( text ) fol. 55 uvei bhikkhU apuNAgamaM gai ti bemi 21 sabhikkhUnAmajjhayaNaM sammattaM 10 -( Ist Calika) fol. 59* jiNavayaNamahiTrijjAsi tti bemi 18 raivakkA paDhamA cUlA sammattA , -( 2nd Culika) fol. 62deg sambaduhANa mu[puvva(cca)i ti bemi 16 vivakkacariyA bIyA cUlA sammattA dasaveyAliya muM akeMdhI (?) samatto. This is followed by the 4 verses which begin with sijjaMbhava and which are found in No. 706. Then we have eyA u do cUlA etc. as the sth verse and thereafter the lines as under : iti niryuktau gAthApaMcakamaunena samagrazrIdazavakAlikaguNanaM / saMvat 1745 varSe zAke 1610 pravarttamAne bhAdrapadazudi 5 bhaumavAsare zrI pattana'nagare mi(idaM pustakaM likhitaM iti maMgalaM.

Page #153
116 Jaina Literature and Philosophy 1716. Ends.- (com.) fol. 62deg vividhamanekaiH prakArairapunargrahaNaparamasvAsvyA(sthyA)pa(pA) dA(donalakSaNavimucyate iti bravImIti pUrvavat samAptA dazavaikAlikaTIkA iti cha mahattarAyA jA(yA)kinyA dharmaputreNa ciMtitA AcAryaharibhadreNa TIkeyaM ziSyabodhinI 1 dazavaikAlika(ka)TIkAM vidhAya yatpuNyamArjitaM tena mAtsaryadu(:)khavirahAd guNAnurAgI bhavatu lokaH 2 dazavaikAlikAnuyogAtsUtravyAkhyAM pRthak kRtA haribhadrAcAryakRtAnmohAdbhaktyA(5)thavA mayA 3 zrImadbodhakaziSyeNa zrImatsumatisUriNA vidvadbhistatra no dveSo mayi kAryo manAgapi 4 yasmAyAkhyo kramaH proktaH sUriNA bhadrabAhunA Avazyakasya niryuktau vyAkhyAkramavipazcitA 5 sUtrArthaH prathamo jJeyo niryuktyA mizritastataH sarvairvyAkhyAkramayukto bhANitavyastRtIyakaH 6 pramodakAryavikSepa(?)cetasAM tadAyaM mayA kriyAyA avabodhArtha sAdhUnAM tu pRthaMkRtaH 7 labdhvA mAnuSya janma jJAtvA sarvAvadAM mataM pramodamohasaMmUDhA vaiphalyaM yena yAMti hi 8 janmamRtyujarAvyAdhirogazokAyupadbhute saMsArasAgare raudre te bhramaMti viDaMbitAH 9 yena punarjJAnasamyaktvacAritravihitAdarAH bhavAMbudhiM samullaMghya te yAMti padamavyayaM 10 iti prazastiH graMthAnaM 2650 zrIrastu saMvat 1745 varSe bhAdrapadazudi 5 bhaumadine mi(idaM pustakaM likhitaM zubhaM. Reference.- For another Ms. see G. 0. Series vol. XXI, p. 18. For information as regards Sumati Suri's commentary see ibid., p. 22.

Page #154
717.1 dazavaikAlikAsUtra, cUlikAyugala tathA TIkA No. 717 99 Size. 10 in. by 41 in. Extent. 71 1= 70 folios; 14 lines to a page; 56 letters to a line. 23 Description. Country paper thin and greyish; Devanagari characters with TS; this is a fret Ms. ; but there is very little difference so far as the sizes of hand-writing for the text and the commentary are concerned; bold, less legible, uniform and good hand-writing; borders ruled in two pairs of lines in black ink; there is some space between these pairs; this Ms. contains Dasavaikalikasutra, the two Culikas and their commentary which is the same as in No. 716; fol. 1a blank; red chalk used; fol. 12th missing hence the corresponding matter missing; fol. 11th ends where the 3rd sutra of the 4th adhyayana terminates, and fol. 13th commences practically with the beginning of the 8th sutra of the same adhyayana; condition very good. Age.- Petty old. Begins. II. 4 Malasatras 35 (Dasavaikalika) fol. r dhammo maMgalamukti ahiMsA saMjamo "" Dasavaikalikasutra, Culikayugala and tika 33 (1st Culika) fol. 64a (2nd ) 68deg cUliyaM tu pakkhAmi (com.) fol. r jayati vijitAnya0 etc. as in No. 716. etc. as in No. 704. 198. 1871-72. "" "" wr ww "" rw dr dr 12 "" Ends.-- ( Dasavaikalika ) fol. 644 ubei bhikakhU apuNAgamamaM gai ti bemi 21 bhikkhU nAmajjhaNaM sammattaM // cha // ( 1st Culika ) fol.684 jiNa ( vayaNa ) mahiTTijjAsi ti bemi 18 rahavakkA naliyaM // cha //

Page #155
118 Jaina Literature and Philosophy 77. Ends.-- ( 2nd Culika ) fol. 71 samvaduhANa mucai na(tti) bemi 16. This is followed by sijjabhavaM gaNahaNa(re) jiNa etc. up to viyAlaNA saMghai.e. to say the first four verses as in No. 706, which are here numbered as 17 to 20. Then we have the following lines: iti zrIdasaveyAlisuyakkhaMdha sammatte no (1) cha // graMthAnaM 2000 mAnaM zubhaM bhavatu // cha ||ch ||ch / -- ( com.) fol. 71 vividhamanekaiH etc., up to yAMti padamavyayaM, the last (the Ioth) verse as in No. 716. This is followed by an additional portion as under : ye bhavyA praticchAdhA janavacane syAdvAdasatnapi na ne vANIzrita vataso vidadhi 2 sattavamArgayogyA na snada sAdhanA vidhibhAnAvasUripadavAmArApayavannira zrA(zrI)maji(ji)nada(de)vasAricaraNA rakSatu saMghaM sadA // 11 // samAptA / cha dazavakAlikaTIkAmiti cha graMthAnasAdhanA / 3000 va? ca) uddsh(s?)||ch|| N. B.- For further particulars see No. 716. vazavakAlikasUtraTIkA Dasavaikalikasutratika 1373. No. 718 1891-95. Size.-- 114 in. by 4 in. Extent.--5o folios ; 16 lines to a page; 48 letters to a line. Description. -Country paper rough and white; Jaina Devanagari characters with occasional A TS; small, clear and very fair hand-writing ; borders ruled in four lines in black ink; this Ms. contains the states of the text; foll. numbered in the right-hand margin only; yellow pigment used; a margin of fol. 6th partly gone; condition tolerably good; the last two foll. seem to have been added to this Ms. by way of replacing the old ones.

Page #156
719.] II. 4 Malasutras 119 Age.- Fairly old. Author.- Sumati Suri. Subject.-A commentary in Sanskrit, explaining Dasavaikalikasutra. Begins.- fol. I OM arha jayati vijityAnyatejAH etc., as in No. 716. Ends.- fol. 49deg vividhamanekaiH etc. up to padamavyayaM 10 as in No. 716. This is followed by zubhaM bhavatu // Reference.- See No. 716. Dasavaikalikasutratika dazavaikAlikasUtraTIkA No. 719 710. 1892-95. Size.-- 104 in. by 44 in. Extent.- 65 folios; 15 lines to a page ; 40 letters to a line Description.- Country paper rough and greyish ; Devanagari cha racters; small, legible and tolerably good hand-writing; borders ruled in three lines in red ink; fol. I blank ; numbers for foll. entered in the right-hand margin only; yellow pigment used ; red chalk, too; complete ; extent 2800 slokas ; condition very good. Age.- Samvat 1663. Begins.- fol. 1 jai namaH jayati etc. as in No. 716. Ends.- fol. 65* vividhamanekaiH etc. up to padamavyayaM // 10 // as in No. 716. This is followed by graMthAnaM 2800 // cha // iti zrIdazavaikAlikaTIkA samAptA // saMvati 1663 vaizAkha vadi 7 dine zrIbRhatkharataragacche zrI. sAgaracaMdrasUrizAkhAyAM zrIvAcanAcAryarAjacaMdragaNivarANAM ziSyavA jayAnadhAnagaNibhiralekhi // 'sAdISAna'grAmAMtaH / zamasta // N. B.-- For others details see No. 718.

Page #157
120 Jaina Literature and Philosophy : 720. dazavaikAlakastra, Dasavaikalikasutra, cUlikAyugala Calikayugala tathA avacUri and avacuri 713. No. 720 1892-95. Size.-- 104 in. by 45 in. Extent. 4 text ) 16 folios ; 8 lines to a page ; 58 letters to a line. ,, -(com.) ,, 16 , , ; 92' >> >> >> >> Description.- Country paper thin and white ; Jaina Devanagari characters; this is a 29 Ms. ; it contains the text, two Culikas and avacuri as well, the last in an extremely small hand; uniform, legible and elegant hand-writing ; borders ruled in red ink ; foll. numbered in the right-hand margin only; mostly, unnumbered sides have a small disc in the centre and the numbered, in the margins, too; the text, the two Culikas and the commentary complete ; condition very good ; red chalk and yellow pigment used. Age.- Samvat 1515. Author of the avacuri.-- Not mentioned. Subject.-- A Jaina agama with a small commentary in Sanskrit. Begins. -- (text) fol. 14 #A: Stauffarital TATT etc. , - (1st Culika ) fol. 156 EE EE n etc. ,, - (2nd >> ) >> 166 pret a etc. >> -- ( com.) fol. 1deg gerata: sherati gustatu az tutuitala - (a tranaeneu urteHTARIA**Tag: HarrearsTTAT: etc. Ends. - (text) fol. 15b jagare etc. up to para as in No. 704. This is followed by samAptaM // - (ist Culika) fol. 16a gazta etc. up to taer as in No. 704. This is followed by reset CGHT II ETArthat afvision of at l J 1 This refers to a horizontal line.

Page #158
72101 11. 4 Malasatras 121 Ends.- ( 2nd Culika ) fol. 16* appA hu khalu etc. up to saMghe // 4 // as in No. 706. This is followed by gAthAcatuSkaM niyuktigatA // iti zrI. dazavaikAlikazrutaskaMdhasUtraM samAptaM // gAthAsaMkhyA // 700 // zlokasaMkhyA // cha / - (com. ) fol. 16 tatra tasminkAle sthavirAH yazobhadrasya ca pRcchA kathanA ca vicAraNA saMghe // 4 // iti niyuktigatagAthAvacUriH ||ch // iti shriidshvkaalikshrutskNdhaavcuuriH|| cha / graMthAnaM 2143 / / zubhaM bhavatu / saMvatu 1515 zake 138 (1) 'bahudhAnya 'saMvatsare zrAvaNazuddha 7 somadine likhitaM // ch| dazavaikAlikasUtra, Dasavaikalikasutra, cUlikAyugala Calikayugala tathA avacUri and avacuri No. 721 435. 1882-83. Size.- 101 in. by 41 in. Extent.- ( text ) 24 folios; 6 lines to a page ; 48 letters to a line. , - (com.) ,, , ; 14 , , , , , 70 , , , Description.- Country paper thin and white; Jaina Devanagari characters with pRSThamAtrAs; this is a tripATI Ms. containing the text, the two Culikas and a commentary ; hand-writing on the whole small, legible and good; borders ruled thickly in red ink ; foll. numbered in both the margins; unnumbered sides have a small square in the centre, only; the numbered, in the margins, too; each of the foll. ra and 246 decorated with the same design in red and blue colours ; both complete ; condition very good. Age.- Pretty old. Subject.-- A Jaina agama along with a small commentary in Sanskrit. 16 [J. L. P.]

Page #159
Jaina Literature and Philosophy - Begins. ( text ) fol. 1 arha / zrIgautamasvAmine namaH // dhammo maMgala etc. -- ( 1st Culika ) fol. 21deg iha khalu bho etc. * ( 2nd ) fol. 234 cUliyaM nu etc. "" ( com. ) fol. ra dharmo maMgalasutkRSTamityanema (na) maMgalamuktaM etc. Ends.- ( text ) fol. 21deg taM dehavAsaM etc. up to ajjhayaNaM as in No. 704. ( 1st Culika ) fol. 232 icceva etc. up to bemi // 18 // as in No. -- 122 22 " 22 " 704. ( 2nd ) fol. 230 appA khalu etc. up to saMghe // 4 // as in No. 706. This is followed by iti zrIdazavaikAlikaM saMpUrNa likhitaM C [ 721. rw biDu' mahAnagare | cha // ( com.) fol. 24deg etAvataiva eti tena zrutena bhA (?) yugapradhAnadharo 'bhaviSyati tato(s) smAdeva kAraNAyuSmAdvacanAcca ziSyapraziSyaiH paSa (Thya) mAnamidaM sumaMgalAya bhUyAn (t ) zrIsaMghAya // 4 // iti zrIdazavaikAlikAcacUriH // // cha // dazavaikAlikasUtra, cUlikAyugala tathA avacUri No. 722 Reference. For a Ms. having the text and an anonymous avacuri see Keith's Catalogue No. 7500. Dasavaikalikasutra, Culikayugala and avacuri 1170. 1887-91. Size.-- ro++ in. by 44 in. Extent.- ( text ) 37 folios; 12 lines to a page ; 32 letters to a line. Description.-- Country paper thick, smooth and grey ; Jaina Devanagari characters with gerars; bold, clear, uniform and elegant hand-writing; borders of the text and those of the two Culikas ruled in four lines in black ink, whereas those of the commentary, in two lines; this is at Ms; so the text is in the middle and

Page #160
722.] 11.4Malasutras ... 123 the commentary on all its four sides, and that the commentary is written in a smaller hand than the text; complete; foll. I. and 37b blank; corners of some of the foll. worn out; condition very fair ; the text, the two Culikas and the commentary complete. Age.- Samvat 1653. Author of the avacuri.- Not mentioned. . Subject.--The text along with two Culikas and a small commentary in Sanskrit. Begins.- (text ) fol. I' dhammo maMgalamukka(kki )etc. as in No. 704. -(com.),, ,, jayati vijitAnya etc. as in No. 716. This is followed by dhammo maMgalamityAdi / ahiMsAsaMyamataporUpo dharma utkRSTaM maMgalaM // etc. ,, - ( Ist Culika ) fol. 34* iha khalu mo etc. as in No. 704. , - ( 2nd , ) , 34 liyaM tu etc. as in No. 704. Ends-- (text ) fol. 34* taM dehavAsaM etc. up to sabhikkhU ajjhayaNaM as in No. 704. ,, - (Ist Culika) fol. 35" icceva saMpassia etc. tti bemi as in No. 704. This is followed by 18 raivakkA nAmaM paDhamaM cUlajjhayaNaM 19... - ( 2nd Culika) fol. 36deg aSpA khalu etc., up to suyakkhaMdho sammatto as in No. 704. Then follows the couple of verses sijjabhavaM etc. and maNagaM paDucca etc. as in No. 706. This is followed by the lines as under: ime niyuktigAthe prathamAdhyayanagate. Then we have: chahi mAsehiM etc. and ANaMdayaMsu etc., the two verses as in No. 706. Then run the lines as under: hame niryaktigAthe atratye 4 saMvat 1653 varSe azvayujamAse prathamapakSe(5)STamyAM tithau mArtaDavAsare zrI vIramapura madhye 'pallIvAlaM gacche upAdhyAyazrIkanakazekharANAM ziSyalezena sumatizekhoreNAlekhi pratiriya sAvariH svaziSyAvalibhirvAcyamAnA ciraM naMdyAt / / . ,, -- (com.) fol. 37deg vicAraNA cirakAlavijayabhAvi // 20 // iti vitikta caryAnAmadvitIyacUDA(lA)'variH // cha // iti zrIdazakAlikAvacUriH samAptA[:] ||ch / zrI Reference.-- See No. 704.

Page #161
I 24 Jaina Literature and Philosophy (723. pazavakAlikasUtra, Dasavaikalikasutra, cUlikAyugala Culikayugala tathA avacUri and avacuri 274. No. 723 A. 1882-83, Size.- 118 in. by 44 in. Extent.-- 18 folios ; 21 lines to a page ; 74 letters to a line, Description.- Country paper very thin, brittle and grey ; Jaina Devanagari characters with TerraS; small but clear, uniform and tolerably good hand-writing ; borders ruled in four lines in black ink; edges of some of the foll. worn out; condition very fair ; this Ms. contains the text along with the two Culikas and the commentary ; but on that account, it is neither a fret nor T rei Ms.; red chalk and yellow pigment as well, used ; the peculiarity of this Ms, is that it does not give the complete verse all at once but it takes it up part by part and explains it. Age.- Pretty old. Author of the avacuri- Not mentioned. Subject.-- The text, two Culikas and a small commentary explain ing them in Sanskrit. Begins.-- ( text ) fol. r* ASE( felg etc. as in No. 704. , -- ( Ist Culika ) fol. 166 TE HE etc., as in No. 704. ,, -- (2nd Culika ) fol. 18a ei a etc. as in No. 704. ,, -- ,, (com.) stop grese for ....... HT Hahat: 193 after staat etc. Ends,- (text) fol. 165 jaard etc., as in No. 704. . -- (1st Culika ) fol. 17 Fota #91" etc., up to 17 dia as in No, 704. ( 2nd Calika ) fol. 186 370gt og etc., up to for ata as in No. 704.

Page #162
724.] II. 4 Malasatras 125 Ends.-- ( com.) fol. 18b istage sura hafa ga Farat atat 113 11 iti dvitIyA cUlA samAptA // iti zrIdazavakAlikAvacUriM // chaM ||ch / Ti ad II JEST TOE etc. Reference. - See No. 704. dazavaikAlikasUtra, Dasavaikalikasutra, cUlikAyugala Culikayugala tathA TabbA and tabba 197. No. 724 1871-72. Size.-- 9} in. by 44 in. Extent.-- (text) 44 folios ; 6 to 7 lines to a page ; 41 letters to a line. >> --(com.) ,, ,, ;12 ,,13 >> >> >> >> ; 57 >> >> >> >> Description. Country paper thin and white; Jaina Devanagari characters with res; this is a fret Ms.; bold, legible and tolerably good hand-writing ; borders ruled in four lines in black ink; fol. 1a blank; so is the fol. 44*; some of the foll. have their edges worn out; condition very fair ; this Ms. contains Dasavaikalikasutra, the two Calikas and their explanation in Gujarati; all complete. Age.-- Samvat 1666. Author of the tabba- Upadhyaya Kanakasundara Gani, pupil of Vidyaratna Gani. Subject.-- The text and the Culikas as before. The explanation is almost throught in Gujarati; only at times it is in Sanskrit; for such cases, see" begins" and "ends". Begins.- ( Dasavaikalikasutra) fol. 1 FAIT FA:1: TFA ATrg etc., as in No. 704. >> -( ist Culika ) m * etc., as in No. 704.

Page #163
[ 724. Jaina Literature and Philosophy Begins.-- ( 2nd Culika) cUliyaM tu paca ( ba ) kkhAmi etc., as in No. 704. -- ( tabba ) fol. rb 126 " 33 - ( tabba ) fol. 42b anaMtarAdhyayane utpravrajitasya sthirIkaraNamuktaM / adhunA vizvi (vi)tta (kta)caryocyate / etc. Ends. fol. 404 ubei bhikkhU apuNAgamaM gai tti bemi // cha // su (sa) bhikkhU adhyayanaM " " praNamya zrImahAvIraM / surAsuranamaskRtaM / dazaivaikAlikasyAyaM / karomi stabukopamaM // 1 prathama maMgalAcaraNagAthA dharmo maMgalamutkRSTaM // dharma te utkRSTa maMgala jANivaM / te dharmanA triNi bheda chai / te kima jIvadayA saMyama te iMdrInuM gopafag saptadazadhA etc. -- ( tabba ) fol. 404 cUlAdvayamArabhyate / bhikSuH kadAcit karmmavazAt sIdet / (a) tastasthirIkaraNaM kartavyaM ityAha / etc. -- -- ( 1st Culika ) fol. 424 jiNavayaNa mahiTTijjAsi tti beti (mi) (18 ) iti vAkyA nAma prathamacUlikA / ( 2nd Culika) fol. 442 savvaduhANa muJca tti bemi // 16 // viva (vi) - ktacaryA nAma dvitIyA cUlA sammattA / / - ( tabba ) fol. 444 vizeSaI vyakta prakaTa yatInI caryA cAlavArUpa dvitIyA bIjI cUlA samAptA saMpUrNA jAtA graM. 82 a. 12 sarva graMthAgra TabbAnaM 1500 zloka a. 12 evaM sUtra Tabbu mIlane graM. 2200 a. 12. zrIvIrajinasya paTTAbharaNazrIgotamagaNapati tatsahatIrthI zrI sudharmmasvAmin tadaMtevAsI zrIjaMbUpaTTe prabhavasvAmI tadanukrameNa vajrasvAmI tadaMtevAsI zrIcaMdrasUri / tadanukrameNa 'caitra'gacchAgacche zrIdhanezvarasUri yena zrIzi(za) va (buM) jayama (mA)hAtma (myaM) kRtaM / tatpaTTe bhuvaneMdumarirabhavat / tatpaTTe zrIdevabhadrasUri suguru ( : ) yena 'tapA' birudaM kRtaM / tathAhi / jiNadattA ' kharayara' | 'puNNima' muNicaMdrasUriNo jAyA / 'pallavIyA' khADhAyarie / 'tavo' mayaM devabhaddAu // 1 // iti vacanAt / tatpaTTAMbarabhAskara' vRdha ( ddha ) tape 'tikhyAtaH zrIvijayacaMdrasUri (rI) sva(zvaro'bhUt / tatpaTTe zrIkSemakIrtigaNaH / yena kRtA zrI. vR (bRhatkalpavRrti (tiH) aSTacatvAriMzatsahasramitA zlokasaMkhyA / yaH zrI

Page #164
II. 4 Mulasutras kSemakIrtisUriNA jAvajjIva SaT vigayasya tyAga ( : ) kRtaH / tadanukrameNa zrIratna siMhasUriH yenA (S) hmapAtasyAha pratibodhitaH // tasyAnvaye sAMpratavatamAne zrIdevaratnasUrIsva ( zva) rapaTTe zrIjayaratna sUrivijayarAjye mahopAdhyAyasyAnvaye upAdhyAyazrI vidyAratnagaNivinayaiH upAdhyAyazrIkanakasuMdaragaNibhiH kRto ( s)yaM stabukaH saMvat vikramArkAt rasarasara seMdu ( 1666 ) vAmagatigaNanAt jJeyaH tatsaMvatsare poSamAsasite pakSe aSTamI ravivAre asva (zvi) nInakSatre saMpUrNeSa stabukaH zrIdazavaikAlika laghuvRrtti (tti ) vilokanAta / kiMcit guruparaMparA to (s) yaM stabukaH / yadazuddhakaTa akSarArtha syAt / tadvibudhaiH zodhanIyo ! zaM (saMzodhya zuddho kriyatAM // sUtragraMtha 700 // zubhaM bhavatuH // : // Reference. -- See No. 704 . 725.1 dharmopadeza (dazavekAlikasUtra ? ) vyAkhyAsahita No. 725 127 Age.--- Not quite modern. Author of the vyakhya. -- Not mentioned. Subject. Dharmopadesa (Dasavaikalikasutra ? ) with vyakhya 1269. 1886-92. Size.-- 8 in. by 47 in. Extent. - 25 folios; 17 lines to a page ; 32 letters to a line. Description.- Foreign paper with water marks Vigo etc.; thin, rough and white; Jaina Devanagari characters; small, clear and fair hand-writing; borders ruled in two lines and edges in one, in red ink; red chalk used; yellow pigment, too, but rarely; fol. 25b blank; complete; condition very good. This Ms. starts with the first verse of Dasavaikalika and goes on elaborately explaining it. Several types of puja too, are described. The various types of dana are discussed.

Page #165
128 Jaina Literature and Philosophy [725. Some stories are also narrated herein. But it is difficult to say exactly what this work is. Begins.- fol. 1a (text) ||prthm kaavymNtr|| OM hrIM hrI hU~ zrI zrI klI blU zrI zrI nmH| atha dvitIyakAvyamaMtraH OM hrIM klIM namaH kumatinivAraNa 2 dhammo maMgalamukti, ahiMsA saMjamo tvo| devA vi taM namasaMti jassa dhamme sayA maNo // 1 // ,, - (com.) fol. I dhammo maMgalAmityAdyapadyaM vyAkhyAyate / iha jagati sarva kAryaprasAdhakaM mahAmaMgalaM zrIjinadharmo bhavati etc. fol. 24* sadanuSThAne viziSTatarakriyAkalApe yo(5) nurAgaH paramA prItiH sa dharmarAgaH iti gAthArthaH bhAvArthastvArogyadvijamidarzanAdaSaseyaH taccedaM etc. Ends.- fol. 25 niAmikaNaM cariyaM imamsa AugAvippassa daDhavvayassa ThihavaM dhazru imAyareha jahA dhuvaM siddhasiriM vareha 36 iti dhammopadeza // manasuSena svavAcanArtha // 711. dazavakAlikasUtra DasavaikalikasutracUlikAyugalAvacUrNi Culikayugalavacurni No. 726 1892-95. Size.-- 104 in. by 48 in. Extent.-- 12 folios ; 26 lines to a page ; 80 letters to a line. Description.--Country paper very thin and greyish; Jaina Deva nagari characters; very small; legible and good handwriting ; borders ruled in three lines in red ink; red chalk used; only the states of the text and those of the two Calikas are given ; complete : condition very good. Age.- Samvat I492. Author.-- Not mentioned. Subject. - A small commentary explaining Dasavaikalikasutra, the two Culikas and a few gathas of the corresponding niryukti.

Page #166
726.] II. 4Malasatras 129 Begins.- fol. IG namaH zrIpravacanAya / ihArthataH zrIvIrakRtasya sUtrato gaNadharakRtasya dazavaikAlikA vyaakhyaa| tatra zAstrANyAdimadhyAMtamamaMgalabhAMji bhavaMti / etc. Ends.-fol. 12 kimatra yuktamiti nivedite vicAraNA saMghe kAlanhAsadoSAprabhUta satsvAnAmidamevopakArakaM / atastiSThatvevaM sthApanA / 20 // iti dazavaikAlikAvacUrNiH / saM. 1492. Then in a different hand we have : 17000 . dazavakAlikasUtra DasavaikalikasutracUlikAyugalAvacUrNi Culikayugalava curni No. 727 1262. 1885-92. Size.-- 104 in. by 41 in. Extent. -- 21 folios ; 19 lines to a page ; 56 letters to a line. Description.- Country paper thin, smooth and grey; Jaina Deva nagari characters with pRSThamAtrA; bold, clear and good hand. writing; borders ruled in three lines in red ink; every side at least in the begining decorated with three small discs, one in the centre and one in each of the two margins; complete : condition very good except that the edges of the first and the last foll. are slightly damaged. Age.- Pretty old. Author.- Not mentioned. Subject.-- A small commentary in Sanskrit explaining the original text and the two Culikas. Begins.- fol. I dhammo dharma utkRSTaM maMgalaM bhavati / sa ca ahaM(hiM)sAsaMyamatapo rUpaH / tatra ahiMsA jIvadayA etc. Ends.- fol. 21 vicAraNA cirakAlavijayabhAvi / idama'dhyayanamiti // 4 // atra zrIzayyaMbhavamUrikathAnakaM jJeyaM // cha // iti shriidshvaikaalikaa'vrnnirkssraarthgmnikaa|| cha / zubhaM bhavatu // cha / 1 The second Culika consists of 16 gathas. The gathas of the niryukti herein explained are numbered in continuation, hence we find this number here, 17 IJ.L.P.]

Page #167
130 Jaina Literature and Philosophy [728. dazavaikAlikasUtra DasavaikalikasutracUlikAyugalAvacUri Culikayugalavacuri No. 728 1182 (3). 1884-87. : Size.- Iod in. by 4g in. Extent.-- 22 folios ; 20 lines to a page ; 65 letters to a line. Description.-- Country paper very thin and greyish; Jaina Deva nagari characters; very small, clear, uniform and good hand-writing; borders ruled in two lines in black ink ; red chalk and yellow pigment used; foll. at times numbered in the right-hand margin; this Ms. contains the tales of the text and those of Culikayugala ; complete ; condition on the whole tolerably good; for, only the right-hand corners and the edges of several foll. are worn out; this Ms. contains additional works as under : (1) pAkSikasUtrAvacUrNi foll. 14 (2) to 220 (2) kSAmaNakAvacUrNi , 22 , 22b. Author.- Yasobhadra Suri, pupil of Sricandra seems to be the author. For, he has composed the last work mentioned here. Subject. - A small commentary in Sanskrit on Dasavaikalikasutra and its two Calikas. Begins- fol. IOM namaH srvvide|| jayati vijitAnyatejAH etc. up to cuuddaamnniviirH||1|| Then we have : saMhitAdiSaDvidhA vyAkhyA / durgatau prapataMtamAtmAnaM dhArayatIti dharma: etc. Ends.- fol. 14deg iti zayyaMbhavenAlyAyumenamavetya mayedaM zAstraM nirmUDhaM kimatra yukta miti nivedite vicAraNA saMgho duHkha(pa)mAka( kA )la(da) hAso(do)SA(t) prabhUtasattvAnAM(nA)midamevopakArakamatastiSThatvetaditi // 13 // iti zrIdazavaikAlikAvacUriH samAptA /

Page #168
II. 4Malasatras 131 729.1 dazavakAlikasUtracUlikAyugalAvacUri No. 729 DasavaikalikasutraCulikayugalavacuri 712. 1892-95. Size.- IIT in. by 4g in. Extent.-- 31 folios ; 15 lines to a page ; 56 letters to a line. Description.- Country paper thin and whitish; Jaina Devanagari characters with pRSThamAtrAs; small, legible and good handwriting; borders ruled in two pairs of lines in black ink; the space between these pairs coloured red; foll. numbered in the right-hand margin only; unnumbered sides have a small disc in red colour, in the centre; the numbered, in each of the two margins, too; red chalk used; this Ms. gives the status of the text and those of the two Culikas; the com mentary complete; condition very good; for, only the last fol. is slightly worm-eaten. Age. - Pretty old. Subject.- Dasavaikalika surta, the two Culikas and the 4 gathas of the niryukti commented upon, in Sanskrit. Begins - fol. I' dhammo maMgalamukka, dharma utkRSTaM maMgalaM / ahiMsA saMjamo tavo ahiMsA saMyamastapaH // tatra ahiMsA jIvadayA etc. Ends.- fol. 31 kimatra yuktamityukte vicAraNA saMghe duSyago(?)mAyAM prabhUtasattvAnA midamevopakArakaM / ati(ta)stiSThatvevaMbhUtA sthApanA // 20 // iti zrIdazavaikAlikAvari // cha // etc.

Page #169
132 SaDAvazyaka sUtra' ( saDAvassayasutta) No. 730 Jaina Literature and Philosophy -- I THE THIRD MULASUTRA Size. 9 in by 4 in. Extent. 8 folios; 14 lines to a page; 46 letters to a line. Description. Country paper thin, tough and greyish; Jaina Devanagari characters; small, legible and elegant hand-writing; borders ruled in three lines mostly in red ink; edges, in one; fol. 1 blank except that a table of measurements etc. is written on it in Gujarati; red chalk used; complete so far as it goes; condition good. (1) dIkSAkulaka (2) jayatihuyaNastotra (3) rAisaMthAragAthA (4) jJAnapaJcamI stuti (5) aSTamItapastuti ( 6 ) caturviMzati jinastuti (incomplete) This Ms. contains the following additional works : foll. 4b to 5b 5b 7b 8a (7) pAkSikakSAmaNaka dw "" fol. dr "" 13 Age. - Old. Author. A Ganadhara according to some. Sadavasyakasutra (Sadavassayasutta) "" 8a This is a title as recorded in some Mss. and works. 95 8b 1730. 1174 (a). 1887-91. 13 7b 8a 8b Sukhlal does not hold this view. He has explained his view in Hindi introduction to his edition of "Pancapratikramana" and its Hindi translation published by Atmananda Jaina Pustaka-Pracaraka Mandala, Agra in A. D. 1921. This view is challenged by Ramavijaya (now styled as Ramacandra Suri) in his Gujarati work". sanAtana satyano sAkSAtkAra " ( pp. 1-67).

Page #170
730.) III. 4 Malasatras 133 The view that Ganadhara is the author of the Avasyakasutra is expressed in Gujarati in the introduction to "sfira R$ 19TEAT" pt. I. This view is refuted by Sukhlal in a book-let " navakAramaMtra yA paMcaparameSThI ane Avazyaka # afHTE TEFT (Tigraf HE TUA f)" published by Sri Jaina yuvaka sevasamaja, Ahmedabad, in Samvat 1983. Anandasagara Suri, in his introduction to his edition of Avasyakasutraniryukti and. Malayagiri Suri's commentary says that Ganadhara is the author of the Avasykasutra. Subject.- This is a mulasutra as stated in Keith's Catalogue. It deals with several sutras which are associated with six avasyakas! So Salavasyakasutra may be roughly defined as a collection of the sutras to be daily uttered twice, once in the morning and once in the evening, while performing the six essential duties (avasyakas) viz. (1 ) samayika, (2) caturvimsatistava, (3) (guru )vandana, (4) pratikramana, (s) kayotsarga and ( 6 ) pratyakhyana. The propriety of this order is discussed in Siddhacakra (vol. IV, No. 9, pp. 201-202.) In this issue, it is explained why pratikramana is used as a synonym for a collection of the six avasyakas. Sadavasyakasutra given in this Ms. consists of a number of sutras. They are as under : 1 As regards the synomyms of Avasyaka, its importance, its six divisions, and their explanation etc. in Gujarati see my " Arhatadarsanadipika " pp. 822-829. 2 H. D. Velankar strikes a different note in his work "A Descriptive Catalogue of Sanskrta and Praksta Mss. in the library of B. B.R. A. S." (vols. III-IV). For, there (p. 397), he mentions as one of the six avasyakas, caityavandana instead of caturvimsatistava. Moreover he mentions the six avasyakas in the following order: Caityavandana, Kayotsarga, Guruvandana, Samayika, Pratikramana and Pratyakhyana. He supports this statament on p. 397 by saying: "This is the order in which they are given in the Mss." Furthermore, on p. 399 he identifies Vandittu sutra with Pratikranianasutra.

Page #171
134 faina Literature and Philosophy 1730. (I) navakAramaMtra (namaskAramantrax or namaskArasUtra*). (2) jagaciMtAmaNi (prabodhacaityavandana*) (3) jaMkiMci (tIrthavandanamUtra*) (4) namutthuNaM (zakrastava or praNipAtadaNDaka'). (5) jAvaMti ceiyAiM (sarvacaityavandana* ). -- (6) jAvaMta ke vi sAhU (sarvasAdhuvandana* ). (7) uvasaggaharathotta (upasargaharastotra x or pArzvanAthastava'). (8) jaya vIyarAya (praNidhAnamUtra* ). (9) iriyAva hiya (I-pathikIsUtrax or airyApathikIsUtra'). (10) tassa uttarI (uttarIkaraNasUtra* ). (II) annattha (kAyotsargasUtra*). (12) logassa (nAmastava or caturvizatistava). (13) sabalAeM arihaMtaceiyANaM (caityastava). (14) pukakharavara (zrutastava). (15) siddhANaM buddhANaM (siddhastava ). (16) saMsAradAvAnalastuti ( vIrastutisUtra ). (17) suguruvaMdanasUtra (dvAdazAvatarvandanakasUtra* or vandanakasUtra). (18) devasia AlouM (devasikAlocanAsUtra). (19) saMthArA odriNakI if same as rAtrikAticAra*. (20) abbhuTrio (gurukSAmaNAsUtra* or kSAmaNAsUtra ). (21) karomi bhate (sAmAyikasUtra). (22) jaya mahAyasa. (23) Ayariya uvajjhAe (AcAryAdikakSAmaNaka* ). (24) zrutadevatAstuti. (25) kSetradevatAstuti. . (26) sirithaMbhaNayapAsanAhathui. (27) sAmAyikapoSadhapAraNagAthA'. * This cross indicates a Sanskrit name ( equivalent) for the corresponding Prakrit one. * This name as well as all other names marked with an asterisk, have been given from the edition of "sAdhusAdhvIdevisakarAtrikapAkSikacAturmAsikamAMvatsarika pratikramaNAni prakIrNakavidhisaMyutAni SaDAvazyakasUtrANi". These names have been used by the editor whose name though not mentioned, is Anandasagara Suri as can be surmised. This edition has been published by Sresthi Rsabhadevaji kesarimalaji Jaina Svetambara Samstha, in Samvat 1992. 1 This name is taken from Lalitavistara. It is mentioned by Hemacandra Suri, too, in his commentary (p. 2164) on Yogasastra ( III, v. 124). 2 This name is given in the svopajna vrtti (p. 2134) of Yogasastra ( III, v. 124). ___ In the anukranmanika of this work we have this very name (kAyotsargasUtra). 3 Each of these 27 sutras except the 19th is separately treated, while describing certain Mss. Sce infra.

Page #172
730.] III. 4 Malasatras 135 All these 27 sutras' are not be found in the Avasyakasutra ( Avassayasutta ). Furthermore, some of the sutras occurring in the Avasyakasutra are not given here. In order that this remark may be properly grasped, I give below a list of the sutras which appear to constitute the Avasyakasutra-the sutras as noted by Haribhadra Suri in his Sisyahita, a commentary on Avasyakasutra and its niryukti : (I) karomimaMte p. 454. (2) logassa pp. 494, 501', 507b and 510. (3) bandanakasUtra p. 546 and 5466. (4) cattAri maMgalaM mUtra p. 569. (5) cattAriloguttamAsUtra p. 570*. (6) cattArisaraNaMsUtra p. 571". (7) icchAmi paDikkamiuM jo me devasio0 (prAtakramaNamUtra) p. 571". (8) iriyAbahiyasUtra (gamanAticArapratikramaNa) p. 573deg. (9) icchAmi paDikkamiuM pagAma (zramaNasUtra) pp. 574, 575', 576deg, 5773, 579, 611', 6159, 644', 655, 725*, 7289, 731, 760, 761, 761, 7629, 762deg and 763". (10) icchAmi ThAiuM kAussaggaM jo me devasio aiAro kao0 ___p. 778. (II) tassa uttarI p. 7794. (12) annattha p. 7794. savvaloe arihaMtaceiANaM p. 786". (14) pukharavara p. 7881. (15) siddhANaM buddhANaM p. 789". (16) icchAmi khamAsamaNo ! uvaTTiomi abhitara pakikhaaM khAmeDaM panarasa divasANaM. p. 7920. (17) pAkSikakSAmaNAsUtra' p. 793" and 793". (18) samyaktvAlApaka sAticAra p. 811. (13) 1 These sutras constitute what are known as " Pratikramanasutras." For their name, style, source etc. see my article "pratikramaNasUtronuM paryAlocana" published in an issue of the " Jain" dated 23rd February 1936. 2 This sutra is counted as four sutras which are respectively referred to as vitiyakhAmaNAsutta, tiiyakhAmaNAsutta, ca utthakhAmaNAsutta and paMcamakhAmaNAsuna as the previous satra here numbered as 16 is there looked upon as par3hamakhAmaNAsutta,

Page #173
136 Jaina Literature and Philosophy 1730. " P. 822.. (19) prathama vrata (sthUlaprANAtipAtaviramaNa) sAticAra p. 818 and 8186. (20) dvitIya, (sthUlamRSAvAdaviramaNa) , p. 820b. (21) tRtIya, (sthUlAdattAdAnaviramaNa) ( 22 ) caturtha ,, (sthUlAbrahmaviramaNa) ,, p. 823deg and 8230. (23) paJcama , (sthUlaparigrahaparimANa) , p. 8250. (24) SaSTha , (dikaparimANa) , p. 827 (25) saptama ,, (bhogopabhogaparimANa) p. 8284. (a) upabhogAdiparimANa sAticAra p. 829. (b) karmAdAna p. 829 ( 26 ) aSTama vrata (anarthadaNDaviramaNa) sAticAra p. 830. (27) navama , (sAmAyikavrata) , p. 831. (28) dazama ,, (dezAvakAzika) , p. 834. (29) ekAdaza,, (pauSadhopavAsa) , p. 835. (30) dvAdaza, (AtithisaMvibhAga) , p. 837. (31) saMlekhanAvicAra pp. 838deg and 8394. (32) namaskArasahita pratyAkhyAna p. 849". (33) pauruSIpratyAkhyAna p. 852'. (34) ekAzanapratyAkhyAna p. 8534. (35) nirvikRtikapratyAkhyAna p. 854br. Out of these Nos. 2, 14 and 15 are metrical compositions containing 7, 4 and 5 verses respectively. Nos. 9 and 27 have 2 and 3 verses respectively ; the remaining portion is in prose. It may be mentioned en passant that the 35 sutras noted above do not belong to one and the same adhyayana I Anandasagara Suri in his edition of "nandyAdigAthAdyakArI iyuto viSayAnukamaH" ( Agan.odaya Samiti Series, No. 55) has mentioned the sutras noted by Haribhadra Suri. There he has given the serial number for these stitras from I to 54. My number (2) is not counted by him. No. 2 is counted in sutragatha. He has numbered Sramanasutra as Nos. 8 to 25. Nos. 11 and 12 of mine are considered as one by him. No. 17 is counted as four numbers ( 32 to 35). This will explain why my number comes to 35 and his as 54. It may added that it appears that really speaking he ought not to have given separate sutrankas for the paras of Sramanasutra.

Page #174
730.] III. 4 Malasatras 137 atigabahyae (6) Pratyakh (4) Pratiky of Avasyakasutra'. That is to say ( 1 ) belongs to Samayikadhyayana, (2) to Caturvimsatistavadhyayana, (3) to Vandanadhyayana, (4) to (9) to Pratikramanadhyayana, ( 10 ) to ( 18 ) to Kayotsargadhyayana and ( 19 ) to ( 35 ) to Pratyakhyanadhyayana. Vacaka Umasvati in his bhasya (p.90).on Tattvarthadhigamasatra (I. 20) has noted (I) Samayika, (2) Caturvimsatistava, (3) Vandana, (4) Pratikramana, (5) Kayavyutsarga and (6) Pratyakhyana as some of the varieties of angabahyasrutajnana. Begins. - fol. I' namo arihaMtANaM etc. up to havai maMgalaM. Then we have: 8saM. 859 guru 7 laghu 61 evaM 68 jayau sAmI risaha 'settaji' etc. Ends.- fol. 4b yAsAM kSetragatAH saMta sAdhavaH zrAvakAdaya jinAjJAM sAdhayaMtastA rakSatu kSetradevatAH siri thaMbha sasAmiNo sesatitthasAmINa titthasu(sa )ma(munnaya(i)kAraNaM surAsurANaM ca savasiM 1 Then we have the 2nd verse. Then again we have five verses, the last ( 5th ) being as under : sAmAiyaposahasaMThiyassa jIvassa jAi jau(jo) kaalo| so saphalo bodhavo seso saMsAraphalaheU 53 Reference.-- Avazyaka is mentioned in Hemacandra Suri's laghuvrtti (p. SI) on his own work Siddhabaima (II. I. 33) as under : " uddiSTametadadhyayanamatho enadanujAnIta, etakaM sAdhumAvazyakamadhyApaya , atho enameva sUtrANi / " It is also mentioned in this laghuvrtti (p. 73 ) on Siddhahaima (II. 2. 43 ) in the following line : "mAsena mAsAbhyAM mAsairvA AvazyakamItam / " I This work consists of six adhyayanas; so it is called Adhyayanasatka and Adhyayanasatkavarga as well. . . .. 2 For this see p. 147. . 3. This occurs on p. 8 of the Appendix to Sukhlal's edition of Pansapratikraa mapa referred to on p. 132. 18 U.L.P.

Page #175
138 Jaina Literature and Philosophy [ 730. I do not know if there is any printed work which contains nothing else but the sutras given in this Ms. No. 730. Almost all the sutras given here are printed with some more along with their explanation in Gujarati in the edition of Sri-Pratikarmanasutra published by Sravaka Bhimasimha Manaka in A. D. 1888. This edition contains additional matter such as navasmaraNas and devabandanAdibhASyatraya. Practically all the sutras given in this Ms. are also printed in the edition named as paJcapratikramaNAdisUtrANi and published by Sri Jaina Sreyaskara Mandala, Mhesana, in Samvat 1971. This edition contains chaya, sabdartha, Gujarati translation etc. Sukhlal's edition noted on p. 132 may be also con sulted. The 27 sutras noted on p. 134 are mostly to be found in several other editions containing only two Pratikramanasutras. They occur in Sadavasyakasutrani noted on P. 134. Some of the sutras occur in Hemacandra Suri's commentary on his own work Yogasastra, in Vardhamana Suri's Acaradinakara, in Manavijaya's svopajna commentary on Dharmasamgraha, in the edition containing Lalitavistara and in the edition containing Vandaruvrtti. Out of these, the sutras commented upon in Lalitavistara and Vandaruvrtti are noted in the description of these very works which are included in this Part III. So, here I shall first of all mention the 23 sutras commented upon in Yogasastra and 29 in Dharmasamgraha, the two works included in Vol. XVIII under "Darsanika literature", and then 31 noted and explained in Acaradinakara. The commentary on Yogasastra (Prakasa III) contains the following works :Page-No'. with vyakhya 2132 to 214 ( 1 ) airyApathikIsUtra * 214b (2) tassa uttarI (3) annattha * 214a 214b 215b wr dr 33 dr "" "" I The page--number given here belongs to the edition of Yogasastra and its *stopajna commentary, published by Sri Jaina dharma prasaraka Sabha, Bahvnagar. This sign is here used to point out that the sutra under question is split up into parts, while being commented upon.

Page #176
130. ul. 4 Malasetras 139 2280 230 233 234 240 245 2460 245 3526 354. Page-No. (4) namotthu NaM* with vyakhya 216 to 223deg (thayapADha) (5) arihaMtaceiyANa* 223* , 224 (6) caturviMzatistava 224 , 228 (7) zrutastava' (8) siddhastava 230* (9) jaya vIyarAya 233* (10) suguruvandanasUtra 237 (1) devasikAlocanAsUtra 244* _245 (12) savvassa vi 245 (13) gurukSAmaNAsUtra* (14) namaskArasahitapratyAkhyAna, (15) pauruSIpratyAkhyAna 252 , 253 (16) pUrvArdhapratyAkhyAna 253 , 2530 (17) ekAzanapratyAkhyAna " 253* , 254 (18) ekasthAnapatyAkhyAnapratIka, (19) AcAmAmlapratyAkhyAna " 254deg (20) abhaktArthapratyAkhyAna (21) pAnakAkArasUtra 255. (22) divasacaramabhavacaramapratyAkhyAna " " 255deg (23) vikRtipratyAkhyAna , " 256* ___ In Upadhyaya Manavijaya's commentary (pt. I.) on his own work Dharmasamgraha, we have the following sutras' with their explanation in Sanskrit : Page-No. . (1) IryApathikIsUtra 142* to 143" (2) tassa uttarI 144deg , 144 (3) annatya 144b , 145 * See the corresponding foot-note on p. 138. 1 These are mostly given in parts, while being commented upon. 2 This page-number refers to the edition published in D. L.]. P. Fund Series as No. 26, in A. D. 1915. 3 This is the name given by the author himself. 4. Some portion of this sutra is not mentioned. 355

Page #177
140 I 2 ( 4 ) (5) ( 6 ) (7) ( 8 ) Jaina Literature and Philosophy natthu NaM arihaMtaceiyANaM caturviMzatistava zrutastava siddhastava vaiyAvRttyakarasUtra (9) ( 10 ) jaya vIyarAya ( 11 ) (12) savbassa vi suguruvandanasUtra (13) gurukSAmaNAsUtra ( 14 ) namaskArasahita pratyAkhyAna ( navakArasI ) ( 15 ) pauruSI pratyAkhyAna ( 16 ) ( 17 ) (18) ( 19 ) pUrvArddhapratyAkhyAna ekAzanapratyAkhyAna AcAmAmlapratyAkhyAna abhaktArthapratyAkhyAna pAnakAkArasUtra' (20) ( 21 ) divasacaramabhavacaramapratyAkhyAna (22) bikRtipratyAkhyAna (23) vaMdittasUtra ( 24 ) (25) zrutadevatAstuti ' (26) kSetradevatAstuti' Ayariya uvajjhAe It runs as under : * Page-No. 1466 to 153b 153b 154b 155a 158a 158b 160a 5 3 This is as follows: 184b 186a " " 223a 234b 235a 235a " "" 163a 163a 164a 174b rob 181a 181a 22 22 "" 187a 187b 1876 188a 188b 189a 189a 189b "" "2 " " 32 160 1632 'suyadevayA bhagavaI, nANAvaraNIya kammasaMghAyaM tesiM khaveu sayayaM, jesiM suasAyare bhattI // 1 // "" 182a " jIse khitte sAhU, daMsaNanANehiM caraNasahiehiM / sAhaMti mukkhamaggaM, sA devI harau duriAI // 1 // " This is as under: " pANassa levADeNa vA alevADeNa vA accheNa vA bahuleNa vA sasittheNa vA asittheNa va! boMsirai. 77 188b 189b 234b 235a 17.30.

Page #178
730.| III. 4 Malasatras 141 Page-No. (27) vardhamAnastuti' 255 to 2350 (28) vizAlalocana 2350 (29) varakanaka 235 , 236 In the 38th udaya ( chapter ) of Acaradinakara we have Avasyakavidhi. This chapter begins with the enumeration of the six types of avasyaka and the explanation of samayika. The following 31 sutras along with their Sanskrit explanation are given in this work : Page-No.. (I) sarvaviratisAmAyikasUtra' 2610 (2) dezaviratisAmAyikasUtra (3) navakAramaMtra 264 (4) zakrastava with com. 265 , 267* (5) caturvizatistava 268 (6) arhaccaityastava (7) zrutastava 2686 ,, 2690 (8) siddhastava* 2690 , 271 (9) vaiyAvRttyakarasUtra (10) jAvaMti cehayAI (10) jAvaMti ke vi sAhU (12) jaya vIyarAya: " , 2710 (13) suguruvandanasUtra 2750 , 277* (14) airyApathikIsUtra* 2774 , 278 2680 2710 1 This is the name given by the author. It is otherwise known as "namo'stu vardhamAnAya", the words with which it begins. 2 This page-number is given from the printed edition published by Pandit K. O. Khamgamwala, Bombay, in A. D. 1923. 3 This sutra is styled here as Dandaka and is explained on pp. 262b-2634. 4 This is explained on p. 2634. It is styled as zrAddhasAmAyikadaNDaka on p. 305b. 5 This sutra is explained on pp. 264 and 265a. This very satra is again given on p. 3750. ___* See the corresponding toot-note on p. 138. 6:9 These are respectively styled as Caityasmarana, Sadhusnmarana, Bhagavatprarthana and Vandanasutra.

Page #179
142 Jaina Literature and Philosophy 1730. 98 280 , .. 2801 " 2810 2816 2822820 294. 3050 " 317 319 Page-No. (15) tassa uttarI with com. 278 (16) atIcArAlocana' to 279 (17) yatirAtrikAticAra (18) sayaNAsayaNNa' (19) aticArASTaka* (20) gurukSAmaNA' (21) Ayariya uvajjhAye' (22) pAkSikAdikSAmaNa 282 (23) zramaNasUtra * 2830 (24) pAkSikasUtra* 294 , (25) vaMdittusUtra 305deg , 311 (26) annattha 3II , 31 (27)dazavidhAddhApratyAkhyAna (28) bhayavaM dasaNNabhaho (77 verses+a line in prose),, (29) barakanaka (30) atIcAragAthASTaka , 325 , 326. (31) dazavidhapratyAkhyAna , 331* , 331b The three sutras viz. Logassa, Suguruvandanasutra and Karemi bhante are printed in Roman characters along with the German translation in " Ubersicht uber die AvasyakaLiteratur", published by Walther Schubring in A. D. 1934. For Mss. styled as Sadavasyaka see Limbdi Catalogue Nos. 2660-2663 and 2666-2671. Out of them, Nos. 26671 This slightly differs from devasikAlocanasUtra. 2 This is only one gatha as under : "sayaNAsayaNNapANe be(ce )iya je(jai) si(se )ja kAya uccAre / samiIbhAvaNaguttI vitahArakaraNe a aiArA // " This is almost the same as 1498th gatha of Avasyakasutraniryukti. 3-4 These are styled as kSAmaNa and sayAdikSAmaNa respectively.. 5-6 These are respectively styled as yatipratikramaNasUtra and zrAddhapratikramaNasUtra. 7 Out of these, the first four verses are practically the same as those given on pp. 7-8 of the appendix to Pancapratikramana (Sukhlal's edition ). 8 This is No. 4 of the series known as "Alt und Neu-Indische Studien ". 324

Page #180
730. ] III. 4 Malasatras 143 2663 contain anonymous balavabodha, too. Nos. 26662671 contain tabba. Therein No. 2667 has a tabba by Samaracandra and No. 2669, a tabba by Jinavijaya. For description of Mss. styled as Sadavasyakasutra see B. B. R. A. S. vols. III-IV, pp. 397-399'. In this Catalogue Nos. 1535 and 1536 given on p. 400 contain over and above Sadavasyakasutra, Merusundara's balavabodha and an earlier but anonymous balavabodha respectively. In Keith's Catalogue, No. 7495 gives the description of a Ms. styled as Salavasyakasutra and a balavabodha in bhasa (Gujarati ). For other details see Weber II, p. 739fn., Indische Studien vol. XVII, pp. 50-76, Indian Antiquary vol. XXI, p. 329ff, Leumann's "Ueber die Ava Cyaka-Literature" (Actes du X* Congress international des Orientalistes IIdegc, parte section I, p. 125, Leide, 1895, E. Leumann's "Die Avasyaka-Erzahlungen", Leipzig, 1897, "Essai de Bibliographie Jaina " Nos. 58 and 374, G. O. Series vol. XXI, p. 24, Winternitz, Geschichte Vol. II (p. 315), A History of Indian Literature vol. II, pp. 429, 470, 476n., 481, 485, 489n., 536, 575 and 589, Z. D. M. G. vol. XXXIV (Jacobi's article on Kalakacarya-katha) and vol. XXXVII (Leumann's article on Kalikacarya-katha ) and Die Lehre der Jainas ( p. 81 ). On pp. 397-399 we have in Devanagari characters the following sutras: - (1) Navakaramantra, (2) Pranipatasutra, (3) Iriyavahi (this is not separated from the former ; that is a slip ), (4) Tassa uttari, (5) Anpattha (this, too is not, separated from the former ), (6) Sakrastava, (7) Arihantacaiyanam styled as Caityastavadandaka, (8) Caturvimsatistava, (9) Srutastva also styled as Siddhantastava, ( 10 ) Siddhastava, ( 11 ) Jaya viyaraya, (12) Suguruvandanasutra styled as Guruvandana, ( 13 ) Daivasikalocanasutra without any specific name, (14) Savvassa vi, ( 15 ) Abbhuthio (this is not separated from the foriner; once more a slip), (16) Samayikasutra styled as Samayika, (17) Vandittusutra also styled as Pratikramanasutra, and (18-28 ) eleven Pratyakhyanasutras.

Page #181
144 SaDAvazyaka sUtra No. 731 Jaina Literature and Philosophy Size. 7 in. by 6 in. Extent. 17 folios; 13 lines to a page; 17 letters to a line. Description. Age. Samvat 1946. Author. Foreign paper with an elephant-brand as the watermark; Jaina Devanagari characters; quite bold, big, legible and good hand-writing; borders ruled in three lines in red ink, whereas edges singly; numbers for foll. entered twice as usual; foll. 1a and 17 blank; complete; the ending portion includes Snatasyastuti, too, which is also treated as a separate work in some Mss.; condition very good. Sa davasyakasutra 1131. 1891-95. [ 731. More than one Jaina saint. For instance, it is said that Snatasyastuti is a composition of Balacandra, a pupil of Kalikalasarvajna Hemacandra Suri. Begins.-- fol. rb OM namaH | zrIgoDipArzvajinAya namaH / Subject. This work mostly in Prakrit consists of sutras some of which are not to be found in the previous work', and thus it differs from it. Ends. fol. 16a namo arihaMtANaM / namo siddhANaM / namo AyariyANaM / namo uvajjhAyANaM / namo loe savva sAhUNaM / eso paMcanamukkAroM (ro) savvapAvappaNAsaNa ( No ) / maMgalANaM ca savvesaM (siM) paDhamaM havaI (i) maMgalaM // I (i)chA (cchA) mikhamAsamaNo' etc. iccAya (? i) mahAsaIo jayaMtu akalaMkasIlakaliAo / ajja vivajjara (i) jAsiM jasa paDha (Da) o (ho) tiU (hu) aNe sayale / iti zrIsvAdhyAya (H) / I For instance, the last sutras viz. Bharahesarasajjhaya ( styled as Silavadadiguhasmaranasutra in Sadavasyakasutrani) and Snatasyastuti are not there.... 2 This sutra is usually known as Pranipatasutra. In the contents of "Sadavasyakasutrani ", it is styled as "Sthobhavandanasutra" and "Khamasamana" as well. -:

Page #182
732.1 III. 4 Malasutras snAtasyApratimasya 'meru' zikhare zacyA (cyA) vibho (:) zaizave / rUpAlokanavismayAhRtarasabhrAMtyA bhramaccakSuSA / unmRSTaM nayanaprabhAdhavalitaM kSIrodakAzaMkayA / vaktraM yasya punaH punaH sa jayati zrIvarddhamAno jinaH // 1 // haMsAMzA (sA) hatapadmareNukapizakSIrArNavAMbhobhRtaiH / kuMbhairapsarasAM payodharabharaprasparddhibhiH kAMcanaiH / yeSAM 'maMdara' ratnazailazikhare janmAbhiSekaH kRtaH / sarvaiH sarvamurAsurezvaragaNaisteSAM ta (na)to'haM kramAn // 2 // arhakaprasUtaM gaNadhararacitaM dvAdazAMgaM vizAlaM / citraM bahvarthayuktaM munigaNavRSabhairddhAritaM buddhimadbhiH / mokSAgradvAra bhUtaM vratacaraNaphalaM jJeyabhAvapradIpaM / bhaktyA nityaM prapadye zrutamahamakhilaM sarvalokaikasAraM // 3 // niSpaMkavyomani (nIla (yuti) malasadRzaM bAlacaMdrA bhadaMSTraM / mattaM ghaMTAraveNa prasRtamadajalaM pUrayaMtaM samaMtAt / ArUDho divyanAgaM vicarati gagane kAmadaH kAmarUpI / yakSa (kSaH) sarvAnubhUtiM (ti) di(rdi ) zatu mama sadA sarvakAryeSu siddhiM // 4 // iti zrISaDAvazyakaM saMpUrNa / saMvat 1946 suMdaralAlakA / Reference. 145 All the sutras given here seem to be published in one or the other editions of Pancapratikramanasutras mentioned in No. 730. SaDAvazyakasUtra A Sa davasyakasutra 871. 1892-95. No. 732 Size.- 8 in. by 42 in. Extent.- 27 folios; 7 lines to a page ; 20 letters to a line. Description.-- Country paper somewhat thick, rough and white ; Jaina Devanagari characters; quite bold, very big, perfectly 19 [J. L.P.]

Page #183
Jaina Literature and Philosophy ( 732. legible and elegant hand-writing: borders ruled in two lines in crimson ink, whereas edges, in one line; fol. 1 marked with diagrams; white paste used instead of the yellow pigment; complete so far as it goes; condition very good. Age.-- Samrat 183 ( 1835?). Begins.-- fol. 1 An: li snifeyrar FA! TAN BROEMOT etc. as in No. 731. Ends.- 26* Tag AEHS etc., up to Fof ll as in No. 731. This is followed by a line as under : 867(?) ao 341eft accia perontaa N. B.-- For further particulars see Nos. 730 and 731. Tetamu Sadavasyakasutra 242. No. 733 1871-72. Size.--- 93 in. by 44 in. Extent.- 6 folios ; 12 lines to a page ; 31 letters to a line. Description.- Country paper thin and white; Jaina Devanagari characters with quarat ; bold, big, quite clear and good hand-writing; foll. 19 and 60 blank ; borders as well as the edges ruled in two lines in red ink; red chalk used; edges of the last two foll. slightly damaged ; condition good; complete so far as it goes. Age.- Pretty old. Author.- Not mentioned. Subiect. - A collection of sutras connected with the six avasyakas. Begins.- fol. 1 OTANC FEATUD etc. as in No. 731.

Page #184
733.] III. 4 Malasatras "147 Ends.- fol. 6. siri thaMbhaNa'TriyapAsasAmiNo / sesatitthasAmINaM / titthasamunnaikAraNaM surAsurANaM ca savvesi // 1 // esamahaM saraNatthaM kAusaggaM karemi sattIe / bhattIe guNasa(su)hiya(ssa) saMghasya samunnAnimittaM // 2 // karomi kAusaggaM iti zrISaDAvazyakasUtraM / Reference.- See No. 730-732. I These two verses are given on p. II (Appendix ) of the edition of " Pancapratikramana" published with Hindi translation from Agra, in A. D. 1991.

Page #185
48 namaskAramantra ( navakAra maMtra ) No. 734 Jaina Literature and Philosophy namutthu NaM ( zakrastava ) Size. 9 in. by 38 in. Extent.-43-2-1-1-1-2-36 folios; 9 lines to a page; 35 letters to a line. ( 8 ) uvasaggaharathotta ( 9 ) jaya vIyarAya ( 10 ) praNipAtasUtra (11) IryApathikIsUtra ( 12 ) tassa uttarI (13) annattha Description. Country paper somewhat thick, rough and greyish; Jaina Devanagari characters; big, fairly legible, uniform and good hand-writing; borders ruled in four lines in black ink; red chalk used; foll. numbered in the right-hand margin just in a corner; each and every fol. worm-eaten in several places; so, in a few cases, the numbering is gone; condition fair; red chalk used; there is some space kept blank in the centre of the numbered and the unnumbered sides as well; yellew pigment used while making corrections; fol. 1 blank; complete; this work ends on fol. 1; this Ms. contains in addition the following works:(1) jayau sAmiu ' fol. 1b jaM kiMci ( 2 ) (3) varakanaka ( 4 ) (5) jAvaMti ceiyAI (6) jAvaMta ke vi sAhU ( 7 ) namo'rhat ( parameSThinamaskAra ) 19 39 .. 29 23 Namaskaramantra (Navakaramantra) 39 23 29 2a 222 22 2a 26 2b 1270 (1). 1887-91. foll. 2b to 3a fol. 3a 3b 3a 3b 3b to [ 734. 223 2b to 3b 1 This is practically same as without the first gatha. 2. This is the name given by Sukhlal in his edition of Pancapratikramana referred to on p. 132.

Page #186
734.] III.4Malasatras foll. 3b to fol. 43 foll. fol. 53 to 5 __, 50 to 6a . foll. 50 fol. 6 , 6 foll. 66 fol. 7a (14) logassa (nAmastava) (15) caityastava (16) annattha (17) pukkharavara (zrutastava) (18) suyassa bhagavao (19) caityastava (20) siddhANaM buddhANaM (siddhastava) (21) veyAvaccagarANaM (vaiyAvRttyakarasUtra ) (22) annattha (23) pArzvastuti (24) paJcadevastuti (kallANakaMdastuti ) (25) AdinAthastuti (26) neminAthastuti (27) saMsAradAvAnalastuti (28) suguruvandanasUtra ( 29 ) devasiya AlouM (AlocanasUtra) (30) savvassa vi (sarvasyApi ) ( 31 ) abbhuTTio (gurukSAmaNAsUtra ) (32) aDrAijjesu (33) vaMdinusUtra ( 34) lUNapANIvidhi (35) ArAtrika ( 36 ) maGgalapradIpa (37) kusumAJjali (38) mahAvarikalaza (39) AbhiSeka (40) mahAvIravRddhakalaza (41) dhUmAvalI (42) devakAba (43) guruchappA (44) namiUNa (bhayaharastotra) (45) tijayapahutta (saptatizatastotra) (46) bRhacchAntistotra ,, ? , 103 10 10b foll. 11- (2),, 12 fol. 12 ., 12 foll 12b . 13a , 143 , 13 fol. 140 foll. 14b 160 1. 7 ,263 28a

Page #187
150 Jaina Literature and Philosophy ( 47 ) laghurAvAMvalI ( 48 ) yogazAstra ( 49 ) bhaktAmara stotra ( 50 ) ajitazAntistava ( 51 ) bhAvanAkulaka ( 52 ) namaskAraphala ( 53 ) zrAvakAvadhi fol. 28 to 28b foll. 28b 31b fol. 31b; foll. 34 to 35b foll. 35 to 39a 40b 42a 42a 43b "1 Age.- Old. Aurhor. Not mentioned. dw 99 39a 41a 99 99 d. [ 734. "" Out of these sutras, 1-33 may be said to be constituting what is, roughly speaking, known as Sadavasyakasutra. Foll. 8, 9, 11, 24, 25, 32 and 33 are missing; so the corresponding works are incomplete. Subject. This entire work in Prakrit deals with obeisance to the five Paramesthins and its fruit. It is styled as Mahasrutaskandha. Each of its first five padas such as namo arihaMtANaM etc. is looked upon as an adhyayana. The portion following these five adhyayanas' is called culika, and it shows the importance of the five adhyayanas. Some look upon this culika as redundant. This view is refuted in "Siddhacakra" (vol. IV, No. 3, p. 67). There it is remarked that in that case, the first and the last verses of Logassa, and the verse beginning with ar which forms a part and parcel of Pukkharavaradivaddhe should be discarded. It is further observed that the last pada of this Mahasrutaskandha occurs in Mahanisithasutra. So those who substitute for are not justified in doing so. An additional criticism is made as under : 1 Just as there is in Avasyakasutraniryukti niksepa and sutrasparsikaniryukti respectively in the beginning and end of every adhyayana, so we have beginning and end for these five padas (adhyayanas). That is why this entire work (Pancamangala) is designated as Mahasrutaskandha Vide "Siddhacakra" vol. IV, No 3, p. 67.

Page #188
735. MI). 4. Malasairas. 151 It is true that there are five padas in the beginning of Bhagavatisutra; but, on that account, the rest cannot be said to be interpolated. For those who look upon only the first five padas as genuine ought not to have discarded AAT Satg fair as it is tantamount to a khandana of a sutra. Begins.- fol. IT & HAT H TTTT: 11 namo arhNtaannN| namo siddhaannN| namo aayriyaannN| namo uvjjhaayaannN| namme loe / svsaahunnN| Ends. - fol. 1b TA T T I Fra(a)199 (COOTHUTI maMgalANaM ca / samvesiM paDhamo(ma) havai maMgalaM // 1 // Reference.- Published. It is also edited by me with Sanskrit rendering and Gujarati translation. See "The third Kiranavali" ( Arhatajivanajyoti ) pp. 49-50. Namaskaramantra is given by way of quotation in the svopajna commentary (p. 371 ) on Yogasastra (VIII, 34). For other details see No. 730. namaskAramantra Namaskaramantra No. 735 1269 (1). 1887-91. Size.- 12 in. by 49 in. Extent. -- 76 folios ; 14 to 15 lines to a page ; 52 to 58 letters to a line. Description.- Country paper thin, durable and grey ; Jaina Deva Dagari characters with frequent BATETS; bold, legible, uniform, neither too big nor too small and elegant handwriting ; borders ruled in two lines in black ink ; the interlinear space coloured red; foll. numbered in the right

Page #189
152 Jaina Literature and Philosophy [ 735. hand margin ; fol. ra blank ; unnumbered sides are decorated with a small disc in red colour in the centre, whereas the numbered, in each of the two margins, too; red chalk used; strips of white paper pasted to the edges of the first fol. ; condition on the whole good; complete ; this work ends on fol. 1b; this Ms. contains in addition the following 67 works : (1) IryApathikImUtra ( 2 ) tassa uttarI (3) ( 4 ) ( 5 ) ( 6 ) annattha logassa (nAmastava ) namatthu NaM ( zakrastava ) caityastava (7) annattha ( 8 ) caityastava (9) zrutastava (10) suyassa bhagavao ( 11 ) caityastava fol. 1b 99 99 22 22 foll. fol. 2a "" 27 39 23 29 22 22 19 29 22 "" ( 12 ) siddhastava (13) vaiyAvRttyakarasUtra ( 14 ) annattha ( 15 ) jAvati ceiyAI ' ( 16 ) jAvaMta ke vi sAhU ( 17 ) cirasaMciya ( 18 ) namo'rhat (19) upasargaharastotra ( 20 ) jaya vIyarAya ( prArthanAsUtra ) ( 21 ) suguruvandanasUtra ( 22 ) AlocanAsUtra ( 23 ) savvassa vi (24) gurukSAmaNAsUtra ( 25 ) sAmAyikasUtra (26) AlocanAsUtra ( 27 ) zrAddhapratikramaNasUtra 1-3 These three may be looked upon as only a portion of Vandittusutra. " 93 93 72 99 21 "" 29 "" 99 "" 99 "" 21 99 22 99 " b 99 30 22 99 99 foll. to 3 4a 99 to 2b 3a to 2b 97

Page #190
735.] III. 4 Malasatras 153 fol. 4 foll.,, , 50 5b.. fol. 110 foll. 12a (28) Ayariya uvajjhAe (29) jo ko vihu pANigaNo (30) upavAsapratyAkhyAna (31) , (32) , (33) granthisahitapratyAkhyAna (34) vikRtipratyAkhyAna (35) ekAzanapratyAkhyAna (36) ekasthAnapratyAkhyAna (37) abhaktArthapratyAkhyAna (38) divasacarimapratyAkhyAna (39) sAdhu( yati )pratikramaNasUtra (40) pAkSikasUtra (41) pAkSikakSAmaNaka (42) dazavaikAlikasUtra cUlikAdvayasahita (43) upadezamAlA . (44) piNDavizuddhi (45) zIlopadezamAlA (46) snAtasyAstuti (47) jIvavicAra (48) vivekamArI (49) guruvandanakabhASya (50) pratyAkhyAna (51) bhAvanAsandhi (52) caityavandanabhASya (53) caupai (Guj.) (54) yogIvA0 (Guj.) ( 55 ) snAtradhUpakSepalavaNottAraNalUNavidhi AratImaGgalapradIpottAraNavidhi (56) AdijinezvarajanmAbhiSeka . "354 fol.40a foll. 41b.. fol. 50 foll: 50b , 512 fol.51 , 516 I 2 This work is here described on p. 101. See No. 707. This work is described in Pt. I on p. 369. See No. 412. 20 U. L. P.1

Page #191
154 Jaina Literature and Philosophy [735 , 556 (57) mahAvIrakalaza foll. 51 to 520 (58) bRhacchAntistotra , 52b , 530 (59) laghuzAntistotra fol. 530 (60) pazcaparameSThistavana ___, 54* (61) gautamapRcchA (62) yogazAstra (I-IV) (63) vItarAgastotra ., 65 , 69 (64) avagAhanAdvAra , 69 , 71. (65) gatidvAra fol. 71 (66) saGgrahaNIratna foll. , , 756 (67) bhaktAmarastotra ,, 750 , 760 Out of these sutras, I to 28 may be said to be com ponent factors of Sadavasyakasutra. Age.- Old. Begins.- fol. I // 6 // arha // namo arihaMtANaM Ends. - fol. I' eso paMcanamukkAro etc. up to havai maMgalaM // 1 // as in No. 734. N, B.- For other details see No. 734. . namaskAramantra Namaskaramantra No. 736 1106 (1). 1891-95. Size.-- 10 in. by 48 in. Extent.- 58 - I = 57 folios ; 14 lines to a page ; 35 to 40 letters to a line. Description.- Country paper thin, tough and white ; Jaina Deva nagari characters; big, clear, uniform and good hand-writing; borders ruled in three lines and edges mostly in two, in red ink ; red chalk and yellow pigment used; foll.

Page #192
736.] I III. 4 Mulasutras ISS numbered in both the margins; a piece of paper of the size of a fol. pasted to fol. 14; condition on the whole good : foll. 1(c) and 58b blank ; this work ends on fol. 1b; conplete; fol. 9th missing; this Ms. contains the following additional works : (1) jayau sAbhi ( jagacintAmaNi ) (2) jaM kiMci (3) zakrastava ( 4 ) jAvaMti ceiAI (5) jAvaMta ke vi sAhU namo'rhat upasargaharastotra jaya vIyarAya (6) ( 17 ) ( 8 ) ( 9 ) praNipAtasUtra (10) IryApathikI mUtra ( 11 ) tassa uttarI (12) annattha (13) nAmastava ( 14 ) caityastava ( 15 ) zrutastava ( 16 ) suassa bhagavao ( 17 ) caityastava (18) siddhastava (19) vaiyAvRttyakarasUtra ( 20 ) annattha ( 21 ) saMsAradAvAnalastuti ( 22 ) suguruvandana sUtra ( 23 ) devasikAlocanAsUtra (24) ( 25 ) - gurukSAmaNAsUtra ( 26 ) sAmAyika sUtra (27) ( 28 ) pauSadhasUtra See p. 148, ft. note 1. 39 "9 fol. 1b foll. 99 fol. 2a 29 99 99 19 39 99 29 99 99 39 99 99 39 99 39 39 93 39 foll. fol. 34 foll. 99 99 99 : 2b 39 " 39 19 94 39 "" 99 vs 19 "" fol. 4a 39 93 " 91 4b to 2a 99 " " 20 3a vn

Page #193
156 Jaina Literature and Philosophy ( 29 ) Ayariya uvajjhAe (30) jaya mahAyasa (31) zrutadevIstuti (32) bhavanavAsinIdevIstuti ( 33 ) kSetradevatAstuti (34) zrutadevatA stuti ( 35 ) pAkSikastuti (36) vardhamAnastuti ( 37 ) namo'stu vardhamAnAya ( 38 ) sAmAyika pauSadhapAraNagAthA ( 39 ) ajJAtanAmadheya ( 40 ) sAdhvati cAragAthA ( 41 ) gocaracaryAgAthA ( 42 ) AkAra saGkhyAgAthA ( 43 ) dazavidhapratyAkhyAna ( 44 ) caukkasAya ( 45 ) sAdhu ( yati ) pratikramaNasUtra (46) pAkSikakSAmaNA ( 47 ) AlocanA (48) upadezamAlA (49) vaMdittasUtra ( 50 ) rAI saMthAragAthA ( 51 ) jaya tihuyaNastotra ( 52 ) ajitazAntistava ( 53 ) namiUNastotra (54) taM jayau ( 55 ) gurupAratantryasmaraNa ( 56 ) sigdhamavahara ( 57 ) uvasaggaharathotta (58) laghuzAntistotra (59) bhaktAmara stotra ( 60 ) kalyANamandirastotra (61) bhAvArivAraNastotra fol. 5a 99 99 39 27 79 39 99 39 foll. 39 wr 99 29 fol. 6a 22 33 59 99 25 99 "" 22 43 29 33 99 foll. 64 fol. b foll. " " 11b fol. 12 foll. 12b 14a "" " 93 5b ", 15b 16b 18b 22 " 224 to 5b 23a : 99 " 99 31 18b 22a 23a 24a 37 fol. 24 2 24b foll. 24b,, 254 fol. 25* foll. 254 26a 28a 3ob " 79 22 " 33 "" 6a " 8b 11b 12a 12b 142 15b 16b 26a 28a 30b ,324 [736.

Page #194
" 40b " 420 foll. 42deg ,, 43* 736.] Ill. 4 Malasutras 157 (62) duriyarayastotra 32 to 34 (63) jIvavicAra 34* ,, 36 (64) navatattva 363, 38 (65) laghusaGgrahaNI ,, 38,, 390 (66) tijayapahuttastotra " 39deg,, 40% (67) navagrahagarbhitapArzvanAthastotra ___fol. 40* ,, 40deg (68) aSTamIstuti (69) paJcamIstuti foll. 10 ,41 (70) navapadastuti fol. 41*,, 410 (71) ajitajinastuti ,, 41 (72) zItalajinastuti foll. 41deg ,, 42 (73) pAcajinastuti fol. 42* ,, 42 (74) nemijinastuti (75) jinakuzalasUrikRtastuti (76) caturvizatijinastuti fol. 43 (77) jinastuti , 43* ,, 43 (78) sImandharasvAmistuti ,, 43deg (79) pArzvajinastuti foll. 43deg ,, 44* (80) viMzativiharamANajinastuti fol. 444. (81) neminAthastuti ,, 44* ,, 44 (82) bIrastuti ,, 44 (83) pArzvajinastuti foll. 44' ,, 45 (84) zatraayastuti fol. 45 (85) dIpAvalIstuti , 45* (86) mahAvIrastuti (87) maunaikAdazIstuti , 450 (88) paryuSaNAstuti foll. 45deg ,, 46 (89) aSTamIstuti fol. 46 (90) sarasvatIstotra ,, 46, 460 (91) saGgrahaNIsUtra foll. 46 ,, 58 Out of these sutras, I to 38 seem to constitute Sada vasyakasutra. Age.- Samvat 1840. , 45*,, 450

Page #195
158 Jaina Literature and Philosophy Begins. fol. 1 aftari etc. Ends. fol. 1 eso paMcanamukkAro etc. up to havai ( vai) maMgalaM N. B.- For additional information see No. 734. - namaskAramantra (1) jIrikApallisvAmizrIpArzvajinastuti ( 2 ) bhayahara ( namiUNa stotra No. 737 Size. 10 in. by 5 in. Extent. 39 folios; 16 lines to a page; 44 letters to a line. Description. Country paper sufficiently thick, tough and greyish in colour; Devanagari characters; bold, legible and fairly good hand-writing; borders ruled regularly in two lines in red ink and margins singly in the same ink; red chalk used for marking the numbers and the titles of different works; white pigment used in place of the yellow pigment; the first fol. is little bit torn; the last three are damaged, perhaps corroded by white ants; condition tolerably good; the last fol. written in a different and bigger hand by some one else; fol. 1 blank; complete; this Ms. contains the following works in addition : (3) upasargaharastotra (4) jaM kiMci (5) zakrastava (6) cintAmaNipArzvastuti (7) pArzvajinastotra ( 8 ) zaGkhezvarapArzvajinachanda (9) gauDI pArzvanAthachanda motIdAmastuti Namaskaramantra 575 (1). 1895-98. 1736. fol. 1b foll. 1b to 2b fol. 2b "" 35 foll. 2b 3a fol. 3a,, 3b 36 foll. 3b,, 5b 5deg,, 7a dr "" wr

Page #196
737.) III. 4 Malasatras (10) padmAvatIpUjanavidhi (II) padmAvatIkavaca ( 12 ) padmAvatIsahasranAmastotra (13) padmAvatIstotra ( ? kalpa ) (14) padmAvatIchanda (15) padmAvatIvidhi ( 16 ) padmAvatIpUjAmantravidhi ( 17 ) padmAvatI pUjA''hUti sarvavidhi ( 18 ) (19) ( 20 ) ( 21 ) ( 22 ) cakrezvarIstotra kSetrapAlachanda (stuti) annapUrNAstuti annapUrNAstotra sAradAstotra ( 23 ) jvAlAmukhIstotra (24) sarasvatIstotra ( anubhUtisiddhi ) (25) sarasvatIdvAdazamAsachanda (26) aDayalanAma sarasvatIchanda ( 27 ) sarasvatIchanda (28) sarasvatyaSTaka ( 29 ) sarasvatIstotra ( 30 ) paThitasiddhasArasvatastotra ( 31 ) bhAratIstotra (32) lakSmIdevIstotra (33) sarasvatyaSTaka (34) sarasvatI devIstotra (35) bAlatripurAchanda ( 36 ) ambikAchanda (37) paJcAGgulIchanda (38) gaNapatipAhADagatichanda (39) gaNezachanda ( 40 ) gaurakSetrapAlanImANI ( ? ) ( 41 ) laghustavastotranyAsa ( 42 ) tripurAstotra fol. 72.,, 7b foll. 7b ga 22 ga "" "" fol. 14b ,, 12a 13b 13b 146 " , I2" 22 "2 fol. 243,, 24b foll. 24b,, 254 26a fol. 25*,, 25b foll. 25b :, fol. 26 26b foll. 26b 27a 272,, 27b fol. foll. 27b 28b 91 28b 29b "" " 159 -15b -23b "" " 29b fol. 30b foll. "" >> 31a fol. 314,, 31b foll. 31b " 32a fol. 32 " " "2 30b "" 326 foll. 32b, 33b 33b 34a fol. 342, 34b foll. 34b,, 35* fol. 35+-,, 35b foll. 35b,, 37* fol. 37b foll. "" "" 38b

Page #197
160 Jaina Literature and Philosophy 737. " 39 (43) bAlAtripurAstotra foll. 38 to 39 (44) bAlatripurApaddhatyAdi (?) fol. 39* ,, 39 (45) jinastuti (?) Age.-Not older than the nineteenth century, see the 23rd folio. On fol. 26b there is the date viz. Samvat 1889. See Saradastotra. Begins.-fol. Ib zrIpAzvajinAya namaH // namo arihatANaM / etc. Ends.- fol. 10 maMgalANaM ca samvesiM paDhama hoi maMgalaM // 1 // N. B.- For other detals see No. 734. namaskAramantra Namaskaramantra No. 738 640 (8). 1895-98. Size.-II in. by 6, in. Extent.- II folios ; 17 lines to a page ; 46 letters to a line. Description.-Country paper thick, tough and white; Devanagari characters; bold, legible, uniform and elegant handwriting ; borders carefully ruled in three lines in red ink, and the margins singly in the same ink; condition very good; complete ; this Ms. contains in addition the following works:(1) upasargaharastotra fol. 1b (2) bhayaharastotra foll. 1b to za (3) jaya tihuyaNastotra 2,, 4 (4) ajitazAntistava (5) cintAmaNipArzvastotra (6) bhaktAmarastotra 4deg,,

Page #198
739.] .: I11. 4 Malasatras 161 (7) Trilareala folla : 8a to gb (8) CHAFFIT >> 90,; 106 (9) J AMIE .. . 106, 11b Age.- Samvat 1940. Begins.-- fol. 16 THT SIPEATUi etc., as in No. 737. Ends. -- fol. 16 Ararui T etc., as in No. 737. Reference.-- This sutra is given as an avatarana in the syopajna commentary of Yogasastra (VIII, 34). For further particulars see No. 734. namaskAramantra Namaskaramantra No. 739 350 ( a ). A. 1882-83. Size.- 104 in. by 4; in. Extent.- 11-1=10 folios ; 15 lines to a page ; 60 letters to a line. Description.- Country paper sufficiently thick, tough and greyish; Devanagari characters with centrs; bold, legible, uniform, neither very big nor very small and elegant handwriting ; borders ruled carefully in two pairs of lines in black ink; there is some space left between these pairs; red chalk used; complete; condition good ; this Ms, contains in addition the following works :(1) Therma fol. 1b (2) faruga (Falastafarm ) foll. Ib to 2a (3) TATE fol. 2o ,, 25 (4) HUFATE foll. 26, 3a (5) FTATEATS (Incomplete). , 39 (6) Sferatifeafta fol. 66 (7) JUFTIAFT foll. 66, ya (8) sifat >> 78, 82 21 ( J. L. P.)

Page #199
162 Jaina Literature and Philosophy [ 739. (9) Pertama foll. 82 to 10 (10) AT fagurala ,, 109 ,, ITD The fifth folio is missing, so the corresponding works are affected. Age.- Old. Begins.-- fol. 1 TH A Il displate )a9.stefania AGTO FRA: HT Shigatur I etc. Ends.- fol. 1deg ANTION THAT GA ETT ATTI 3131 N. B.- For additional information see No. 734. namaskAramantra Namaskaramantra 885 (a). No. 740 1892-95. Size.-- 104 in. by 4; in. Extent.-- (text) 13 folios ; 1 to 2 lines to a page ; so letters to a line. >> (com.) , o ; II ,, ,,,,, ; 55 ,, to a line. Description.- Country paper somewhat thick, tough and white; Jaina Devanagari characters with occasional TeaTETS; this is a frgret Ms.; the text written in big, quite legible, * uniform and very good hand-writing; practically same is the case with the commentary except that it is written in a slightly smaller hand-writing; foll. numbered in the right-hand margin: fol. 1a originally blank has been later on utilised by some one for writing some items connected with the Dikpalas ; condition very good; both the text ja and the commentary complete; the latter ends on fol. 28; this Ms. contains in addition the following works:

Page #200
140.] :: LIB. 4. Malasutras ! 163 (1) upasargaharastotra TIkAsahita foll. 2 to 3b.. (2) saptatizatastotra , , 3 , 7 (3) bhayahastotra , 7 , 13 Age.- Samvat I792. Author of the commentary.-- Vacaka Siddhicandra, pupil of Bhanucandra. For his life and works see my Sanskrit bhumika (pp. 72-84) of Stuticaturvimsatika published in A. D. 1930, and for information in Gujarati see "zAsanaprabhAvaka guru-ziSya bhAnucaMdra ane siddhicaMdra" published in " Jainacharya Shri Atmanand Centenary Commemoration Volume" ("jainAcArya zrI AtmAnaMda janma zatAbdi smAraka graMtha"), pp. 225-245. Subject. -- The text together with its explanation in Sanskrit. Begins.- ( text ) tol. I" e60|| zrIsarvajJAya nmH|| namo arihaMtANaM etc. as in No. 734. , -(com.) fol. 1b . :||shriignneshaay nmH| zrInAbhayaH zriyaM dadyAtmarAmaranamaskRtaH / vighnAnekapapaMcAsyo dadhadvizvajanInatAM / 1 / akbbrsrtraannhRdyaaNbujssttpdH|| bhAnucaMdrazciraM jIyAd gurumeM vaackaapnniiH|2| / aSTottarazatAnAM yo'vadhAnAnAM vidhaayk| dadhAnaH 'pusphahameM ti birudaM zAhinA()rpitaM / 3. navAbokacaMdreNa siddhicaMdreNa srvdaa| buddhibai vi(vi)taMdreNa bAlAnAmalpamedhasAM / 4 / zazvatsaptasmaraNAnAM rattireSA vidhiiyte| tatra tAvannamaskAra eva vyAkhyAyate mayA / 5 / tribhirvizeSakaM / / namo arihaMtANamiti / namo namaskAra kebhyaH / etc. Ends.- (text) fol. 2* savvapAvappaNAsaNo etc. up to maMgalaM / 1 / as in No. 734.

Page #201
2164 Jaina Literature and Philosophy [ 740. Ends. (com. ) fol. 22 FF TTETTHET I Ta gertat i set as det vizrAmasthAnAni tatra sapta ekaikapadA / aMtyA tu dvipadeti namaskArArthaH / Reference.-- Both the text and the commentary are included in Anekartharatnamanjusa ( pp. 1-6 ) edited by me and published in Sheth D. L. J. P. F. Series as No. 81 in A. D. 1933. For other details see No. 734. namaskAramantra Namaskaramantra bAlAvabodhasahita with balavabodha 742. No. 741 1892-95. Size.--91 in. by 41 in. Extent.-- 4 folios ; 12 lines to a page ; 34 letters to a line. Description.- Country paper rough and grey ; Devanagari chara cters; big, clear and tolerably good hand-writing ; borders ruled in four lines in black ink; red chalk used; yellow pigment, too; edges of all the foll. are slightly damaged; condition on the whole good; both the text and its explanation complete so far as they go, that is to say the culika and its explanation are not to be found here. Age.- Old. Author of the balavabodha.-- Not mentioned. Subject.-- Obeisance to the five Paramesthins in Prakrit and its explanation in detail in Gujarati, with quotations in Prakrit. Begins.-- (text ) fol. 14 afediu - (com.) fol. 14 HTETT TAFETT Benia Hiaat ganti fosfor a stata etc.. Ends.- (text ) fol. 36 FAI JIS HET HIEU I

Page #202
742.] III.4 Malasutras 165 Ends.- (com.) fol. 4 aDhAI dvIpa mAhi ja ke chaha sAdhu savi huM sAdhu teha pratai mAharau namaskAra paMcAMga praNAma trikAlavaMdanA sadA sarvadA havau // iti zrIpaMcaparameSTi(SThi)namaskAra samApta // Reference. - See No. 734. namaskAramantra Namaskaramantra bAlAvabodhasahita with balavabodba 1365. No. 742 1891-95. Size.- Iof in. by 4g in. Extent.-5 folios ; II lines to a page ; 40 letters to a line. Description.-Country paper thin, rough and white; Jaina Deva nagari characters with frequent TEHETS; big, legible, uniform and good hand-writing; borders ruled in two pairs of lines in black ink ; the space between these pairs coloured red; foll. numbered in the right-hand margin ; fol. sb blank; both the text and the commentary complete so far as the first five padas are concerned; condition tolerably good. Age.- Old. Author of the balavabodha.-Not mentioned. Subject. The text in Prakrit together with its explanation in Gujarati. Begins.- ( text) fol. I' namo arihaMtANaM // etc. ,, - (com. ) fol. I' arihatanai mAharau namaskAra hu kisyA chai te arihaMta / rAgadveSarupiA ari vayarI haNyA chai jeNe te arihaMta valI kisyA chaha // etc. Ends.- (text ) fol. 5. namo loe sambasAhUNaM

Page #203
Jaina Literature and Philosophy [ 742: Ends. -- ( com. ) fol. 52 nirahaMkArI / nipa ( ( pa )rigrahI nirAraMbhI / zAMta dAMta ratanatrayasAdhaka aDhAI dvIpa mAhi jike chaI sAdhu te savi huM sAdhu pratiiM mAharu namaskAra paMcAMgapraNAma trikAlavaMdanA sadA sarvadA hu // 5 // iti zrI caityavaMdana paMcapadanamaskArasArtha saMpUrNa // cha // zubhaM bhavatu kalyANamastu // zrI // N. B. -- For other details see No. 734. 166 namaskAramantra bAlAvabodhasahita No. 743 Extent.-- fol. 424 to fol. 43b. Description. The text up to five padas; the commentary ends abruptly. For other details see No. " Author of the balavabodha. -- Not mentioned.. Subject. The text and its explanation in Gujarati. Begins. -- ( text ) fol. 422 Namo arahaMtANaM / etc. " Namaskaramantra with balavabodha - Ends. ( text ) fol. 43deg Namo loe savva sAhUNaM 571. 1875-76. (com) fol. 424 zrI arihaMtaniM mAhAru sadA kAla namo ( ( ) stu / te zrIarahaMta kehavA chi / zrIsamosaraNa virAjamAna / etc. 593 (c). 1875-76. namaskAra mantravyAkhyA No. 744 - (com) fol. 43deg zrI sAdhuniM mahAru sadA kAla mamo ( s) stu / te zrIsAdha kehavA chi || paMcamahAvrata dhAre / / paMca. Namaskaramantravyakhya 1241 (a). 1884-87. Size.-9 in. by 49 in. Extent.~ 26 + 1 = 27 folios; 19 lines to a page ; 60 letters to 1 line.

Page #204
744.] ... III.4Malasatrae 167 a Description.--Country paper thick, tough and white; Jaina Deva nagari characters ; small, fairly legible and tolerably good hand-writing ; borders not ruled ; foll. numbered in the right-hand margin ; fol. 19th repeated ; red chalk used ; fol. 260 blank; condition very good ; complete ; this Ms. contains the status of the text ; this Ms. contains in addition the following works:(1) upasargaharastotravRtti foll. a to (2) zAntikarastavArthANu (3) bhayaharastotravivRti (4) laghuzAntistavavyAkhyA (5) saptatizatastotravyAkhyA (6) ajitazAntistavavivaraNa (7) bhaktAmarastotraTIkA (8) bRhacchAntistavavivaraNa " 23* ,,26. Age.-Samvat 1873. Author.- Harsakirti Suri. Subject.-- Commentary on Namaskaramantra which is looked upon as the first smarana out of seven. Begins.-- fol. 1 // ahe| praNipatya jinaM vakSye saptasmaraNeSu vivaraNaM kiMcit yasmAnmaMdamatInAmApa bhavati sukhena tadvodhaH 1 yataH parvadineSu sakalazreyo(s)rtha kSudropadravAdidoSanivAraNArtha ca kAraNAdau sukhaM zAMtyartha ca sapta militA(ni) eva smayate guNyaMte iti sapta smaraNAni ucyate tathAdau caturdazapUrvANAmAdibhUtaM anAdyanaMtaM ca paMcaparameSThinamaskAraM(ra) rUpaM prathamasmaraNaM AdI vyAkhyAyate namo arihaMtANaM ityAdi etc. Ends.- fol. 1. idaM ca smaraNamanAdibhUtaM yato jinAH caturviMza(ta)yo'naMtA: saMjAtAH anaMtAzca bhaviSyati tadA sadaivA'yamevAto'nAdhanaMtamityarthaH atra padAni nava saMpado'STau akSarANi aSTaSaSTiH ladhvakSarANi ekaSaSTiH gurvakSarANi sapta jJeyAni iti prathamasmaraNasya TIkA 1 / Reference.-- Edited by me and published in Anekartharatnamanjusa (pp. 2-6) which forms No. 81 of Sheth D. L. J. P. F. Series, published in A. D. 1933.

Page #205
168 Jaina Literature and Philosophy namaskAra mantravyAkhyA No. 745 Namaskaramantravyakhya foll. Ia 3a 6a Size.-- 10 in. by 43 in. Extent.--27 folios; 17 lines to a page; 54 letters to a line. Description. Country paper thin, rough, tough and white; Jaina Devanagari characters; small, fairly legible, uniform and very good hand-writing; borders ruled in three lines in red ink; red chalk used; lines here and there written in red ink; foll. numbered in both the margins; fol. 27b blank; there is some space kept blank in the centre, in the case of the numbered and the unnumbered sides as well; in a few cases, this central place is decorated with a small disc in red colour; in the left-hand margin, the title is written as auto; condition very good; the extent of the commentary to each of the seven smaranas is as under :-- (I) upasargaharastotravRtti (2) namiUNa ( bhayahara) stotravRtti (3) laghuzAntistavavRtti "3 (4) tijayapaduttavRtti ( saptatizatastotravRtti ) (5) ajitazAntistavavRtti ( 6 ) bhaktAmara stotravRtti (7) bRhacchAntistotra Begins. - fol. r // 60 // zrIjinAya namaH // dr dr dw ,, dw etc. as in No. 744. 42 (a). 1874-75. prathamasmaraNe vyAkhyAM saMkSepAdvihitavAn samyak // 1 iti prathamasmaraNavyAkhyA // 11 N. B. For additional information see No. 744. to 3a 6a "" dr [745 8b Iob Iob 16a 16a 23b 23b 27a dr dr dr dw 8b Ends. fol. 1 idaM ca smaraNamanAdibhUtaM etc. up to jJeyAni as is No. 744. This is followed by the lines as under :'nAgapurIyatapoM' gaNarAjaH / zrIharSakIrttisUrivaraH

Page #206
7461 111.4 Malasatras 169 prabodhacaityavandana * Prabodhacaityavandang [jagaciMtAmaNi [ Jagacintamani. ghezyavaMdaNa]'. ceiyavandana ) No. 746 1220 (13). 1884-87. Extent.-- fol. 1894 to fol. 189". Description.-- This work may seem to begin abruptly as it does not contain some of the gathas occurring in Jagacintamaniceiyavandana. But it may noted that this sutra begins in this very way so far as Vidhipaksa is concernted. See p.7 of "Vidhipaksagacchiyapratikramanasutra" published by Bhimasi Manaka in A. D. 1934. For other details see No. 1220(1). NO. 1884-87.. Author.- Gautama Indrabhati Ganadhara (according to the Jaina ____tradition). Subject.- Salutation to the Jinavaras and the caityas. Begins.- fol. 189* kammabhUmihiM ( kammabhUmihiM ) paDhamasaMghayANi / ukosau sattarasau / jiNavarANa viharaMtu(ta) labbhai / nava koDihiM kebalihi etc. Ends.- fol. 189 sattANavaha sahassA / lakkhA chappanna attttkoddiio| causai bAsiyA teNe(la)ke ceie vaMde // 2 // vaMde nava koDisae paNavIsa koDilakkha tevanA aTThAvIsa sahassA causai aTTAsiyA paDimA // 3 // Reference.-- Published in some of the printed editions of the Prati kramanasutras. It is edited by me, along with Sanskrit rendering and Gujarati translation, and is published by Babu Bhagvanlal Panalal and Babu Mohanlal Panalal in " The Fifth Kiranavali" (Arhatajivanajyoti) on pp. 81-84 in A. D. 1937. Of course, this partly differs from what we have here in the Ms. * See p. 134. 1 This sort of brackets indicates that instead of the Prakrit rendering, an independent Prakrit title is given. 22 [J.L.P.]

Page #207
170 prabodha caityavandana 0.20 No 747 Extent. fol. r. Description. rai Jaina Literature and Philosophy Complete so far as it goes. For other details see Namaskaramantra No. 736. 28 Subject. This caityavandana begins according to the Kharatara gaccha. See Sukhlal's edition (App. 15) noted on p. 132. Begins. - fol. rb jayau sAmihi 2 risaha 'seja' etc. prabodhacaityavandana No :- 748 Prabodhacaityavandana 1106 (2). 1891-95. Ends. fol. rb kammabhUmihiM etc. up to ceie par3imA practically as in No. 746. N. B. -- For additional information see No. 746. samA [747 ....... jaya bIsa (?) moheramaMDaNU / jayau sAmiDa risahu 'settu(tu) ji' 'ujjita hunemijie / 95 Extent. fol. Ib. Description. Complete so far as it goes. For other details see No. 734. Begins.--fol. r* ma Prabodhacaityavandana 1270 (2). 1887-91. 'bharavaTTi muNisudhvarDa maharapAlu duhadaMDapaMDaNu ear' videha' va titha va suvahu disi vidisi ji ke vi ti (tI )aNAgayasaMpayai / baMdiMu jiNa sabve vi 1 Ends.fol. 1b kammabhUmihi etc. up to beie vaMde // 3 // as in No. 746. NB. -- For further particulars see Nos. 746 and 747. 9

Page #208
750.] 1:11. 4 Mhlasutras 171 tIrthavandamasUtra Tirthavandanasutra [jaM kiMci) [ Jam kifici] No. 749 575 (5). 1895-98. Extent.-- fol. 26. Description.- Complete. For other details see Namaskaramantra No. 737. Age.- Samvat 1889 (vide fol. 26 ). Author.-- Not mentioned. Subject.- This sutra composed in a verse in Prakrit deals with salutation to the tirthas in svarga, patala and manusyaloka. Begins and Ends.- fol. 20 jaM kiMca(ci) nAma titthaM / sago(gge) pAyAle tiriylogNmi|| - jAiM jiNabiMbAI // tAI savAI baMdAmi // 1 // As it consists of one verse, there is no separate end. Reference.- Published with some difference in any of the editions of Pratikramanasatra noted on p. 138 and in "The Fifth Kiranavali" (Arhatajivanajyoti) on p.85 edited by me, along with Sanskrit rendering and Gujarati translation. tIrthavandhanasUtra Tirthavandanasutra 1220 (16). No 750 1884-87. Extent.-- fol. 1896. 122011). Description.- Complete. For other details sce No. 1884-824Author.-A Jaina Saint. Begins and Ends.-fol. 1890 ja kiMci nAma titthaM / sagge pAyAla(li) mANuse loe ... jAiMjiNabiMbAiM tAI savA(dhA)I vaMdAmi / cha / N. B.- For other details see No. 749.

Page #209
172 Jaina Literature and Philosophy 1751. tIrthavandamasUtra Tirthavandanasutra No. 751 1106 ( 3 ). 1891-95. Extent.--- fol. 16. Description.--- Complete. For other details see Namaskaramantra No. 736. Begins and Ends.-fol. 16 jaM kiMci nAma tityaM etc. up to savvAiM baMdAmi 3 as in No. 750. N. B.- For additional information see No. 749. tIrthavandanasUtra Tirthavandanasutra 1270 (3). No. 752 1887-91, Extent.- fol. rb to fol. 2". Description. Complete. For other details see No. 734. Begins and Ends.-fol. 1 to fol, 2a (f) FTA etc. up to fais TETIA 11 8 11 as in No. 750. N. B.-- For further particulars see No. 749.

Page #210
753. ) III. 4 Malasatras 173 zakrastava Sakrastava [ atgry of ] [ Namutthu nam] 1220 (17). No. 753 1884-87. Extent.-- fol. 1896. 1220 ( 1 ). Description.- Complete. For other details see No. - 1884-87. : Author.- Sakra according to the Jaina tradition. Subject.-- Eulogy of the Tirthamkaras. Begins.- fol. 1896 AHTU O STEAIO etc. as in No. 758. Ends.-- fol. 1895 Fragu etc. up to footro as in No. 758. This is followed by the lines as under :jiyabhayANaM ja' aiyA siddhA je bhavissaMtiaNAgae kAle saMpaI / baTTamANA savve tiviheNa baMdAmi // Reference.-- Published. See any of the printed editions of the Pratikramanasutras noted on p. 138. This work is edited by me with Sanskrit rendering and Gujarati translation and is published in "The Fifth Kiranavali ( Arhatajivanajyoti) on pp. 86-88 where the due posture is also shown by way of an illustration. Kalpasutra (sutra 16 ), Haribhadra Suri's commentary (p. 494ff.) to Arasyakasutra and Vandaruvstti ( pp. 29-36 ) may be consulted. For an extract see B. B. R. A. S. vols. III-IV. p. 398. For Sanskrit rendering and English translation see Trisastisalakapurusacaritra vol. I, pp. 127-128 (Gaekwad's Oriental Series, No. LI). For a parallel work in Sanskrit see my edition of #TATUTUTATETAPHORETe (pp. 242-245). For other details see my article "Trgua it" published in "Sri Jaina Satya Prakasa" vol. II, No. 12, pp. 599-602.

Page #211
174 Jaina Literature and Philosophy (.754 zakastava Sakrastava No. 754 1106 ( 4 ). 1891-95. Extent. fol. to fol. 2a. Description.-- Complete. For other details see Namaskaramantra No. 736. Begins.-fol. r FANOG U SREATUD etc. as in No. 753. Ends.--fol. 2* Hotelui etc. up to falargur SETA as in No. 753. This is followed by 8. N. B.-- For further particulars see No. 75 zakastava Sakrastava 1270 (5). No. 755 1887-91. Extent.- fol. 2a to fol. 26. Description.- Complete. For other details see No. 734. Begins.- fol. 2* FATT(EN) OP I SPEATO I etc. as in No. 753. Ends.- fol. 2* savvalaNaM / etc. up to sabve tiviheNa baMdAmi / / 7 / ' as in No. 753. N. B.- For further particulars see No. 753. 97075fTa i . Sakrastava 1269 (6). No 756 1887-91. Extent.- fol. to fol. 2". Description. Complete. For other details see Namaskaramautra No. 735. Begins.- fol. Are o garot etc. as in No. 753. . Ends.-- fol. 2* samvannaNaM etc. up to tibiheNa vaMdAmi // 1 / cha // as in No. 73. S N. B.- For additional information see No. 753.

Page #212
788... . . Int. Malashtrati sis zakastava..... Sakrastava No. 757 1880-81. Exent.-leaf 1200 to leaf 121b. Description.- Complete. For other details see 5.77 (..).. No. 7 1880-81. Begins.- leaf 120 namotthu NaM arihaMtANaM // bhayavaMtANaM AigarANaM etc. Ends.--- leaf 121 saMpaiya badramANA / savve tiviheNa baMdAmi / . N. B.-- For additional information see No. 753.... : . . zakrastava Sakrastava No. 758 5 75 (6). .. 1895-98. Rainb Extent. fol. 26 to fol. 3*. la Description.- Almost complete in case the following lines may be said to be lacking : "jiabhyaannN| . . jea aiA siddhA je a bhavissaMtiNAgaekAle saMpai vaTTamANA savve tiviheNa vaMdAmi" ___For other details see No. 737. Begins.- fol: 2' namonyu NaM // arihaMtANaM // bhagavaMtANaM // Ayami( gare / titthayarANaM etc. Ends.- fol. 3* savvakSaNaM savvadaMsINaM // sivamayalamaruyamaNaMtamakkhayamavvAbAha mapuNarAvatti ||siddhiginaamdheyN // ThANaM saMpattANaM // namo binnaannN||1|| / iti zrIzakastavaH // 1 .. N. B.- For other details see No. 753.

Page #213
176 Jaina Literature and Philosophy (759. sarvacaityavandana Sarvacaityavandana (Fraia wei) (Javanti ceiyaim ] No. 759 1220 ( 26 ). 1884-87. Extent.-- fol. 1904. I 220 (1). Description. Complete. For other details see No. - 1884-87. Author.- A Jaina saint. Subject.- Salutation to the caityas of all the three lokas, in one verse in Prakrit. Begins and Ends.- fol. 190deg Hreifat orang ( O) ( O) to fafcerto al savvAI tAI vaMde [iha saMto tattha saMtAI // 5 Reference.- Published. See any printed edition of the Pratikra mapasutras. This work has been recently edited by me, along with the Sanskrit rendering and Gujarati translation, and it is published in "The Fifth Kiranavali " ( Arhatajivanajyoti ) on p. 89. This sutra occurs in Sraddhapratikramanasutra as verse No. 44. So this and Vandaruvstti (p. 157) may be consulted. sarvacaityavandana Sarvacaityavandana No. 760 1269 (16). 1887-91. Extent.-- fol. 24. Description.- Complete. For other details see Namaskaramantra No. 735. Begins and Ends.-fol. 2* jAti cehayAI etc. up to tattha saMtAI // 1 as in No. 759. N. B.- For additional information see No. 759.

Page #214
762.): 111. 4 Malasutras 177 sarvacaityavandana Sarvaceityavandana No. 761 . 1106 (5). 1891-35. Extent.- fol. 2. Description.- Complete. For other details see Namaskaramantra No. 736. Begins and Ends.-fol. 2* Frife TESTE etc. up to yg fat are #arg as in No. 759. N. B.- For further particulars see No. 759. sarvacaityavandana Sarvacaityavandana No. 762 1270 (6). 1887-91. Extent.-- fol. 26. Description. -- Complete. For other details see No. 734. Begins and Ends.--fol. 2a Arafat agurs etc., up to se sa faca per fare it as in No. 759. N. B.-- For additional information see No. 759. 23 (J.L.P.)

Page #215
178 Jaina Literature and Philosophy (763. sarvasAdhuvandana Sarvasadhuvandana (strata $ @ Elg ] [Javanta ke vi sahu ] 1220 (27) No. 763 1884-87. Extent.-- fol. 1906. 1220 (1). Description.- Complete. For other details see No. 1884-87 Author.- A Jaina saint. Subject.-- Salutation to all the saints, in one verse in Prakrit, Begins and Ends. - fol. 1908 jAvaMti(ta) keha (? vi) sAhU / bharaheravae mahAvidehe ya / savvemu tesu paNao tiviheNa tidNddviryaannN||2 Reference. - Published. See any printed edition of the Prati kramanasutras. This work is recently edited by me, along with the Sanskrit rendering and Gujarati translation, and is published in "The Fifth Kiranavali" (Arhatajivanajyoti) on p. 90. This work occurs in Sraddhapratikramanasutra as verse No. 45. Vandaruvstti (p. 157) may be consulted. sarvasAdhuvandana Sarvasadhuvandana No. 764 1269 (17). 1887-91. Extent. - fol. 2". Description.- Complete. For other details see Namaskaramantra No. 735. Begins and Ends.- fol. 2 Arifat a Pot ha etc. up to fac erui etc., as in No. 763. N. B.- For additional information see No. 763:

Page #216
966. ] 111. 4 Malasatras 119 Sarvasadhu'vandana No. 765 1270 (7). 1887-91. Extent.-- fol. 26. Description.- Complete. For other details see No. 734. Begins and Ends.-fol. 2b raifa(a) # Per wie etc., up to fama ferrari . as in No. 7630 N. B.- For additional information see No. 763... sarvasAdhuvandana . . Sarvasadhuvandana 1106.(6). 1891-95. No, 766 Extent. fol. 2. Description.- Complete. For other details see Namaskaramantra No. 736. Begins and Ends. -- fol. 2* HITT Hraratia) e HT etc. up to farmor faastatuoi ? as in No. 763. N. B.- For additional information see No. 763.

Page #217
180 Jaina Literature and Philosophy 1767 upasargaharastotra Upasargaharastotra (39FMETTET) (Uvasaggabarathotta ) 350 (b). No. 767 A. 1882-83 Extent. fol. 1b. Description. Complete. For other details see No. 739. Author.-- Bhadraba husvamin according to the Jaina' tradition. Subject. This work consisting of five gathas in Prakrit as usual deals with a hymn in honour of Lord Parsvanatha, the 23rd Tirthamkara of the Jainas. This work is variously designated by scribes such as 34 Figurata, staro s para and startarea. Begins.- fol. 1 gangi etc. as in No. 777. Ends.- fol. 1b 737 #y@t etc. up to the end as in No. 777. Reference.- Published along with Parsvacandra's commentary in the D. L. J. P. F. Series as No. 8o on pp. 97-112, where Priyankaranfpakatha is also included.' Also published with the commentary of Jinaprabha Suri and that of Siddhicandra Gani as well, in the D. L. J. P. F. Series as No. 81. This work is recently edited by me, along with the Sanskrit rendering and Gujarati translation, and is published in "The Fifth Kiranavali" (Arhatajivanajyoti) on pp. 92-93. 1 Herein on pp. 41-44 (App. ) is given the text containing 20 verses, and on pp. 45-48 we have padapurti of all the carapas of the first five usual verses.

Page #218
770.1 III. 4 Malas atras 181 upasargaharastotra Upasargabarastotra No. 768 640 (b). 1895-98. Extent.- fol. 1b. Description.-- Complete. For other details see No. 738. Begins.- fol. 10 GU HITET etc. as in No. 767. Ends.- fol. 1 537 #graat etc. as in No. 767. N. B.- For other details see No. 767. upasargaharastotra Upasargaharastotra No. 769 1220 ( 29 ). 1884-87. Extent.-- fol. 190*. Description.-- Complete. For other details see No. 1220 (0.). Begins.-- fol. 1909 Jahime etc. as in No. 767. Ends.--fol. 1909 gu tigait etc. up to wa ne grafi 4 11 30 as in No. 767. N. B.- For further particulars see No. 767. upasargaharastotra Upacargabarastotra No. 770 1269 ( 20 ). 1887-91. Extent.-- fol. 2to fol. 26. Description.- Complete ; s verses in all. For other details see Namaskaramantra No. 735.

Page #219
1 182 Begins. fol. 24 uvasaggaharaMpAsaM etc. as in No. 767. Ends. fol. 2b iya saMdhuo etc. up to pAsajiNacaMda // 5 // cha as in No. 767. N. B. For additional information see No. 767. upasarga hara stotra Jaina Literature and Philosophy No. 771 [770. C Upasargaharastotra 672 (g). 1899-1915. Extent. fol. 8b. Description. Complete; five verses in all. For other details see Ajitasantistava No. 672 (a ). 1899-1915. Begins. fol. 8b uvasaggaharaMpAsaM etc. Ends. fol. 8 iya saMdhuo etc. up to tA deva disaha bohiM bhave bhave pAsajiNa caMda // 5 as in No. 767. This is followed by the lines as under : iti zrIupasargaharaNastotraM // saptamaM smaraNaM // 7 // iti saptamasmaraNa (NaM) samAptaM (ta) ma // ccha // lideg jIvanavIjaya // raNAza' // 6 rAmaghATa ' madhye // kusallAjImhArAjyakI pozAla || miti vaikhAkha di 10 dazamI zukra (kra) bAsare // saMvat 1932 kA zAke 1797 // paMniMvIvIvAcanArthe // ccha

Page #220
774. ) 111. 4 Malasutras 183 34TETETTE Upasargaharastotaa No. 772 1270 ( 9 ). 1987-91. Extent.-- fol. 2b to fol. 34. Description.- Complete ; five verses in all. For other details see No. 734. Begins.--fol. 20 za H ET etc. as in No. 767. Ends -fol. 3a TE AGait etc. up to qrafrazia "E(?) 11 as in No. 767. This is followed by afturatetecta a N. B.- For additional information see No. 767. upasargaharastotra Upasargaharastotra No. 773 575 (4). 1895-98. Extent.- fol. 2b. Description - Complete. For o. her details see Namaskaramantra No. 737. Begins.- fol. 2b gapirgi etc. as in No. 767. Ends.--fol. 2b gt ya etc. up to frie i 8 1 practically as in No. 767. This is followed by sa m HJIETII. N. B.- For additional information see No. 767. upasargaharastotra No. 774 Up@sargaharastotra 1106 (8). 1891-95. Extent.- fol. 2a. Description.- Complete. For other details see Namaskaramantra No. 736.

Page #221
184 Jaina Literature and Philosophy 1775. Begins.- fol. 2* FAT(s)pateralitatearen t : 34 H INTEN TE OCITA EFATOS etc. Ends. --fol. 2* fet figrait etc. up to set the grefforzia ll as in 767. This is followed by the line as under : ___ iti zrIpArzvajinalaghustavanaM // N. B.- For additional details see No. 767. No. upasargaharastotra Upasargaharastotra laghuvRttisahita with laghuvrtti No. 775 272 (a). 1871-72. Size.- 104 in. by 45 in. Extent.- s folios ; 13 lines to a page ; 39 letters to a line. Description.- Country paper tolerably thick and whitish in colour; Jaina Devanagari characters with occasional TEATS; legible, bold, big, uniform and fair hand-writing ; borders ruled in four lines in black ink; red chalk used; yellow pigment, too; the lower edges of the numbered sides slightly eaten away by white ants ; condition very fair ; this Ms. contains both(?) the text and the commentary; both complete ; the latter ends on fol. 56; this Ms. contains an additional work viz. afssorata along with its commentary which commences on fol. sb and ends on the same fol. Author of the commentary.- Purnacandra Suri. Subject.- A hymn in honour of Lord Parsvanatha, consisting of five gathas. The commentary deals with the yantras and tantras pertaining to them. It is styled as ggare. Begins.- (text ) fol. 1* 347VIER >> - ( com. ) fol. 1 namaskRtya paraM pArca sarvayoginamaskRtaM / upasargaharastotraM vivRNomi samAsataH // 1 // 1 This line may be looked upon as a separate work by itself.

Page #222
776.] III. 4. Malasutras _185 upasargaharaM pArzva pArzva yakSaM pArzvanAthaM ca bhagavaMtaM kiMviziSTaM karmaghanamuktaM maMgalakalyANaAvAsaM viSadharaviSanirnAzanaM cetyakSarArthaH vaMdAmIti kriyApadaM / etc. Ends.- (text) fol. 4deg iya saMthuo( ? ) etc. ,, - ( com.) fol. 5. idAnIM stuterupasaMhAramAha / iti saMstuto mahAyaza bhakti bharanirbhareNa etc. up to tathA OM namo bhagavate pArzvanAthAya kSemaMkarAya hI namaH kSemaMkaro mNtrH| upasargaharastotraM vivRtaM maMkSepato gurumukhen| vijJAya kimapi tattvaM vidyAvAdAbhidhagraMthAt // 1 // ityupasargaharastotralaghuvRttiH pUrNacaMdrAcAryakRtiriyaM samAptA / Reference.-- Published in Saradavijaya Jaina Granthamala, Bhav nagar. upasargaharastotra Upasargabarastotra arthakalpalatAsahita with Arthakalpalata 232(g). No. 776 A. 1882-83. Extent.- fol. 18 to fol. 19". Description.- Both the text and the commentary practically com' 232(a). plete. For other details see No. A A. 1882-83.. Author of the commentary.-- Jinaprabha Suri, pupil of Jinasimha Suri of the Kharatara gaccha. Subject. The text in Prakrit together with the explanation in Sanskrit ; the latter is styled as Arthakalpalata and is com posed in Samvat 1365 (see No. 777 ). Begins.- ( text ) fol. 18* uvasaggaharaMpAsaM pAsaM vadAmi kammaghaNamukaM / visaharavisaninnAsa maMgalakallANaAvAsaM // 1 // ,, - (com.) fol. 18 pratibodha vidhAno etc, 24 J.L.P.]

Page #223
186 Jaina Literature and Philosophy [776. Ends.- (text) fol. 19deg I(i)ya saMthuo mahAyasa / bhattikabharaninbhareNa hiayeNa / tA deva dija bohiM bhave bhave pAsajiNacaMda // 5 // ,, - (com.) fol. 19 saMvandvikramabhUpate(:) zarakratUdarcimRgAMkairmu(mi te| pauSasyAsitapakSabhAji zaninA yukte navamyAM tithau| zrIjina // Reference.- Both the text and the commentary published. See _No. 767. upasargaharastotra Upasargaharastotra arthakalpalatAsahita with Arthakalpalata No. 777 1241 (g). 1891-95. Extent.-- fol. 535 to fol. 616. Description.-- Both the text and the commentary complete; the latter composed in Samvat 1365. For other details see No. 1241 (a). 1891-95. Age.-- Samvat 1868. Begins.- (text) fol. 53deg uvasaggaharaMpAsaM (?) etc. Begins.- ( com.) fol. 53deg pratibodhaM vidadhyAto(?) sa ca varAhamiha(hi)ra stathAvidhajJAnAvaraNIyakarmakSayopazamAbhAvAskiMcideva caMdraprajJaptisUrya prajJaptyAdikaM zAstramadhItavAn / etc. Ends.- (text) fol. 61 iya saMthuo etc. - (com.) fol. 61deg prAkRte pAsajiNAya etc. up to iti siddhaM / practically as in No. 784. This is followed by the lines as under :saMvadvikramapate(:) zaraRtUdarcisRgAMkairmite / pauSasyAsitapakSabhAji zaninA yuke navamyAM tithau / ziSya(:) zrIjinasiMhamUrisugurorvRttiM vydiidimaaN| zrI sAketapure' jinaprabha iti khyAto munInAM prabhuH / 3 //

Page #224
779.1 rUpAM lISitvA 'subhaTapura madhye | N. B.-- For other details see No. 776. 187 111. 4 Malasatras graM. 271 / saM. 1868 mArga0 kRSNa 13. vAsare / zrI vRddhaAcArya gcche| zrIjinacaMdra sUrajIziSyapAThakavAcanArthe / zrIratnalakSmIjI tatziSyamI upasargaharastotra arthakalpalatAsahita " No. 778 Extent. fol. 28b to fol. 338. Description. Both the text and the commentary complete; the verses. For other details see former contains five No. Begins.- ( text ) fol. 30 - ( com. ) fol. 28b Ends.- ( text ) fol. 320 "" 85 1 ( a ). 1895-1902. Upasargaharastotra with Arthakalpalata upasarga hara stotra arthakalpalatAsahita iha saMdhuo etc. up to bhave bhave pAsajiNacaMda // 5 as in No. 767. - ( com. ) fol. 332 prAkRte pAsajiNA / padmAvatI tAM caMdayati AilAdayate etc. up to munInAM prabhuH // 3 as in No. 777. This is followed by the lines as under : iti zrIsapta (maM) smaraNaM samAptaM // pratyakSaraM nirUpyAsya graMthamAnaM vinizvittaM / anuSTubhAM ca dvizatyekasaptatisamanvitA // 1 zubhaM bhavatu[ : ] // zrIrastu [ : ] // // graMthAgraM 271 // N. B. For additional information see No. 777. No. 779 Extent. - fol. 34b to 851 (g). 1895-1902. uvasaggaharaMpAsaM etc. as in No. 767. pratibodhaM vidadhAno etc. as in No. 776. fol. 41b. Upasargaharastotra with Arthakalpalata 1229 (g). 1891-95.

Page #225
188 Jaina Literature and Philosophy [ 779. Description. In the centre of the 35th folio there is a square with vertical diagonals. Both the text and the commentary complete. For other details see No.-229 a): 1891-95. Begins.- (text ) fol. 346 (?) JaFITEITIE etc. ,, - (com. ) fol. 340 gratate lacurat etc. as in No. 776. Ends.-- (text ) fol. 400 ga yrat etc. up to retaie ,, -- (com. ) fol. 418 Trend Trefot etc. up 10 sat' fraagh' saga fa entai gatai sy: 11 ll as in No. 777. This is followed by FATHT di ghiacara: N. B.- For further particulars see No. 777. upasargaharastotra vRttisahita No. 780 Upasargaharastotra with vrtti 1205. 1886-92. Size.- 104 in. by 4} in. Extent.-- 6 folios ; 14 lines to a page ; 48 letters to a line. Description.- Country paper very brittle, not very thin and quite grey in colour ; Jaina Devanagari characters; bold, legible, big, uniform and elegant hand-writing: borders ruled in four lines in black ink ; all the four edges of almost every fol. more or less worn out; condition not satisfactory; this Ms. contains both the text and the commentary ; both complete; fol. ra blank. Age.- Samvat 1697. Author of the commentary.- Dvija Parsvadeva Gani. Subject The text consists of s gathas only. The Sanskrit com mentary throws light on the yantras and mantras pertaining to them.

Page #226
781.] III. 4 Malasatras 189 Begins-- ( text ) fol. 1" uvasaggaharaM etc. as in No. 767. ___,, -- ( com. ) fol. 1b dharaNeMdraM namaskRtya / zrIpArzva munipuMgavaM / upasargaharastotrattiM vakSye samAsataH // 1 // praNatasurAsuralalATavinyastamukuTazreNisamAzritameva ca / etc. Ends.- ( text ) fol. 6deg iya saMthuo etc. up to pAsajiNacaMda as in No. 767. , -( com.) fol. 6' sarvakalyANaM saMpaikarI yaMtraM bhavati // cha // dvijapArzvadeva gaNiviracite yatkimapi dharaNedrapArzvayakSaH padmAvatIpramukhAni svadevatAbhirmama kSamitavyamiti // yacca kiMcidviru(ddha)yaMtraM maMsita(?) sarvasya mithyA duSkRtamiti // cha / iti zrIuvasaggaharastotrasya vRtti samAptaM // saMvatsare zrIvikramavRpatau saptanaMdakAyabhU (1693)yute / varSe AzvinamAse zuklapakSe dugrgA(!)STamyAM tithau // liSitaM jagajIvanarSiNA svAtmahetave // kalyANamastu / bhAvyaM bhavatu / akkharamattAhINaM / maya yA) lihiyaM ayANamANaNaM / taM Sa(kha)maha mujja sAmI / jiNaMdamuhaniggayA vANI // 'zAladurge' sthite sati / leSakapAThakayorjayaH ||ch / Reference. - Edited by me and published in the D. L. J. P. F. Series as No. 80, along with Priyankaranrpakatha etc. This Ms. is there designated as kha. upasargaharastotra Upasargabarastotra TIkAsahita with tika 885 (b). No. 781 1892-95. Extent.- fol. 24 to fol. 3'... Description.- Both the text and the commentary complete; the former contains five verses. For other details see Namas karamantra with vrtti No. 740. Author of the commentary.- Siddhicandra Gani, pupil of Bhanu candra. For details see p. 163.

Page #227
190 laina Literature and Philosophy [781. Subject.- The text and its explanation in Sanskrit.. Begins.- (text) fol. 2* udhasaggaharapAsaM etc. as in No. 779. ,, -(com.) fol. 2 atha paMcAzItyadhikazatAkSaramAnasya / upasargaharastotra syayamAdyAM gAthAmAha / uvasaggeti / ahaM zrIpAzva pArzvanAthaM vadAmi abhi Taumi baduGa abhivAdanastutyoriti dhAto rUpa etc. Ends.-- (text) fol. 3deg iya saMthuo etc. up to pAsajiNacaMda / 5 / as in No. 780. This is followed by ityupasa[gaharastotra / ,, -(com. ) fol. 3deg sAmAnyakevalinasteSu caMdra iva caMdrastasya saMbodhanaM he jinacaMdra tatpuruSaH / tvaM arthAnmA bodhi ratnatrayaprAptiM pretya jinadharmAvApti vA dehi pravitaretyarthaH / kAsman bhave bhave janmani janmani / yAvanmokSaM na prApnomIti bhAvaH / idaM stotraM dharaNedrapadmAvatIpArzvayaurAdhiSThitamiti pakSe teSAM vyAkhyAnaM tu vRhadvRttito draSTavyaM / 5 / iti pAdazAhazrIakabarajallAladInazrIsUryasahasranAmAdhyAyakazrI zatraMjaya tIrthakaramocanasarvatragovadhanivarttanAdyanekasukRtavinirmApakamahopAdhyAyazrI bhAnucaMdragIizaSyayugapadaSTottarazatAvadhAnacamatkRtapAdazAhazrIakabarajallAladInapAdazAhInUraddInajihAMgIrapradattaSuzphahama nAdirajjamAM dvitIyAbhidhAnamahopAdhyAyazrIsiddhicaMdragaNiviracitAyAM saptasmaraNaTIkAyAM upasargahara stotraTIkA samAptA // cha / Reference.- Published see No. 767. upasargaharastotra Upasargaharastotra 'vRttisahita with vrtti No. 782 384 (a). 1871-72. Size.- Iod in. by 4g in. Extent.- fol. 63* to fol. 65+. Description.- Complete. For other particulars see sadayavatsasAvaliGgI - kathA No. 384 (a). ____1871-72.. Author of the commentary.-- Not mentioned. Subject.-The text is here looked upon as the 2nd smarana. Iti explained in Sanskrit.

Page #228
191 783.] III. 4 Malasutrar Begins.- (text ) fol. 63* ubasaragaharaMpAsaM etc. as is No. 767. - ( com. ) fol. 63* atheti smaraNaM padArthoM lI(li khitAnI(ni) ahaM pArzva pArzvanAthaM vaMde namaskAromi(mI)ti etc. Ends.- ( text ) 65 iya saMthuo etc. up to bhave bhave pAsajiNacaMda as in No. 767. , - ( com. ) fol. 65deg caturdaza:dharapraNItatvAt sUtravat jJeyamiti dvitIyasmaraNam 5 iti zrIupasargaharastotravRtti samAptam graMthAgraMtha samasta 1275 che yAdRzaM pustakaM dRSTvA tAdRzaM likhitaM mayA yadi su(zuddhamasu(zuddha vA mama doSo na dIyate 1 saM. 1911 nA varSe zrAvaNasUda 1 vAra buddhe likhitaM paM.rAjavijaya gaNI paM.uttamasatkatatzIpamuMnInItavijayapaM.rAjasatkapaThanArtha paropagArAya zrIdharmanAthajIprazAdAt zreyaM upasargaharastotra Upasargaharastotra avacUrisahita with avacuri 643. No. 783 1892-95. Size.- Io in. by 43 in. Extent- (text) 3 folios ; 7 lines to a page ; 40 letters to a line. ,, -( com.),, ,, , I0 ,, ,, ,, ,, ; 50 , , , , Description.- Country paper thick, rough and grey; Jaina Deva nagari characters with TeaTS; borders ruled in two lines in red ink, whereas edges at a distance of one inch from them in three lines in the same ink; the text occupies the central place, and the commentary, the space all around; this is a pazcapATI Ms.; red chalk used ; edges of the foll. very slightly damaged; both the text and the commentary com plete ; condition very good. Age.-Old. Author of the commentary.- Not mentioned. Subject.- The text as before. The Sanskrit commentary though small is lucid and throws light on the mantras and yantras connected with the five gathas forming the text.

Page #229
192 Jaina Literature and Philosophy [783. Begins.- (text ) fol. I' ubasaggaharaM etc. as in No. 767. ,, -(com.) fol. 11 stotrasyASTAtiriktaM zataM yaH kuryAjApaM paMcagAthAtmakasya / tasyAvazyaM maMkSu nazyati vighnA staM niHzeSA vRNvate siddhayazca // ' s(atra hi prathamagAthAyAM jagadvAlbhya kara etc. Ends.- (text ) fol. 3deg iya saMthuo etc. as in No. 767. ,, - ( com. ) fol. 3deg prAkRte pAsajiNAya padmAvatI tAM caMdatyAlAdayatIti tasyAmaMtraNa dIrghahasvau mitho vRta(ttau) iti hasvatre pAsajiNacaMdeti siddhaM // iti upasarga(hara)stavAvacUriH / upasargaharastotravRtti Upasargaharastotravrtti No. 784 1241 (b). 1884-87. Extent. - fol. 1a to fol. 2b. Description.- Complete; only the states of the text are given. For other details see Namaskaramantravyakhya No. 744. Author.- Harsakirti Suri. Subject.- Sanskrit commentary on Upasargaharastotra, the 2nd smarana. Begins.- fol. 1 atha dvitIyasmaraNaM vyAkhyAyate upasargaharamiti idaM ca smaraNaM varAhamiha( hi )rakRtazrIsaMghopadvanivAraNArtha zrIbhadrabAhubhiH kRtaM ya. zrImadrabAhusvAmino bhrAtA varAhamiha(hi)raH sa ca dIkSAM gRhItvA caMdraprajJaptisUryaprajJaptipramukhAdikaM zAstramadhItavAn etc. Ends.- fol. 2' ihAnye'pyarthAH saMti tathA pArzvayakSapakSe'pyanyo'rtho'sti paraM vistarabhiyA noktAH kiMtu mUlArtha eva vyAkhyAto'sti 1 This verse occurs by way of a quotation in Harsakirti Suri's Upasargabarastotravrtti on p. 14.

Page #230
785.0 111. 4. Malasutras 193 upasargaha(ra)stotre vRttiM zrIharSakItisUririmAM kRtavAn sukhAvabodha(dhAM) maMdamatInAM hitArthAya iti zrIdvitIyasmaraNaM samAptaM 2 Reference.- This work is edited with this commentary by me, and it is published in Anekartharatnamanjusa (pp. 13-24) which is published in Sheth D. L. J. P. F. Series as No. 81 in A. D. 1933. upasargaharastotravRtti Upasargaharastotravrtti No. 785 ___42 (b). 1874-75. Extent.- fol. 12 to fol. 3a. Description.- Complete. For other details sec Namaskaramantra vyakhya No. 745. Begins.-fol. 1 atha dvitIyaM smaraNaM vyAkhyAyate / uvasaggaharamiti idaM ca etc., as in No. 784. Ends.- fol. 3. ihAnye'pyarthAH etc. up to hitArthAya practically as in No. 784. This is followed by iti dvitIyasmaraNabattiH // 2 // // N. B.- For other details see No. 784. " [J.L. P.]

Page #231
194 Jaina Literature and Philosophy ( 786. gejategi e Prarthanasutra [ 577 aitia) [ Jaya viyaraya ) 1220 (30) No. 786 1884-87. Extent.- fol. 1902 Description.- Complete though it may appear to end abruptly. For other details see No. 1220 ( 1 ). 1884-87.. Author.- A Jaina saint. Subject.-- This small work in Prakrit is a prayer to one who is free from attachment and aversion. It contains only two verses. Begins.- fol. 1902 ___ . jaya vIyarAya jagaguru hoU(u) mama: / tuhappabhAvao bhayavaM bhavaniveo maggANusAra( ri )yA ittphlsiddhii| Ends. fol. 190a logaviruddhacA(cA)o / gurujaNapUyA paratthakaraNaM ca / muhagura(ru)jogo tabbayaNasevaNA AbhavamakhaMDA / grat stezzata il II Reference.- Published. See any printed edition of Pratikramana sutras where an additional portion containing two gathas and a Sanskrit verse is generally given. For an extract containing these two gatbas and the interpolated matter see B. B. R. A. S. vols. III-IV, pp. 398-399. This work is recently edited by me along with the Sanskrit rendering and Gujarati translation, and is published together with an illustration indicating the posture to be taken up while reciting it, in "The Fifth Kiranavali" (Arhatajivanajyoti) on p. 94. 1 See pp. 134 and 152.

Page #232
787.] I11. 4 Malasutras 195 There are only two gathas (just given here in Pancasaka (IV, v. 33-34) in Caityavandanasutra (p. 1142) commented upon by Haribhadra Suri, in Yogasastra (III, p. 233a ), and in Acaradinakara (p. 271b). In the edition of Sravakanusthanavidhi (p. 31 ) containing Vandaruvstti, we have these two gathas plus two other gathas and one verse in Sanskrit.' In Santi Suri's Ceryavandanamahabhasa (v. 846-849 ) we have, however, 4 gathas, the first commencing with great and the last with aws and the middle ones being those which are given here (i. e. in No. 786 ). For vivarana see Lalitavistara (pp. 114-1159), the svopajna vrtti (p. 233b) of Yogasastra, Abhayadeva Suri's vrtti (pp. 81" and 822 ) on Pancasaka, Acaradinakara (p. 2716), Vandaruurtti (p. 32 ) and the svopajna vitti (p. 164a ) on Dharmasamgraha. " Ubersicht uber die Avasyaka-Literatur" (p. 2) may be consulted. prArthanAsUtra Prarthanasutra No. 787 1270 (10) 1887-91. Extent.- fol. 3a. Description.- Complete. For other details see No. 734. Begins and Ends.fol. 3a FT aus() etc, up to 37THAOST LIE Il as in No. 786 This is followed by gfa JEFFE N. B. - For additonal information see No. 786. It is rather a strange thing that in the l'undarulli we have explanation of the first two gathas only. 2 This is a wrong nomenclature for this sutra.

Page #233
196 Jaina Literature and Philosophy 1 788. prArthanAsUtra Prarthanasutra No. 788 1106 (9). 1891-95. Extent. fol. 2a to fol. 2b. Description.-- Complete ; 2 verses in all. For other details see Namaskaramantra No. 736. Begins and Ends. - fol. 2o f a ty etc., up to 311HTAUET as in No. 786. This is followed by a line as below: 2 iti praNidhAnadaMDakaM. N. B. - For additional information see No. 786. prArthanAsUtra Prarthanasutra 1269 ( 21 ). No. 789 1887-91. Extent.-- fol. 2b. Description.- Complete. Herein we have one additional verse. For other details see Namaskaramantra No. 735. Begins and Ends. - fol. 26 Fry atatry etc. up to 37/HTAGET IR Il as in No. 786, This is followed by the verse as under :-- vArijaha jai vi niyameNa baMdhaNaM / vIyarAya tuha samae / taha vi mama hujja sevA bhave 2 ta(tu )mha calaNANaM // 3 // N. B. - For additional information see No. 786. 1 Scc p. 134 where it is styled as Pranidhanasutra.

Page #234
790.) III. 4 Malasairas 197 IryApathikIsUtra Iryapathikisutra (EiTUTTICHET) (Iriyavahiyasutta ) No. 790 1220 ( 8 ). 1884-87 Extent.-- fol. 1892. Description. 1220 ( 1 ). Complete, For other details see No. 1884-87. Author.- A Jaina saint. Subject.-- A Prakrit composition dealing with alocana. Begins.-- fol. 1894 ETIAITU FICHE H791 ENTITET TEATA icchaM / icchAmi paDikkamiuM / iriyAvahiyAe / virAhaNAe : gamaNAgamaNe / TEHT ATEHU I ENTUEHU I etc. Ends.-fol. 189* abhiyA up to tassa micchA mi dukkaDaM // cha // etc. as in No. 794. Reference.- Published. See any printed edition of Pratikramana sutras. This work is edited by me, along with the Sanskrit rendering and Gujarati translation, and is published by Jivanalal Panalal in "The Fourth Kiranavali (Arhataji. vanajyoti ) on pp. 71-72. Haribhadra Suri's commentary (p. 573a ) on Avasyakasutra, Yogasastra (III) and its svopajna commentary (pp. 2139-214a ), Acaradinakara (pp. 277-278a) and Vandaruvitti (p. 24 ) may be consuted. For an extract see B. B. R. A. S. vols. III-IV, p. 398. For the gates of this work and its explanation etc. in verses in Prakrit see Ceiyavandanamahabhasa ( v. 366-381 ). The svopajna commentary on Dharamasamgraha (pp. 1429-143a ) may be also consulted. See also" Ubersicht uber die Avasyaka-Literatur" (p. 2).

Page #235
198 Jaina Literature and Philosophy | 791. IryApAthakIsUtra Tryapathikisutra No. 791 1106 (11). 1891-95. Extent.- fol. 2b. Description.-- Complete. For other details see Namaskaramantra No. 736. Begins.--fol. 20 #31FTGT Fetag etc. as in No.790. Ends.--fol. 2b 3pfwar etc. up to a practically as in No. 794. This is followed by N. B.- For additional information see No. 790. IryApathikIsUtra Iryapathikisutra 1269 (2). No. 792 1887-91. Extent.- fol. 16. Description.- Complete. For other details see Namaskaramantra No. 735. Begins.-fol. 1 extA VICaefas etc. as in No. 790. Ends.--fol. 10 fagur aftur etc. up to am PHTEGIA ES 11Cllgil practically as in No. 790. N. B.-- For additional information see No. 790. IyApathikIsUtra Iryapathikisiitra 1270 (12) No. 793 1887-91. Extent.-- fol. 3a to fol. 36. Description.-- Complete. For other details see No. 734. Begins.--fol. 3a parete etc. asjin:No. 790. Ends.- fol. 3a SIA( ? )ar etc. up to aff (HTIA Colly Il as in No. 794, N. B.-- For additional information sec No. 790.

Page #236
794. 111. 4 Malasatras 199 IryApathikIsUtra Tryapathikisatra No. 794 77 ( ). 1880-81. Extent.- leaf 124* to leaf 124deg. Description.- Complete. For additional particulars see Agamikavastuvicarasara No 77 (1). 1880-81.. Begins. -leat 124* icchAmi paDikkamiu iriyAvahiyAe / virAhaNAe / gamaNA gamaNe / pANakkamaNe / bIyakkamaNe / etc. __Ends.- laet I24deg bhaThiba(bhi)hayA vattiyA ( lesiyA) saMghAiyA saMghaTTiyA ThANAo ThANaM saMkAmiyA jIviyAo vavaroviyA tassa micchA mi dukkaDaM

Page #237
200 Jaina Literature and Philosophy (796. 77 (1). uttarIkaraNasutra Uttarikaranasutra [ GFA 39 ] [ Tassa uttari ] No. 795 77 i ). 1880-81. Extent.- leaf 1242 Description.- Complete. For other details see 1880-81. Author.- Not mentioned. Subject.-A formula in Prakrit for further preparation to purify the defiled soul. This is styled as "Ummaggakaranasutta" (Unmargakaranasutra ) in Cezyavandanamahabhasa (v. 382'). Begins and Ends.--leaf 124* tasmuttarIkaraNeNaM / pAyachi(cchi )ttIkaraNeNaM / visohIkaraNeNaM / visallI Tutoi i qaroi ITHIOPIETOUTEIT ET IT A FISI Reference.- Published in any of the editions of Pratikramanasutras noted on p. 138. This work is edited by me, along with the Sanskrit rendering and Gujarati translation, and is published in "The Fourth Kiranavali ( Arhatajivanajyoti ) on p. 73. For an extract see B. B. R. A. vols. III-IV, p. 398. Haribhadra Suri's commentary (p. 779') on Avasyaka sutra, Yogasastra and its svopajna vitti (p. 2149-2146), Acaradinakara (p. 278a ) and Devendra Suri's Vandaruvrtti (p. 27) are worth consulting. For vivarana in verses in Prakrit see Ceiyavandanamahabhasa (v. 383-387). The svopajna commentary (p. 144-144) on Dharmasamgraha may be also consulted. 1 This runs as under : "iriyAvahiyAsattaM ettiyamettaM ao para sesaM / ummaggakaraNamuttaM tassa ya eyAriso atyo // 382 //

Page #238
798.) 111. 4 Malasairas 201 uttarIkaraNasUtra Uttarikaranasutra 1220 ( 9 ) No. 796 1884-87. Extent.- fol. 1894 Description.- Complete. For other details see No. 1730-37. Begins and Ends. -- fol. 1892 Trigant etc. up to fit #13tho I practically as in No. 795. N. B.-- For further particulars see No. 795. uttarIkaraNasUtra Uttarikaranasutra No. 797 1106 (12). 1891-95. Extent.- fol. 26. Description.- Complete. For other details see Namaskaramantra No. 736. Begins and Ends.- fol. 2 ta(ta)smuttarIkaraNeNaM etc. up to ThAmi #76#( F# )soj as in No. 795. This is followed by g: N. B.-- For additional information see No. 795. uttarIkaraNasUtra Uttarikaranasutra No. 798 1269 (3). 1887-91. Extent.- fol. 1. Description. - Complete. For other details see Namaskaramantra No. 735. Begins.--fol. 1 tahun tautui etc. up to da 13 vjI as in No. 795. N. B.- For additional information see No. 795. 26 (J.L.P.)

Page #239
202 uttarakaraNasUtra No. 799 Jaina Literature and Philosophy [799. N. B. For other details see No. 795. Uttarikaranasutra 1270 (13). 1887-91. Extent. fol. 3b. Description. Complete. For other details see No. 734. Begins and Ends. fol. 3 tassuttarIkaraNeNaM etc. up to TAmi kAusa ( sa ) gaM / as in No. 795.

Page #240
800.1 III. 4 Malasatras 208: kAyotsargasUtra Kayotsargasutra [ act] [ Annattha ] No. 800 1220 ( 10 ). 1884-87. : Extent.-- fol. 1892. Description. Complete. For other details see No. N 1220 ( 1 ). 1884-87. Author. - A Jaina saint. Subject.- This small work composed in Prakrit explains how one is going to act--what allowances he will make-during the kayotsarga posture. Begins.-fol. 1892 PATHAVOT I SALENCUT I FTATUT I Bigo AHTEGO I gygoi i arafatavoto I Hateg forargeetgi etc. Ends.- fol. 1892 THT A FIGH(TF) GTI FIT STEATOT HETTO FATTOO acq(TV)RTA ata FT I STOTO II AT(AT)OTU I STIUTOT I STOTTON STATH Reference.- Published. See any printed edition of the Pratikra manasutras. For the text, its chaya, Gujarati translation and the posture see my fourth Kiranavali (pp. 74-75 ). Haribhadra Suri's commentary (p. 779 ) to .vasyakasutra, Yogasastra (III) and its svopajna commentary ( pp. 2146-2155), Acaradinakara (p. 3118-3115 )and Vandaruvstti (pp. 156 to 166 ) may be consulted. For an extract see B. B. R. A. S. vols. III-IV, p. 398, and for explanation in verses in Prakrit see Ceiyavandanamahabhasa ( v. 427-497). The svopajna commentary (pp. 1446-1459 ) on Dharmasamgraha may be also consulted. I See p. 134.

Page #241
204 Jaina Literature and Philosophy (801. kAyotsargasUtra Kayotsargasutra No. 801 1106 (13). 1891-95. Extent.- fol. 2b. Description.- Complete. For other details see Namaskaramantra No. 736. Begins.--fol. 2b tema safigui etc. as in No. 800. Ends.-fol. 26 H A 75##nooit etc. up to stealu TATIA U: practically as in No. 800. N. B.- For additional particulars see No. 800. - kAyotsargasUtra Kayotsargasutra No. 802 1270 (14). 1887-91. Extent.-- fol. 36. Description. Complete. For other details see No. 734. Begins.--fol. 36 stargalau etc. as in No. 800. Ends. --fol. 35 A 4T5H( FR )pf I etc. up to 34COTUT alterata II T II as in No. 800. N. B.-- For additional particulars see No. 800. kAyotsargasUtra Kayotsargasutra 1269 ( 4 ). 1887-91. No. 803 Extent.-- fol. 1b. Description. Complete. No. 735. For other details see Namaskaramantra

Page #242
8os.] III. 4 Malasatras 205 Begins.-- fol. rb fry (55) Truj etc. as in No. 801. d . Ends.-fol. I' hoja me kAusa(ssa )ggo etc. up to appANaM bosirAmi // 7 // practically as in No. 801 N. B.- For additional information see No. 800. :. kAyotsargasUtra Kayotsargasutra No. 804 1269 (8). 1887-91. Extent.- fol. 2'. Description. - Complete but mostly abbreviations are given. For other details see Namaskaramantra No. 735. Begins and Ends.-fol. 2* annatthUsasieNaM nI0 khA chI jaM. u0 vA. bha. pittamucchAe 4 mu0 su0 su0 eva 5 kAussaggo 6 jAva na pAromi / 7 tAva vosirAmi / / cha / N. B.- For additional information see No. 800. kAyotsargasUtra Kayotsargasutra 77 ( ). 1880-81. No. 805 Extent.- leaf I2rb to leaf 1221. Description.- Complete. For other details see Agamikavastuvicara. 77 (1). sara No. 1880-81.. Begins.- fol. I21 annatthusasieNaM etc. Ends.-fol. 122* abhaggo avirAhio hoja me kAusa( ssa )ggo / jAva arahaMtANaM / bhagavaMtANaM / namokkAreNaM na pAremi tAva kAyaM chA(ThA )jeNaM / moNeNaM / jhANeNaM appANaM bosirAmi // cha / N. B.- For further particulars see No. 800.

Page #243
206 Jaina Literature and Philosophy ( 806. Parcerias Kayotsargasutrapratika No 806 1270 ( 17). 1887-91. Extent. -- fol. 4* to fol. 46. Description.- Only a taste of wrathofaa is given. For other details see No. 734. Subject.-- The Kayotsargasutra is referred to by its opening words. Begins and Ends.-fol. 4* to fol. 46 N. B.-- For further particulars see No. 800. . kAyotsargasUtrapratIka No. 807 Kayotsargasutrapratika 1220 ( 24). 1884-87. Extent.-- fol. 1904. Description.-- Only a state is given. For other details see O No. 1220 ( 1 ). 1886-87. : Begins and Ends.-- fol. 1908 targafavorheric 11 3 11 N. B.- For additional particulars see No. 806. 1 This and the following numbers up to 813 do not deserve to be counted as separate works; but, even then, a separate serial number is given to them to point out the nature and continuity of works treated in the corresponding Mss.

Page #244
810.) 11). 4 Malasatras 207 kAyotsargasUtrapratIka Kayotsargasutrapratika No. 808 1270 ( 23 ) 1887-91. Extent.- fol. sa. Description.- Only gates are given. For other details - see No. 734. Begins and Ends.- fol. sa STTTATOT I AFECUTUL ! N. B.- For additional particulars see No. 806. kAyotsargasUtrapratIka Kayotsargasutrapratika No. 809 77 (3) 1880-81. Extent.-- leaf 124. Description.-- Only a steftes is given. For other details see No 77 ( 1 ). 1880-81.' . Begins and Ends.- 37h si gule Il Clig 11 N. B.- For further details see No. 806. kAyotsargasUtrapratIka No. 810 Kayotsargasutrapratike 1269 (15). . 1 1887-91. Extent. fol. 2a Description.- Only a gaitas is given. For other details see Namas karamantra No. 735. Begins and Ends.-fol. 2 STERIT gratie lig II N. B.- For additional information see No. 806.

Page #245
208 Jaina Literature and Philosophy [811. kAyotsargasUtrapratIka Kayotsargasutrapratika No. 811 - 1106 ( 16 ) 1891-95. Extent.- fol. 3o. Description.- Only a grafica is given. For other details see No. 736. Begins and Ends.- tol. 3deg 3 2 55 fergu geur N. B.- For additional particulars see No. 806. kAyotsargasUtrapratIka Kayotsargasutrapratika No. 812 Extent.-- fol. 36. Description.- Only gates are given. For other details see Namas karamantra No. 736. Begins and Ends.-- fol. 36 wala 5deg anlato N. B.-- For further particulars see No. 806. kAyotsargasUtrapratIka Kayotsargasutrapratika No. 813 1220 (19). 1884-87. Extent. -- fol. 1896. Description.-- Only a settes is given. For other details see - No._1220 ( 1 ). NO. 1880-87. Begins and Ends.--fol. 1896 arthrGUTHRIE 11 Il N. B.- For additional particulars see No. 806.

Page #246
814. ] nAmastava [ logassasutta ] No. 814 Extent. fol. 189a. III. 4 Malasatras Complete. For other details see No. Begins. fol. 189a logassujo (jjo) gare / dhammatitthayare jiNe / arahaMte kittaissaM / cauvIsaM pi kevalI // 1 Namastava [Logassasutta] 1220 (11). 1884-87. Description. Author. A Jaina saint. - Subject. This sutra composed in 7 verses in Prakrit eulogizes the 24 Tirthankaras of this avasarpini cycle of time. It is hence styled as Cauvvisattho (Sk. Caturvimsatistava). This sutra forms a part of the Avasyakasutra. 209 1220 ( 1 ). 1884-87. caMde nimmalayarA | Aiccesu ahiyaM payAsa ( ya ) rA / sAgaravaragaMbhIrA / siddhA siddhiM mama disaMtu // 7 27 [J. L. P.] usabhamajayaM ca vaMde / saMbhavamabhinaMdaNaM ca sumaI ca paumappu ( pa ) haM suppA (pA) saM jiNaM cava (caM) duppahaM vaMde // 2 // etc] Ends. fol. 189a Reference. Published. See any printed edition of the Pratikramanasutras and my third Kiranavali (pp. 54-56). For a learned discussion in German see " Ubersicht uber die Avasyaka-Literatur" (pp. 6-7). Herein the text is given in Roman characters. An edition containing Haribhadra Suri's commentary (p. 7863) to Avasyakasutra, an edition having Malayagiri Suri's commentary (pp. 591-599) to the same, Yogasastra (pp. 224-228a), Acaradinakara PP. 267-268) and Vandaruvrtti (pp. 40-43) may be consulted. For an extract see B. B. R. A. S. vol. III-IV, p. 398. For explanation Ceiyavandanamahabhasa (v. 515-638) may be referred to. See also Mulacara v. 539 and No. 818.

Page #247
210 faina Literature and Philosophy [815. nAmastava Namastava 1270 ( 15 ). - No. 815 1887-91. Extent. fol. 3 to fol. 4*. Description.- Complete ; 7 verses in all. For other details see No. 734. Begins.--fol. 36 Duratatout etc. as in No. 814. Ends.-fol. 4* ja(g) fatagoreT I etc. up to AA H ol1 as in No. 814. N. B.-- For additional information see No. 814. nAmastava Namastava No. 816 1269 (5). 1deg87-91. Extent.- fol. 1b. Description.- Complete ; 7 verses in all. For other details see Nainaskaramantra No. 73;. "Begins.--tol. 16 FITTEFATTI etc. as in No. 814. Ends. -fol. 1b fFASTTT etc. up to fafc #A TII as in No. 814. N. B.-- For additional information see No. 814. nAmastava Namastava No. 817 1106 (14). 1891-95. Extent.-- fol. 26 to fol. 3o.

Page #248
818. ] III. 4 Malasatras Description. Complete; 7 verses in all. For other details see Namaskaramantra No. 736. Begins. fol. 2b Ends. fol. 3a Sergeanten etc. as in No. 814. nAmastava No. 818 caMde nimmalayarA etc. up to siddhiM mama disaMtu 7 N. B. For additional particulars see No. 814. sara No. Begins.-leaf 122a Extent. leaf 122a to leaf 123a. Description. Complete. For other details see Agamikavastuvicara 77 (I). 1880-81. S etc. as in No. 814. as in No. 814. Ends.-leaf. 123a 211 Namastava 77 ( ). 1880-81. caMdesu nimmalayarA etc. up to siddhiM mama disaMtu // 7 // as in No. 814. N. B. For further particulars see No. 814 and an edition containing Caityavandanasutra and Lalitavistara (pp. 89b-96b) and Dharmasamgraha (pp. 1552-158a).

Page #249
212 Jaina Literature and Philosophy 1819. caityastava Crityastava [ BATEZ ETTI] [ Arihantaceiyanam ] No. 819 77( ). 1880-81. Extent.- leaf 1216 to leaf 122a. Description.- Complete. For further particulars see Agamnikavastuvicarasara No. 77 (1). 1880-81. Author.- A Jaina saint. Subject.-- This work is included in the Avasyakasutra. It is one of the Pratikramanasutras in Prakrit and constitutes the Caityastavadandaka. It is connected with the aradhana of Sthapanajina. This work mentions the reasons of doing so. Begins.-- leaf 1216 SRETETTU I TA #13FAST I equaturg Jal?g sauraitrurg i FaerTaITTIT I FIAT Talaturg i etc. Fnds.-- leaf 122a fh( ETT HETT I fag I ATTUTIC I cagig 1 baDamANIe / hAmi kAusaggaM Reference.- Published. See any printed edition of the Prati kramanasutras. For chaya and Gujarati translation along with the text see my fourth Kiranavali (p. 76). Haribhadra Suri's commentary (p. 786) to Avasyakasutra, Vandaruvstti (pp. 36-37), Yogasastra and its commentary (pp. 223-224), Ceyiavandanamahabhasa (v. 642-652) and an edition having Lalitavistara (pp. 766-846) may be consulted. For an extract see B. B. R. A. S. vols. III-IV, p. 398. Ubersicht uber die Avasyaka-Literatur" (p. 2) may be also referred to. caityastava Caityastava 1270 (16). No. 820 1887-91. Extent. -- fol. 4*. Description.- Complete. For other details see No. 734. Begins.-fol. 4* eart SATENETESTO I etc. as in No. 819.

Page #250
823. ] III. 4 Malasutras 213 Ends. --fol. 4* FETT AErg etc. up to Jo #13#(*)si as in No. 819. N. B.- For additional information see No. 819. caityastava Caityastava No. 821 1220 (18). 1884-87. Extent. -- fol. 1896. 1220 (1). Description.-- Complete. For other details see No. 1? 1884-87. Begins.-- fol. 18yBATETETTO etc. as in No. 819. Ends.--fol. 1896 HEIC ETC I (ET UITOTIC I haq(ca ETC I IGHIUSI STA F13F(FA)HOT I N. B.- For other details see No. 819. caityastava Caityastava No. 822 1106 ( 15 ). 1891-35. Extent. fol. 3a. Description.- Complete. For other details see Namaskaramantra No. 736. Begins.- fol. 3a ang HTET TESTOj etc. as in No. 819. Ends.- fol. 3a FEIT AEIT etc. up to JuA FI5H(F)si as in No. 819. N. B.- For additional particulars see No. 819. caityastava Caityastava 1269 (7) 1887-91. No. 823 Extent.-- fol. 2a.

Page #251
214 Jaina Literature and Philosophy [ 823 Description.- Complete. For other details see Namaskaramantra No. 735. Begins.- fol. 2* 31TEC ETIO etc. as in No. 819. Ends.-- fol. 2* FEIT AEIT etc. up to FISFIT as in No. 819. This is followed by 3. N. B.- For additional information see No. 819. caityastava Caityastava 1269 (9). No. 824 1887-91. Extent.-- fol. 2a. Description.- Only the opening line is given. For other de:ails see Namaskaramantra No. 735. Begins and Ends. - fol. 24 savvaloe arihaMtaceiyANaM karemi kAussaggaM vaMdaNavattiyAe ityAdi cha N. B.- . For additional information see No. 819. caityastava Caityastava 1270 ( 20 ). No. 825 1887-91. Estent.- fol. 46. Description.-- Only a portion is actually mentioned. For other details see No. 734. Begins and Ends.- aqoralatig i gauraieng i France 113 11 N. B.- For additional information see No. 819.

Page #252
829.) 111. 4 Malasatras 215 caityastavapratIka Caityastavapratika No. 826 1220 ( 12 ). 1884-87. Extent.- fol. 189". Description.- Only the tales of this sutra are given. For details see Pratyakhyananiryukti No. 1220 (1). 1884-87.. Begins and Ends. fol. 1894 575 SATENETETIT !! It ends thus. caityastavapratIka Caityastavapratika 77 ( ). No. 827 1880-81. Extent.-- leaf 1236 Description.- Only a states is given. Begins and Ends.- leaf 1236 auraietats 11 g 1 N. B.- For additional information see No. 819. caityastavapratIka Caityastavapratika No, 828 1269 (12) 1887-91. Extent.-- fol. 24. Description.- Only a garx is given. For other details see Namas karamantra No. 735. Begins and Ends.- fol. 2* aga prate I II N. B.- For additional information see No. 819. caityastavapratIka Caityastavapratika 1:05 (19). No. 829 1891-95. Extent.-- fol. 36. Description.-- Only a gata is given. For other details see Namaskaramantra No. 736. I The remark made (on p. 203) in connection with Kayotsargasutrapratika holds good in the case of this and the willgnoof works 827 829.

Page #253
216 Begins and Ends. fol. vaMdaNavattie ityAdi. N. B. For additional information see No. 819. zrutastava [ pukkharavara ] No. 830 Begins. fol. 123a 1 Jaina Literature and Philosophy Extent. leaf 123a to leaf 123b. Description. Complete. For further particulars see No. Subject. One of the Pratikramanasutras in Prakrit. Sukhlal does not consider this sutra as a part and parcel of Avasyakasutra. For his remark see his prastavana (p. 45) to his edition of Pancapratikramana. This sutra consists of 4 verses in Prakrit. The first deals with salutation to the Tirthamkaras and the next three with the eulogy of srutadharma. Ends. fol. 123b . Reference. pukkharavaradIvaDe dhAyaisaMDe ya jaMu ( ba ) dIve ya bharaheravayavidehe / dhammAigare nama'sAmi / 1 etc. [829. Srutastava [Pukkharavara ] 77 ( ). 1880-81. siddhe bho payao Namo jiNamae naMdI sayA saMjame devanAgasuvannakinnaragaNassabbhUabhAvaccie / logo jattha paTTio jagamiNaM telakama cAsuraM 77 (1). '1880-81.' age en faveu umiiai age || 8 This work also known as Siddhantastava is published. See any printed edition of the Pratikramanasutras. Haribhadra Suri's commentary (p. 788a) on Avasyakasutra, the edition containing Caityavandanasutra and Lalitavistara (pp. 97-106b) and Vandaruvrtti (pp. 45-18) may be consulted. Also see Ceiyavandanamahabhasa (v. 653-699). For an extract see B. B. R. A. S. vols. III-IV, p. 398. The portion of the 2nd line of the last verse viz. devanAgagaur is quoted by Jinaprabha Suri in his com - mentary (p. 1o) to Upasargaharastotra. Vide D. L. J. P. F. Series, No. 81. "Ubersicht uber die Avasyaka-Literatur" (p. 2) may be consulted.

Page #254
885) 111. 4 Malasutras 287 Srutatava No. 831 1270 (18). 1887-91. Extent.-- fol. 46. Description.- Complete ; 4 verses in all. For other details see No. 734. Begins.-fol. 4" framaraiag etc. as in No. 830. Ends.- fol. 4" TFA agt(3) etc. up to syrgai agait, as in No. 830. This is followed by 8 11 N. B. - For additional information see No. 830. i zrutastava Sranastava No. 832 1269 (10). 1887-91. Extent.-- fol. 2". Description.- Complete ; 4 verses in all. For other details sec Namaskaramantra No. 735. Begins.--fol. 2* gertateras etc. as in No. 830. Ends.-fol. 24 JFAT TE@t etc. up to TFATTE agat i as in No. 830 This is followed by 8. N. B.-- For additional information see No. 830. zrutastava Srutastava No. 833 1220 ( 20 ). 1884-87. Extent.-- fol. 1876 to fol. 190deg. 12201). Description. - Complete. For other details see No. 7 * 1884-87. Begins.-. fol. 1890 gramating etc. as in No. 830. Ends.-- fol. 1909 TFT 753 FIFTIMATE 78 gaat as in No. 830. N. B.-- For other particulars see No. 830. 28 ( J. L. P. 1

Page #255
218 zrutastava No. 834 Jaina Literature and Philosophy | 834. - Srutastava 1106 (17). 1891-95. Extent. fol. 3a. Description. Complete; 4 verses in all. For other details see Namaskaramantra No. 736. Begins. fol. 3 gara etc. as in No. 830. Ends. fol. 34 dhammo bahuo etc. up to dhammottaraM baDhao as in No. 830. This is followed by 8. N. B. For additional information see No. 830.

Page #256
836. 1 III. 4. Malasatra's wdh . siddhastava Siddhastava : [ragioi giui) [ Siddhanam buddhanam ] No. 8351 1220 (22). 1884-87. Extent. -- fol. 1902. Description.- Complete; 5 verses in all. For other details - see 1220 ( 1 ). No. 1884-87. Author.-- A Jaina saint. Subject.-- This small metrical composition in Prakrit is a hymn which praises the liberated. Begins.-fol. 1902 siddhANa buddhANaM / pAragayANaM paraMparagayANaM / harga( ? st Jerui I F J (Dat waaiergratoi etc. Ends. fol. 1902 cattAri aTTa dasa do ya bNdiyaa| jiNavarA caubIsaM / siddhA siddhiM mama disaMtu // 4 (? 5) Reference. - Published. See any printed edition of the Prati kramanasutras. Haribhadra Suri's commentary' (p. 789) to Avasyakasutra where the first 3 verses are explained, the edition of Caityavandanasutra with Lalitavistara a (pp. 1066-118*) and Vandaruvitti (pp. 49-51) may be : consulted. For an extract see B. B. R. A. S. vols. III-IV, p. 398. For different interpretations of the last verse given here, see my edition containing Bhavaprabha Sari's Jaina: dharmavarastotra etc., published as No. 84 in the Sheth D. L. J. P. F. Series, in A. D. 1933 Sukhlal does not consider this sutra as a part of the Avasyakasutra. For his remark see his prastavana (p. 45 ) to his edition of Panca pratikramana. Ceiyavandanamahabhasa ( v. 711-771 ) and ubersicht uber die Avasyaka-Literatur (p. 2) may be consulted. On p. 789a, there is a remark as under : "etAstisraH stutayo niyamenocyante, kecidanyA api paThanti, na ca tatra niymH|" 2 On p. 112b, it is stated that "Cartet: tatt faza1979, Arta 3110 paThanti, na ca tatra niyama iti ma taLyAkhyAnakriyA"

Page #257
Jaina Literature and Philosophy [836. sikhastava Siddhastava No. 836 1269 (18). 1887-91. Extent.- fol. 2a. Description.- Complete. For other details see Namaskaramantra No. 735. Begins.-- fol. 2* feroi terui etc. as in No. 835. Ends.- fol. 2 *ift og etc. up to fa fa il as in No. 835. This is followed by %. N. B.- For additional information see No. 835. siddhastava Siddhastava No. 837 1270 ( 21 ) 1887-91. Extent.-- fot. qs to fol. 5* Description.- Complete. For other details see No. 734. Begins.--fol. 40 fraro TT etc. as in No. 835. Ends--- fol sa aft sang etc. up to a fornire il y as in No. 845. N. B.- For additional information see No. 835.

Page #258
839. ] siddhastava No. 888 No. 736. Begins. fol. 3b Ends. fol. 3b fageda Extent. fol. 3b. Description. Complete. For other details see Namaskaramantra iii. rror roi etc. as in No. 835. 4 Malasatras Begins. leaf 123b - cattAri aTTa etc. up to mama disaMtu // as in No. 835. This is followed by ". N. B. For further particulars see No. 835. Ends. leaf 124a faro gero etc. as in No. 835. 241 Siddhastava No. 839 Extent. leaf. 123b to leaf 124. Description. Complete. For additional details see Agamika vastuvicarasara No. 77 (1).. 1880-81. 1106 (20). 1891-95. N. B. For additional information see No. 835. Siddha stava 77 ( ). 1880-81. cattAri aTTa etc. up to mama disaMtu etc. as in No. 835i

Page #259
222 caityavandanasUtra ( ceiyavaMdaNasutta) vbAsahita Jaina Literature and Philosophy 7 22 1840. No. 840 Size.-- ro in by 4 in Extent.-- 7 folios; II lines to a page ; 40 letters to a line. Description.-- Country paper thin, tough and white ; Jaina Devanagari characters with occasional gears; big, clear, uniform and good hand-writing; borders ruled in four lines in black ink; white pigment used; foll. numbered in both the margins; complete so far as it goes; condition very good. Age.- Pretty old. Author of the text. - Not mentioned. tabba.-- Caityavandanasutra ( Ceiyavandanasutta ) with tabba 99 999 Subject. This Ms. starts with the enumeration of 4 mangalas and 4 saranas. Then follows the exposition of the charac teristics of a Tirthamkara in verses in Prakrit. Namutthunam along with its explanation in Gujarati forms the succeeding topic. The distinguishing features of the liberated, the Acaryas, Upadhyayas and Sadhus make up the concluding portion of this Ms. Begins. - ( text ) fol. 14 zrIvItarAgAya // " 690. 1892-95. cAri maMgalaM / arihaMtA maMgalaM // siddhA maMgalaM // sAhU maMgalaM // hee (fort dhammo maMgalaM // cattAri logutta ( mA ) // arihaMtA loguttamA // siddhA loguttamA / sAhU loguttamA / kevalipatto dhammo logu tamA // cattAri saraNaM pavvajjAmi // arihaMtA saraNaM pavvajjAmi // siddhA saraNaM pavvajjAmi // sAhU saraNaM pavvajjAmi // keva ( li) patto dhammo saraNaM pavvajjAmi | gAthA // cauraMgo jiNadhammo / ma kayo cauraMgasaraNi jiNa meM kayo / cauraMgo bhavachoho / na kayo tiNi hAriu ammo / dullabho mANuso jammo / dhammo sanvannamAsio / sAha sAhamImANaM ca / sAmaggI puNa dulahA // 2 / etc.

Page #260
840.1 III. 4 Malasatras 223 (text) fol. 1b jagamattha itthayANaM / vayasIlavaranANadasaNadharANaM // nANaM joyagirANaM // logaMmi namo zrI(siri )jiNavarANaM // 18 // icchaM icchAmi khamAsamaNo baMdiuM // jAvaNijjAe // nisIhiyAe / matha(ttha)eNa vNdaami|| Begins.- (tabba ) fol. I icchAkAreNa saMdisaha / bhagavana caityavaMdana karUM / nissIhaM // namotthu NaM / namaskAra hau // arihaMtANa / arihaMtanai / paNi kisyA chai te zrIarihaMta / jAtivaMta / kulavaMta / balavaMta // rUpavaMta / jJAnavaMta / zrutavaMta / saubhAgyavaMta / etc. (rabba ) fol. 4 namo AyariyANaM / mAharau namaskAra zrIAcArya pratiiM hau // paNi kisyA chaI te zrIAcArya / je zrIAcArya paMca viddhi AcArU pratipAlai etc. Ends.- ( text ) fol. sa paDirUvAI caudasa // paM(kha)tIpamuhAI dasaviho dhammo / bArassa baMbhovaNAe / sUriyaNA hu~ti chattIsA // 5 // paMciMdiyasaMvaraNo / nvvihbNbhcerguttidhro| cauvihakasAyamukko e aTTArasaguNehiM saMjutto // 6 // paMcamahavvayajutto / paMcavihAyArapAlaNasamattho // paMcasamaI(? o) tigutto / chattIsaguNe(No) guru(rU) majjha // 7retc. ,, --- (tabba) fol. 7deg kummo vai guttidie| puDhavI jima savvasahe / samudra jima gaMbhIre / pukkhariNIpatra jima nilepai // isyA chaiMje saadhu|| bhagavatI dayA taNA pratipAlaka / bhagavatI ahiMsA sarvabhUtanaI SemakArI / sA(?)puruSa sapuruSiiM sevI / kAyara kAtara janiiM pariharI / tehanA pratipAlaka // anAtha jIvanA nAtha / apIhara jIvanAM pIhara / azaraNa jIvanAM zaraNa / sarvajJaputra sAdhu / nIrAga / nikaMcaNa / nirahaMkArI / ni()parigrahI / niraarNbhii| zAMta dAMta / ratnatrayasAdhaka / aDhAI dvIpa mAhiiMje keI chaI sAdhu // te savi huM sAdhu prati mAharu namaskAra / paMcAMga.praNAma trikAla vaMdana sadA sarvadA hau // iti zrIcaityavaMdanapAMcapadanavakAra samAptaH // zrIH // cha // shriiH||

Page #261
224 Jaina Literature and Philosophy [841 lalitavistarA Lalita vistara (caityavandanasUtravyAkhyA) (Caityavandanasutravyakhya 1241. No. 841 1886-92. Size.- Io in. by 4g in. Extent.-38 folios ; I3 lines to a page ; 45 letters to a line. Description.- Country paper tough and white ; Jaina Devanagari characters; big, legible, uniform and good hand-writing; borders ruled in three lines in red ink, and edges singly ; fol. 1 blank; so is the fol. 38b; this Ms. contains the gates of the text; foll. numbered in the right-hand margin only; condition very good ; extent 1270 slokas. Age.-- Samvat 1825. Author.- Haribhadra Suri (Yakinimahattarasunu ). See pp. __104-I0S and Weber II, p. 924, fn. 4. Subject.- A very beautiful, important, interesting and instructive commentary (vyakhya) on Caityavandanasutra. This vyakhya also styled as vitti is at times mistaken for Lalita vistara, a Buddhist work. Begins.-fol. 1 9 namaH zrIvIrasvAmine / praNamya bhuvanAlokaM mahAvIraM jinottamaM / caityavaMdanasUtrasya vyAkhyeyamabhidhIyate // 1 // anaMtagamaparyAyaM srvmetjjinaagme|| mUtraM yato'sya kAtsnyena vyAkhyAM kaH kartumIzvaraH ? // 2 // etc. ityatrAha ciMtyamatra sAphalyaM caityavaMdanasyaiva niHphalatvAt ityatrocyate etc. Ends.-fol. 384 prakRtisaMdaraM ciMtAmaNiratnakalpaM saMvegakArya vaitari(di)ti mahAkalyANa virodhena ciMtAmaNiratne(5)pi samyagajJAnaguNa eva zraddhAdyatizayabhAvato'vidhiviraheNa mahAkalyANasiddhi ityalaM prasaMgena AcAryaharibhadreNa dRbdhA sannyAyasaMgatA caityavaMdanasUtrasya vRttilalitavistarA // 1 // ya enAM bhaavytyuccairmdhysthenaaNtraatmnaa| savaMdanAM sabIjaM vA niyamAdadhigacchati // 2 // .

Page #262
841.] III. 4 Malasatras 225 parAbhiprAyasaM(ma)jJAtvA tatkRtasya ca vastunaH / guNadoSau satto(tA) vAcyau prazna eva tu yujyate // 3 // praSTavyo'nyaH parIkSArthamAtmano vA parasya ca / jJAnasya vA(cA)bhivRddhyartha tyAgArtha saMzayasya ca // 4 // a(kotvA yadajitaM puNyaM mayainAM zubhabhAvataH / tenAstu sarvalokAnAM mAtsaryavirahaH paraH // 5 // lalitavistarA nAma caityavaMdanavRttiH samAptaH (tA) ||ch // kRtiriyaM yAkinIdharmamUnorAcAryaharibhadrasyeti graMthAgramanuSTupachaMdasA zlokazatAni dvAdaza saptatyA samanvitAni aMki(ka)to(s)pi / graMthAyazloka 1270 pramANamat (?) // saMvat 1825 mArgazira sudi 7 sAtima vAra zukre / paM0 bhu(bhUpativijaya la(li )piikRtN.|| zrI sthaMbhatIrthe ' / cha etc. Reference.- Published in D. L. J. P. Fund Series as No. 29 in A. D. 1915. This edition contains Municandra Suri's panjika which explains some portions of Lalitavistara. Over and above this, the following sutras are given in this edition: (a) Namutthu nam pp. 70-84. (b) Caityastava p. 760. (c) Kayotsargasutra p. 846. (d) Caturvimsatistava pp. 896, 92, 93* and 96deg. . (e) Srutastava pp. 97", 100', 101, Ior' and 1024. (f) Siddhastava' pp. 1066 and 109a. (g) Prarthanasutra p. 114. These sutras along with Lalita vistara have been published by Rsabhadevaji Kesarimalaji Samstha, Rutlam, in A. D. 1934, since the above-mentioned edition has been long since unavailable. For an additional Ms. see B. B. R. A. S. vols. III-IV ( pp. 423-424), and for a Ms. of this Lalitavistara along with a supercommentary by Municandra see Keith's Catalogue No. 7496. ____Kielhorn's Report for i880-81 (p. 14) may be also consulted. . * Only i verses are given 19 10.L.P.1

Page #263
226 Jaina Literature and Philosophy ( 842. lalitavistarA Lalitavistara 151. No 842 1872-73 Size.-- 104 in. by 4. in. Extent.-- 24 folios ; 15 lines to a page ; 60 letters to a line. Description.- Country paper thin, rough and whitish ; Jaina Deva. nagari characters with GEHETS; small, legible and tolerably good hand-writing; borders ruled in two lines in black ink; foll, numbered in the right-hand margin just at its foot ; iol. 1a blank : this Ms. seems to be exposed to fire ; several foll. less legible, on account of ink having spread out or perhaps due to the portion being sooty ; bits of paper pasted to the last few foll; condition on the whole unsatisfactory ; this Ms. contains only the gates of the text complete; marginal notes given in the 1st 3 foll, Age.- Samvat 1473. Begins.- fol. ab A: THEIT II qurtu ya * etc. as in No. 841. Ends. fol. 24" Toraggi etc. up to Fafara as in No. 841. This is followed by saMvata 1473 varSe azvana vadi 7 zanau zrI pattane likhitaM // ni wa Ilg 11 N. B.- For additional information see No. 841. compic llitvistr| Lalitavistara No. 843 1151. 1887-91. Size.- 14 in. by 49 in: Extent.-- 20 folios; 17 lines to a page ; 62 letters to`& line. Description: Country paper thin, rough and greyish ; Jai'na Deva. nagari characters with THTTS small, legible and good

Page #264
844.1 111. 4 Malasatras 227. hand-writing ; borders ruled in three lines in red ink; foll. numbered in the right-hand margin only ; edges of a few foll. slightly worn out; condition on the whole good; complete ; extent 1270 slokas. Age.- Samvat 1489. Begins.-fol. 1deg ARi Harry II TOTFC yaarsia etc. as in No. 841. Ends.- fol. 20 tafariqi etc. up to ar para: FATAT:( AT ) as in No. 841. This is followed by SEFAN JARTA TIETETcAryaharibhadrasyeti / cha / graMthAgramanuSTupachaMdasAM zlokazatAni dvAdaza saptatyA samandhitAni graMthAnaM 1070 // saM0 1489 bhAdrapada zudi 10 bhaume lekhitA N. B.-- For further particulars see No. 841. lAlitavistarA Lalitavistara 20. No. 844 1880-81. Size.-- 129 in. by 18 in. Extent.- 60 to 143 plus some fragmentary leaves preceding the 6oth ; 2 to 4 lines to a leaf ; 45 letters to a line. Description.- Palm-leaf durable and greyish ; Jaina Devanagari cha racters with TEHETS; sufficiently big, legible and good hand-writing; this Ms. presents an appearance of the work having been divided into two columns, but it is not so; for, the lines of the first column extent to the second ; borders of each of the columns ruled in black ink ; red chalk used; leaves numbered in both the margins; in the right-hand one in numbers and in the left-hand one in letter-numerals e. g. 4 represented as a symbol given in Appendix IV (p.17) to part II of Vol. XVII ( D. C. J. M.); leaves preceding the both in fragments; condition unsatistactory; fragmentary leaves are kept separate.

Page #265
Jaina Literature and Philosophy 228 Age. -- Old. Begins.--leaf 604 tadbhakta ityucyate / na ca duSTetarAvagame vicAramaMtareNa vicArazva yuktigarbha ityAlocanIyAmatatktapapatitodAharaNamapyudAharaNamAtraM // nyAyA'nupapatteH tadudbhUtAderapi tathA darzanAbhAvAt etc. Ends.- leaf 1434 mahAkalyANavirodhi na cintanIyaM / ciMtAmaNiratne ( ( ) pi samyaga - jJAtaguNa eva zraddhAtizayabhAvato (S) vidhiviraheNa mahAkalyANasiddherityalaM prasaMgena // cha // [$44. AcAryaharibhadreNa vA saMnyAyasaMgatA / caitthavaMdanasUtrasya vRttirlalitavistarA // cha // ya enAM bhAvayatyuccairdharmasthenAMtarAtmanA / sada (?) tAM (su) bIjaM vA niyamAdadhigacchati // parAbhiprAyamajJAtvA tatkRtasya na vastunaH / guNadoSau sadA vAcyau / prazna eSa tu yujyate // To ( S)nyaH parIkSArthamAtmano vA parasya ca / jJAnasya cAbhivRddhyarthe tyAgArtha saMzayasya vA // kRtvA yadarjitaM puNyaM mayainAM zubhabhAvataH tenAsva (stu) sarvasattvAnAM mAtsaryavirahaH paraH // cha // lalitavistarA nAma caityavaMdana vRttiH samAptAH // cha // kRtirdharmato jAkinImahattarAkhUnorAcArya haribhadrasyeti // cha // graMthAgramanuSTupachaMdasA zlokazatAni dvAdaza saptatyA samanvitAni // maMgalaM mahAzrIH // zubhaM bhavatu // cha // cha // cha // N. B. -- For further particulars see No. 841. lalitavistarApaJjikA Lalitavistarapanjika 1241. 1887-91. No. 845 Size.-- rok in. by 4g in. Extent. - 37 folios; 16 lines to a page ; 64 letters to a line. Description. - Country paper thin and grey; Jaina Devanagari cha racters with pRSThamAtrAs; small, legible and good hand-writ

Page #266
845.] 111. 4 Malasatras 229 ing; borders ruled in four lines in black ink; red chalk used ; white pigment used ; fol. 35b blank ; complete; the praNipAtadaNDaka ends on fol. 27deg; extent 2050 Slokas%3; condi tion very good. Age.- Seems to be pretty old. Author.- Municandra Suri, pupil of Vinayacandra Suri and guru of the celebrated Vadi Deva Suri. See Peterson, Reports III, p. 244, v. 3. In Keith's Catalogue, in No. 7496 where both Lalitavistara and the Panjika are noted, Municandra is said to be the author of the former as such an erroneous statement is made by the scribe who wrote it. Of course, Gaikawar who has described (?) this Ms. has noted this mistake and has referred to Kielhorn's Report for 1880-81 (p. 14) where the correct entry is made. Subject. This is an elucidation of difficult phrases etc., occurring in Haribhadra Suri's Lalitavistara, a commentary explaining the Caityavandanasutra, up to Siddha-Mahaviradi-stava. Begins.-fol. 11 ntvaa(s)nuyogddhebhyshcaityvNdngocraaN| vyAkhyAmyahaM kvacitkiMcivRttiM lalitavistarAM // 1 // A(yAM) buddhvA kila siddhasAdhurakhilavyAkhyAtRcUDAmaNi ___ saMbuddhaH sugataH(ta)praNItasamayAbhyAsAccalaccetanaH / yatkartuH svakRtau punarutayA cakre namasyAmasau ko hyenAM vivRNotu nAma vi[]vRttiM smRtyai tathA(s)pyAtmanaH // 2 zAstrAMtaradarzanataH svayamapyahAd gurUpadezAta tu| kriyate mayaiSa durgamakatipayapadapaMjikAraMbhaH // 3 // tatrAcAryaH ziSTAcAratayA vighnopazamakatayA ca maMgalaM prekSAvatpravRttyarthamabhidheyaM saprasaMgaM prayojanaM sAmarthya gamyaM saMbaMdhaM ca vaktukAma Aha // praNamye tyAdi / tatra praNamya prakarSaNa natvA // etc. Ends.-fol. 37 apunabaMdhakasyaiva lakSaNamAha bho(noDa)pi punabaMdhakocitasamAcArA kathaMcu(ci)kacyuto(Da)pi / etadyannaliMgaH punazco(: svo)citaacaarprytnaavseyo'punbNdhkH| AdidhArmika iti etaditi / idameva prakRtaM caityavaMdanavyAkhyAnamiti / mahetyAdi mahataH saccaityavaMdanAdeH kalyANasya kuzalasya

Page #267
Jaina Literature and Philosophy [845. virodhi bAdhakamavajJAviplAvanAdi na naiva ciMtanIyamadhyavaseyaM kuta ityAha ciMtAmaNItyAdi sumNglN|| iti zrImunicaMdrasUriviracitAyAM lalitavistarApaMjikAyAM siddha mahAvIrAdistavaH samAptaH // tatsamAptau ca samApteyaM llitvistraapNjikaa| kaSTo graMtho matiranipuNA saMpradAyo na tAdRk / zAstraM taMtrAtaramatagataM saMnidhau no tathApi / svasya smRtyai parahitakRte cAtmabodhAnurUpaM / nAgAmAgaH padamahAmaha vyAvRtazcitta zuddhyA // pratyakSara nirUpyAsya graMthamAnaM vinizvitaM / anuSTabhaM(bhAM) sahasra dve paMcAsa(zadadhike tathA / 2050 // This is followed in a different hand by the lines as under :saMvignenAMtipadA tpgnnptivijysensriinnaaN| zrIrAmavijayakRtinA cikoze pratiriyaM muktA // 1 // Reference.- Published along with Lalitavistara in the D. L. J. P. F. Series as No. 29. See Guerinot Bibliographie, p. 55. For additional works of this author and the Ms. see B. B. R. A. S. vols. III-IV, pp. 423-424. lalitavistarApaJjikA Lalitavistarapanjika 21. No. 846 1880-81. Size.- 12 in. by it in. Extent.- 249 + I + I = 25I leaves ; 2 to 4 lines to a leaf; 45 letters to a line. Description.- Palm-leaf durable and greyish; Jaina Devanagari cha racters with pRSThamAtrA ; sufficiently big, legible, uniform and good hand-writing : this Ms. presents an appearance of the work having been divided into two columns, but really it is not so; each of the columns ruled in three lines in black

Page #268
846.) III. 4 Malasatras 231 ink ; leaves numbered in both the margins; in the righthand one as 144, 145 etc., and in the left-hand one as 5) ) etc.; for some of the letter-numerals e. g. for 4, 6 gha gha c ), a and 9 see Appendix IV (pp. 17, 18 and 19 ) to Part II of Vol. XVII ; leaves in this Ms. start with 144 and they go up to 392 ; complete ; condition very good ; there is one extra leaf both in the beginning and in the end. Age.- Fairly old. Begins.- leaf 144.AAT STATIOTTI ar(s)auttaat: etc. Ends. -- leaf 3916 gaasutt etc. up 10 trupa Teer practically as in No. 846. Then we have: yAdRza pustakaM dRSTA tAdRzaM likhitaM mayA yadi zuddhamazuddha vA mama doSo na vidyate / / N. B. - For additional particulars see No. 846.

Page #269
232 Jaina Literature and Philosophy [ 847. caityavandanabhUtravRtti Caityavandanasutravrtti No. 847 1293 (a). 1886-92. Size. - 111 in. by 41 in. Extent.-- 20 folios ; 14 lines to a page ; 45 letters to a line. Description. -- Country paper rough and white; Jaina Devanagari characters with occasional pRSThamAtrAs; small, legible and very fair hand-writing ; borders ruled in four lines in black ink; red chalk used; foll. numbered in the right-hand margin only; complete; some of the foll. slightly wormeaten; condition good; this Ms. contains the following additional works : (1) bandanakavivaraNa foll. 6deg to Iob ( No. 857). (2) pratyAkhyAnavRtti , Iodeg ,, I4 (3) kAyotsargadoSa fol. 14b (4) zrAddhapratikramaNasUtra laghuvRttisahita foll. I4 to 20deg. Age.- Not modern. Author.- Sritilaka Suri. Subject.-- a commentary in Sanskrit to Caityavandanasutra. Begins.- fol. I. zrIvIrajinavareMdra baMditvA caityavaMdanAdIni / alparucikatvahetovivariSye gamanikAmAtraM // 1 iha caityavaMdanAdInAM / vRttirArabdhapara iriyAvahiyAe / appaDikvaMtAe na kappai / kiMci ceiyavaMdaNa sajjhAyA ityAgamAt prathamamairyApathikI etc. Ends.-- fol. 6deg zubhaguruyogaH / tadvacanasevanA / AbhavaM AsaMsAraM / akhaMDA saMpUrNA idaM ca / praNidhAnAM na nidAnarUpaM / prAyeNa nisaMgAdibhilASarUpatvAt // cha / iti zrIzrItilakAcAryAviracitA caityavaMdanAvRtti samAptAH ||ch|| shrii||||

Page #270
848. ] caityavandanasUtravRtti No. 848 III. 4. Malasatras Extent. fol. 10a to fol. 13 Description. Complete. For other details see No. Begins. fol. 10a 30 J. L. P.] Caityavan danasutravrtti 200 (b). 1873-74. fr etc. as in No. 847. Ends. fol. 13 : etc. N. B. For further particulars see No. 847. 233 200 (a). 1873-74.

Page #271
234 Jaina Literature and Philosophy 'saMsAradAvAnalastuti No. 849 Samsaradavanalastuti 1220 (25). 1884-87. Extent. fol. 1902. Description. Complete; 4 verses in all in what is known as Sama-Samskrta i. e. in Sanskrit and Prakrit as well. For other details see No. 1220 ( 1 ). 1884-87. Ends. fol. 190a Author. Haribhadra Suri, the Yakinimahattarasunu. For details about him see pp. 104, 105 and 224. Subject. The 1st verse deals with eulogy of Lord Mahavira; the 2nd, with a panegyric of all the Tirthamkaras; the 3rd, with salutation to the holy scriptures; and the 4th, with a stuti of Srutadevi. Begins. fol. 190a [849. saMsAradAvAnaladAhanIraM sa (saM) mohalIharaNa (Ne) samIraM / mAyArasAdAraNasArasIraM / namAmi vIraM girisAradhIraM // 1 // bhAvAvi (va) nAmasuradAnavamAnavena cUlAvilolakamalAvalimAlitAni / saMpUritAbhinatalo kasamIhitAni / kAmaM namAmi jinarAjapadAni tAni // 2 // bodhAgAdhaM padapadavInIrapUrAbhirAmaM / jIvAhiMsAviralalaharIsaMga mAgAhadehaM / cUlAvelaM gurugamamaNIsaMkulaM dUrapAraM / sAraM vIrAgamajalanidhiM sAdaraM sAdhu seve // AmUlAloladhUlIbahula parimalAlI DhalolAlimAlA - jhaMkArArAbasA rAmaladalakamalAgAra bhUmInevAse ! |

Page #272
851.) III. 4 Malasatras chAyAsaMbhAra sAre ! varakamalakare ! tAratA (hA ) rAmarAme ! "" Reference. Published. See any printed edition of the Pratitkramanasutras noted on p. 138. See Prathamajinastava and Parsvajinastava, each of which is a Padapurti-kavya of every carana of this Samsaradavanalastuti, and each of which is published in Jainastotrasamgraha (pt. I, pp. 65-69) in Yasovijaya Jaina granthamala, in Vira Samvat 2439 (2nd. edn.). For another kavya of this type see pp. 64-69 of mAMDavagaDhakA mantrI athavA pethaDhakumArakA paricaya" published as zrIhaMsavijayajI jaina phrI lAyabrarI graMthamAlA puSpa 11 in Samvat 1979. saMsAradAvAnalastuti No. 850 vANIsaMdohadehe ! bhavavirahavaraM dehi me devi ! sAraM // 4 zrImahAvIrastutiH // cha // Ends. fol. 3b I Extent.- fol. 3b. Description. Complete; 4 verses in all. For other details see Namaskaramantra No. 736. Begins. fol. 3b saMsAradAvAnalastuti 235 Samsaradavanalastuti 1106 (23). 1891-95. #angranasqizar etc. as in No. 849. bodhAgAdhaM etc. up to deva (hi) me deva ( vi ! ) sAraM 4 as in No. 849. This is followed by iti zrIvarddhamAnastutiH N. B. For additional information see No. 849. Samsaradavanalastuti 1270 (28). 1887-91. No. 851 Extent. fol. 6a to fol. 6. Description. Complete; 4 verses in all. For other details see No. 734. In No. 850, this work is styled as Sri-Varddhamanastuti.

Page #273
236 Jaina Literature and Philosophy ( 851. Begins.- fol. 62 1160 #Tea ter I etc. as in No. $49. Ends.-- fol. 66 wuri etc. up to eit A fa! Fii 118 01 as in No. 849. This is followed by thigiteaia: 11 g II N. B.- For further particulars see No. 849. saMsAradAvAnalastuti Samsaradavanalastuti vyAkhyAsahita with vyakhya No. 852 327. 1871-72. Size.-- 95 in. by 41 in. Extent.-- I folio; 16 lines to a page; 43 letters to a line. Description.- Country paper somewhat thick, tough and white; Jaina Devanagari characters; small, quite legible, uniform and very good hand-writing ; borders ruled in two lines and edges in one in red ink ; yellow pigment used while making corrections; there is only one fol., and it is numbered in the right-hand margin ; condition very good ; both the text and its Gujarati commentary complete. Age.- Not modern. Author of the commentary.- Not mentioned. Subject.-- The text together with its explanation in Gujarati. Begins.-- (text) fol. ray troll #arararagargari etc. as in No. 849.

Page #274
851.1 III. 4 Malasutras 237 Begins.~~ ( com. ) fol. 14 ehanau artha e havau je zrIvIra varddhamAnasvAmi teha nai namuM namaskAra karUM kehavau chai zrIvIra saMsArarUpIyao je dAvAnala dAvAgni tehanA dAha bajhAivInai / nimitti nIra kahatA pANI tIyai samAna sariSao etc. Ends. -- ( text ) fol.rb bodhAgAdhaM etc. up to deva ( vi ! ) sAraM 4 as in No. 849. ,,--( com. ) fol. rh valI tAra kahatAM nirmala mo (mau) ktika tehanau je hAra mauktikalatA tiNai karI abhirAma manojJa chai valI vANI kahatAM bhagavaMtanI bhASA tehanau je saMdoha samUha tehija deha zarIra chai jehanao etalai virahA (hAM ) kita zrIharibhadrasUrikRta stutinI vyAkhyA pUrNa thaI // 4 // zrI

Page #275
238 Jaina Literature and Philosophy [853. vandanakasUtra Vandanakasutra (aquture ) ( Vandanayasutta ) 1220 ( 31 ). No. 853 1884-87. Extent.- fol. 1906. 1220 (1). Description.-- Complete. For other details see No. 1884-87. Author.- A Jaina saint. Subject.- Vandana to a holy preceptor. It is hence called Vandanakasutra. See Vandaruvstui (p. 63). This sutra is recited while performing dvAdazAvartavandana. Begins.-fol. 1906 og 11 CATHHUCOTT) sites frarong etc.. Ends.- fol. 1900 FT FARHAUNT (T) CEATA.FATA THETH Sportor STARIA 11 3 11 Reference.- Published. See any printed edition of the Pratikra manasutras. For one printed in Roman characters along with its translation in German see Ubersicht uber die Avasyaka-Literatur (pp. 7-8). Haribhadra Suri's commentary (p. 546-546b) to Avasyakasutra, Yogasastra (pp. 237-240 ), Acaradinakara (pp. 275-2774), Vandaruvstti (pp. 63-66 ) and Dharmasamgraha ( pp. 174-1806) may be consulted. For an extract see B. B. R. A. S. vols. III-IV, p. 399. vandanakasUtra Vandana kasutra 1270 ( 29 ). No. 854 1887-91. Extent.- fol. 66 to fol. 7*. Description.- Complete. For other details see No. 734. Begins.--fol. 66 pagifH (@AIFAUT etc. as No. 853. Ends.- fol. 7* AF WATATOTT etc. up to aferit ll ll as in No. 853. N. B.- For further particulars see No. 853.

Page #276
857. ] : III. 4 Malasatras 239 bandanakasUtra Vandapakasutra No. 855 1269 ( 22 ). 1887-91. Extent.- fol. 26. Description. Complete. For other details see Namaskaramantra No. 735 Begins.- fol. 26 GIA FATRAUTT etc. as in No. 853. Ends.- fol. 26 TRO (FA) FATFAUT etc. up to youtui alt TIPA II E II as in No. 853. N. B.- For additional information see No. 853. vandanakasUtra Vandanakasutra No. 856 1106 (24). 1891-95. Extent.- fol. 36 to fol. 4". Description.- Complete. For other details see Namaskaramantra No. 736. Begins. -- fol. 36 WTA HATHAUT etc. as in No. 853. Ends. fol. 4* T WATFAUT etc. up to 37cm STRANTIA as in No. 853 N. B.- For additional information see No. 853. vandanakasUtravivaraNa Vandanakasutravivarana 1293 (b). 1886-92. No. 857 Extent.- fol. 66 to rob Description.-- Complete. For vitti No. 847. details see Caityavandanasutra

Page #277
240 Jaina Literature and Philosophy vandanaka sUtravivaraNa No. 858 Author.-- Sritilaka Suri. Subject.-- Explanation of Vandanakasutra. Begins.--fol. 68 atha vaMdanakavivaraNaM / / iha ziSyo vidhivatpratilekhita mukha vastrikAtmadeho'dhijya ca pAvanatakAyaH // karadvayagRhItarajoharaNAdiravagrahAdvahi sthito vaMdanAyodyata evamAha || icchAmItyAdi // icchAmi abhilaSAmi etc. Ends.--fol. rob prAcUrNaka (:) atithiH tasyApi baMdanakaM dIyate ityarthaH / aSTAnavatimevaM yo dhyAyan sthAnazataM sadA datte vaMdanakaM sAdhuH zrAddho vA syAtsamiddhibhAkaH // cha // zrItilakAcAryaviracitA vaMdanakavRttiH // cha // bhadramastu // cha // (857. 1 Vandanakasutravivarana 200 (c ). 1873-74. Extent. fol. 13b to fol. 164. Description.- Complete. For other details see No. Begins. fol. 13b atha vaMdanakavivaraNaM etc. Ends. fol. 162 prAghUrNaka: atithi: etc. up to vaMdanakavRttiH as in No. 857. 200 (a) 1873-74.

Page #278
860.1 daivasikAlocanAsUtra [ devasiya AloyaNA ] No. 859 III. 4 Malasatras Extent. fol. 190b. Description. Complete. For other details see No. Author. A Jaina saint. Subject. 24t Daivasikalocanasutra [Devasiya aloyana] 1220 (32). 1884-87. daivasikAlocanAsUtra No. 860 1220 ( I ). 1884-87. Alocana in Prakrit. Hence this is named as Alocanasutra. See Vandaruvrtti (p. 2). Begins. - fol. 1905 icchAkAreNa saMdisaha bhagavanu devasiyaM Aloemi / icchaM jo me devasio / aha (A) ro kao / etc. Ends. fol. 190 bArassa ( sa ) vihassa sAvagadhammassa jaM khaMDiyaM jaM virAhiyaH tassa micchAmi dukkaDaM // cha // Reference. Published. See any printed edition of the Pratikramanasutras. Haribhadra Suri's commentary' (p. 778") to Avasyakasutra, Yogasastra (pp. 2442-2452) and Vandaruvrtti (p. 67) may be consulted. For an extract see B. B. R. A. S. vols. III-IV, p. 399. Daivasikalocanasutra 1106 (25). 1891-95. Extent. fol. 4a. Description. Complete. For other details see Namaskaramantra No. 736. Begins. fol. 4 fq etc. as in No. 859. Ends.fol. 44 (bArasavihassa sAvagadhammassa) jaM khaMDiyaM etc. up to tassa micchAmi dukkaDaM as in No. 859. N. B. For additional information see No. 859. I For comparison see pp. 571a and 571b where a sutra pertaining to Daiva. sika aticara is given. Acaradinakara (pp. 278a-279b), too, may be consulted. 31 [J. L. P.]

Page #279
242 Jaina Literature and Philosophy 1861. devasikAlocanAsUtra Daivasikalocanasutra No. 861 1:06 ( 26 ) 1891-95. Extent.- fol. 4a to fol. 46. Description.- Complete ; owing to a dittographical error, it seems, this sutra is repeated. For other details see No. 736. Begins.-fol. 4* TotERUT HICTE etc. as in No. 859. Ends.--fol. 4a CRTATEA etc. up to FA ETA #as in No. 859. N. B.- For additional particulars see No. 859. daivasikAlocanAsUtra Daivasikalocanasutra 1269 ( 23 ). No. 862 1887-91. Extent.- fol. 26. Description.- Complete. For other details see Namaskaramantra No. 735. Begins.-fol. 25 791#rfor etc. as in No. 859. Ends.-fol. 26 TTHEFA etc. up to for f gas as in No. 859. N. B.-- For additional information see No. 859. devasikAlocanAsUtra Daivasikalocanasutra No. 863 1270 ( 30 ). 1887-91. Extent.- fol. 7a to fol. 76. Description.- Complete. For other details see No. 734. Begins.--fol. 7' gateriur etc. as in No. 859. Ends.-fol.7deg bArasavihassa etc. up to micchA mi dukkaDaM // cha / as in No. 859. N. B.-- For additional information see No. 859.

Page #280
864. 1 vaivasikAlocanAsUtra No. 864 Extent. fol. 2b to fol. 32. Description. Only the opening portion is given. For other details see Namaskaramantra No. 735. III. 4 Malasatras 243 Daivasikalocanasutra 1269 (27) 1887-91. Begins and Ends. fol. 25 to 34 icchAmi paDikamiuM / jo me devasio aiyAro kao kAio ityAdi prAgvat // cha // N. B. For additional information see No. 859.

Page #281
244 Jaina Literature and Philosophy 1865. rAtrisaMstArakagAthA Ratrisarostarakagatha (rAisaMthAragagAhA) ( Raisantharagagaha ) 1174 (d). No.865 1887-91. Extent.-fol. 7b to fol. 84. Description.- Complete: a little bit of prose plus 20 verses in Prakrit. For other details see Sadavasyaksatra No. 730. Author.- Not mentioned. Subject.-- Holy reflections to be entertained before going to sleep at night. Begins.- fol. 7 zrI nisIhi nisIhi namo khamAsamaNANaM / goyamAINaM / mahAmuNINaM navakAra 3 karomi bhaMte 3 kahIyaha aNujANaha paramagurU (guruguNa)rayaNehiM bhUsiyasarIrA bahupaDipunnA porisa rAIsaMthArae ThAmi 1 etc. Ends.- fol. 8. sADU maMgalaM majju sAhUya majju devayA / sAhUe kittaettANaM / vosarAmi tti yAvagaM // 18 // khAmemi satvajIve / sabbe jIvA khamaMtu me mitI me sababhUesu / vera maje na keNaI // 19 // evamahaM AloI nidia garahia dugaMchiaM samma tivihiNa pddikkto| vaMdAmi jiNe cauvIsaM // 20 // iti raaiisNthaaraagaathaa|| Reference.- Cf. Santharaporisi published in several editions of Pancapratikramanasatras and the Mss. Nos. 033 (a and 2. 1895-98 246 (b) 1871-72" which are not available at present for description and which will be hence described later on.

Page #282
866.] rAtrisaMstArakagAMthA No. 866 III. 4 Malasatras 245 Ratrisamstarakagatha 1106 (52). 1891-95. Extent. fol. 15 to fol. 166. Description. Complete. For other details see No. 736. Begins. fol. 15 fif 2 am garzamnoi manigo for etc. as in No. 865. Ends. fol. 16b evamahaM etc. up to iti rAIsaMthAragAthA as in No. 865. This is the followed by samAptA. N. B. For further particulars see No. 865.

Page #283
246 gurukSAmaNAsUtra' [eryfeen] No. 867 Jaina Literature and Philosophy Extent. fol. 190. Description.-Complete. For other details see No. Author. A Jaina saint. Subject. Guruksmanasutra [Abbhutthio] 1867. 1220 (34). 1884-87. 1220 (1). 1884-87. gurukSAmaNAsUtra No. 868 This small work in Prakrit furnishes us with an exemplary illustration of vinaya on the part of a sisya. Begins.fol. 190deg icchAkAreNa saMdisaha bhagavanu abbhuTTio ahaM abhitaradevasiyaM khAmemi etc. Ends. fol. 190deg jaM kiMci majjha viNayaparihINaM / suhumaM vA bAyaraM vA / tumme jANaha ahaM na jANAmi tassa micchA mi dukaDaM // cha // vaMdanakasUtraM samAptaM / cha / Reference. Published. See any printed edition of the Pratikramanasutras. For the text, its chaya, Gujarati translation and the posture see my third Kiranavali (pp. 52-53). Haribhadra Suri's commentary (p. 792a) to Avasyakasutra, Yogasastra (pp. 245-246b), Acaradinakara (p. 286b), Vandaruvrtti (pp. 68-69 ) and Dharmasamgraha (pp. 1812-1822) may be consulted. For an extract see B. B. R. A. S. vols. III-IV, p. 399. This work is included in Sramanasutra, too. Guruksamanasutra 1270 (32). 1887-91. Extent.- fol. 7b. Description. Complete. For other details see No. 734. 1 The seribe has styled this as Vandanakasutra.

Page #284
870. ] I11. 4 Malasatras Begins.-fol. 76 56 (Freu etc. as in No. 867. Ends.--fol. 7deg file hey etc. up to TH ATT BA THITI as in No. 867. N. B.-- For additional information see No. 867. gurukSAmaNAsUtra Guruksamanasutra No. 869 1269 ( 25 ). 1887-91. Extent.-- fol. 26. Description.- Complete. For other details see Namaskaramantra No. 735, Begins.--fol. 26 gegranto High as in No. 867. Ends.--fol. 26 APR AE etc. up to fir PATETIJI as in No. 867. N. B.- For additional information see No. 867. gurukSAmaNAsUtra Guruksamanasutra No. 870 1106 (27). 1891-95. Extent.-- fol. 46. Description. - Complete. For other details see Namaskaramantra No. 736. Begins.- fol. 46 59891917 sfahr etc. as in No. 867. Ends.- fol. 4degja kiMci majjha etc. up to tassa micchA mi dukkaDaM 1 as in No. 867. N. B.--For further particulars see No. 867.

Page #285
248 sAmAyika sUtra [ karoma bhaMte ] No. 871 Jaina Literature and Philosophy [ 871. Samayikasutra [ Karemi bhante ] 1220 (39). 1884-87. Extent. fol. 191b to fol. 191b. Description. Complete. For other details see No. 1220 ( I ). 1884-87. Author. A Jaina saint. Subject. A Prakrit formula meant for a sravaka undertaking samayikavrata. Begins. fol. 1914 karemi bhaMte sAmAiyaM / sAvajjaM jogaM paccakkhAmi jAva niyamaM pajja (jju) vAsAmi duvihaM tiviheNaM / maNeNaM vAyAe kAraNaM na karemi / na kAravema / Ends. fol. 191 tassa bhaMte paDikkamAmi / niMdAmi garahAmi appANaM bosi rAmi // 1 Reference. Published. See any printed edition of the Pratikramanasutras or my fourth Kiranavali (p. 77) where its Sanskrit rendering and Gujarati translation are given. For the text in Roman characters and its German translation see ubersicht uber die Avasyka-Literatur (p. 6). The edition containing Haribhadra Suri's commentary (p. 778b) to Avasyakasutra, Malayagiri Suri's commentary to the same (p. 556) and Vandaruvrtti (p. 85) may be consulted. For an extract see B. B. R. A. S. vols. III-IV, p. 399. The edition styled as sAdhuprAtikramaNAdisUtrANi and publish - ed by the Secretary of Sri Atmananda Jaina Sabha in A. D. 1921 contains practically this Samayikasutra. See its page 12. Samayikasutra 1106 (28). 1891-95. sAmAyika sUtra No. 872 Extent. fol. 4. Description. Complete. For other details see Namaskaramantra No. 736.

Page #286
874) 111. 4 Makomanas Begins... foli 4 A HA FTAIFT HET HIER HIT You ett. as in No. 876 Ends. - fol. 4 h na etc. up to staarui alferrira as in No. 873. N. B.- For further particulars see No. 871. sAmAyikasUtra Samayikasutra No. 873 139 ( 20 ) 1887-91. Extent.-- fol. 26. Description.- Complete. For other details see Namaskaramotatet No. 871. Begins.-- fol. 26 for i etc. as in No. 876 Ends.- fol. 2 etc. tp to fit to #28 ix No. 87: N. B.- For additional information see No. 876. sAmAyikasUtra Samayikasutra No. 874 1106 ( 29 ). 1891-95. Exent. fol. 46. Description.- Complete ; here, too, it appears that there is a ditto graphical error as in the case of the Daivasikalocanasutra No. 861. For other details see No. 736. Begins.- fol. 4 etc. as in No. 871. Ends.-- fol. 4 At sit etc. up to sta as in No. 875. This is followed by R. N. B.- For additional informat 32 [ J.L.P.1

Page #287
20 Jaina Literature and Philosophy [875." jaya mahAyazaH. (jaya mahAyasa) _No. 875 Jaya mahayasah " (Jaya mahayasa) 1220 (41). 1884-87. No.875 Extent.-fol. 1916. Description.-- Complete so far as it goes. 1220 (I). For other details see .....No. 1884-87. . Author.-- A Jaina saint. Subject. - A verse in Prakrit eulogyzing the idol of Parsvanatha installed at Stambhanakapura. Begins and Ends:- fol. 191b jaya mahAyasa (jaya mahAyasa) jaya mahAbhAga / jaya ciMtiusahu phalai jaya samattha paramattha jANai / jaya jaya gurugarima guru / jaya duhatthasattAraNa) tANai / 'thaMbhaNayaTThiya pAsajiNa bhavI(vi)ya bhImabhavatthu bhayaava tANaMtaguNaM tujjha tti(ti)saM(jha) namaH (mo) tthu // 1 Reference. Published with Hindi translation in the Appendix (p. 8) to Paica pratikramana, a work published by Sri " : Atmananda-Jaina-pustaka-pracaraka-mandala, Agra, in .... A. D. 1923. jaya mahAyazaH Jaya mahayasah ................. ... .. 1106 (32) *No.876 No. 876 ... . . . 1891-95. Extent.-- fol. 5a. Description.-- Complete. For other details see Namaskaramantra : No. 736. Begins and Ends.-- fol............. ... jaya mahAyasa etc. up to tujjha tti saMjha namatthu as in No. 875. This is followed by 2. . N. B.-- For additional information see No. 875.

Page #288
877.] III.4. Malasatras 251 AcAdikSAmaNaka [Ayariya uvajjhAra] No. 877 Acaryadiksamanaka [ Ayariya uvajjbae.] 1220 (43) ..1884-87.1 Extent.- fol. 1920.. Description.- Complete ; 3 verses in all. For other details see Author.- A Jaina saint. Subject.- A metrical composition in Prakrit whereby an acarya, an upadhyaya, a pupil, a co-religionist and the entire sramanasangha are requested to forgive the individual who has unnecessarily offended any one of them. Begins.- fol. 192 Ayariya uvajjhAe sIse sAha( ha )mmie kulagaNe y|...! je me kiyA kasAyA savve tiviheNa khAmemi // 1 savvassa samaNasaMghassa / bhagavao aMjAja]liM kariya siise| savvaM khamAvaittA khamAmi samba(ssa) ahi(ha)yaM pi // 2.etc. I.: Ends:- fol. 192 sambasa(ssa) jIvarAsa(sissa / bhASao dhmmnihiyniycico| savvaM khamAvaittA khamAmi savvassa ahiraha)yaM pi // 3 ..... Reference.- Published. See any printed edition of the Prati kramanasutras. This work is quoted by Haribhadra Suri, in his commentary (p. 786deg and 786deg) on Avasyakasatra. In connection with this Ayariya uvajjhae, Sukhlal has made the following remark in his Hindi introduction (p. 45) to his edition of Panca pratikramana published by Sri Atmananda-Jaina-pustaka-pracaraka-mandala, Agra: "yadyapi Ayariya uvajjhAe, pukkharavaradIbar3e, siddhANaM buddhANaM ye maulika nahIM hai tathApi ve prAcIna haiM; kyoki una kA ullekha karake zrIharibhadra sUri ne svayaM una kI vyAkhyA kI hai|"

Page #289
252 No. 878 Begins. fol. 4a Extent.--fol. 4o. Description.-- Complete; 3 verses in all. For other details see Namaskaramantra No, 735, Ends.-- fol. 4a Jaina Literature and Philosophy en etc. as in No. 877. savvasta etc. up to ahi() yaM pi // 3 as in No. 877. N. B. For additional information see No. 877. AcAryAdikSAmanaka No. 879 Acaryadiksamanaka 1269 (29). 1887-91. Begins.-- fol. 5 Ends. fol. 5. [878. Extent. fol. 5. Description. Complete; 3 verses in all. For other details see Namaskaramantra No. 736. Acaryadiksamanaka 1106 (31). 1891-95. eufta ng etc. as in No. 877. wower ofteerer(for)e etc. up to off as in No. 877 N. B. For further particulars see No. 877.

Page #290
881.1 SriStambhanaka-Parsvanathastuti zrIstambhanakapArzvanAthastuti (sirithaMmaNathavA samAhathui ) (Siri Thambhanaya - Pasanahathui ) 1280 (44). No. 880 1884-87. No. - Extent. fol. 193*. Description. Complete 'so far as it goes. For other details see 1220 (1). 1884-87. I11. 4 Malasalras Author - A Jaina saint. -- Subject. A metrical composition in Prakrit in two verses praising the idol of Lord Parsvanatha installed at Stambhanakapura. Begins.- fol. 6a Ends. fol. 6a siri'thaM bhaNaya 'TTiya[sta ] / pAsasAmiNo sesatitthasAmINa (naM) / titthasamunnaya (i) kAraNa (NaM) surAsurANaM ca savvesiM // 1 Reference. 253 esamahaM saraNattha uu kAusaggaM karemi ( sattIe ) bhattI guNamuTThiyassa saMghassa samunnaya (i) nimittaM // 2 karemi kAussaggaM cha / pratikramaNasUtraM // 1923. Published with Hindi translation in the Appendix ( p. 11 ) to Panca pratikramana, a publication of Sri Atmananda-Jaina-pustaka-pracaraka-mandala, Agra in A. D. zrI stambhanaka pArzvanAthastuti No. 881 SriStambhanaka-Parsvanathastuti 1106 (41). 1891-95. Extent. fol. 64. Description.-- For other details see Namaskaramantra No. 736. I See p. 137.

Page #291
254 Jaina Literature and Philosophy [881. Begins.- fol. 62 faffsjaur legt HTAUTT etc. as in No. 880. Ends.--- fol. 62 GHAE etc. up to with #Ishim as in No. 880. This is followed by fa sftgeHOTELEI HATE IN N. B.-- For additional information see No. 880.

Page #292
883.] III. 4 Malasatras." 255 sAmAyikapauSadhapAraNagAthA' Samiyikapausadhaparanagatha (sAmAiyaposahapAraNagAhA) . (Samaiyaposabaparanagaha ) 1106 (40). No. 882 ___1891-95. Extent.- fol. so to 6+: Description.- Complete ; 5 verses in all. For other details see Namaskaramantra No. 736. Author.- A Jaina saint. Subject. A small metrical composition in Prakrit eulogyzing the saints and dealing with repentance. Begins.-- fol. sb ___ bhayavaM dasanabhaddo etc. Ends.- fol. 6. sAmAIposahasaMTriassa jIvassa jAi jo kAlo so saphalo bodhayo so so saMsAraphalaheU 55 iti sAmAikaposahapAraNagAthA Reference.- Published with Hindi translation on pp. 6 to 8 of the Appendix to Sukhlal's edition of Panca pratikramana. sAmAyikapauSadhapAraNagAthA No. 883 Samayikapausadbaparanagatha 1220 (40) 1884-87. Extent.- fol. 1916. Description.-Complete so far as the Ist 4 verses are concerned. For other details see No. 1. 1220 (I). 1884-87. I This is the 27th work noted on p. 134-the last work which constitutes Sadavasyakasatra No. 730.

Page #293
Jaina Literature and Philosophy [889. Begins. -- fol. 1916 mapaksasamako susaNo thUli(la)bhava vAya * saphalIkayagihacAyA sAhU evaMvihA huMti // 1 sADUNa baMdaNeNaM nAsaha pAvaM asaMkiyA bhASA phAyadANe nijara ubaggaho nANamAINaM // 3(12) (choumattho sahamaNo kittiyamita pi saMbharai jiivo| jaM ca na mamarAmi ahaM / micchA mi duvaMDaM tassa ( // 3 // ) jaMja maNeNa ciMtiyamasuhaM vAyAi bhAsiyaM kiNci|| asU(su)ha kAraNa kiyaM micchA mi[ha] dukkaDaM tassa / / 3 (14) . N.B. - For additional information see No. 882.

Page #294
885.1 praNipAtasUtra [ khamAsamaNasuta ] No. 884 III. 4 Malasaras Extent. fol. 189*. Description. Complete. For other details see No. Author. A Jaina saint. Subject. Begins and Ends.- fol. 189a Pranipatasutra [Khamasamanasutta] 37 This work styled also as Thobhavandanasutta and composed in Prakrit is included in the Caityavandanavidhi. It is a salutation to a guru: It does not occur in any of the Avasyakasutras. It is styled as laghuvandana by Anandasagara Suri (See Siddhacakra vol. III, Nos. 19 and 20, last page). praNipAtasUtra No. 885 Extent. fol. 3a. Description. Complete. Begins and Ends. fol. 3 1220 (7). 1884-87, 1220 (1). 1884-87. 33 [J. L. P.] // 50 // OM namo vItarAgAyaH / icchAmi khamAsamaNo baMdiuM jaavnnijjaae| nissIhiyAe matthe (tthae ) Na vaMdAmi Reference. Published in any printed edition of the Pratikramana sutras. For the text together with its chaya, Gujarati translation and the posture see my third Kiranavali (p. 51). For an extract see B. B. R. A. S. vols. III-IV, p. 398. Pranipatasutra 1270 (11). 1887-91. For other details see No. 734. icchAmi khamAsamaNe ( No ) etc. up to matthava ( ( ) nas in No. 884. N. B. For additional particulars see No. 884.

Page #295
258 Jaina Literature and Philosophy [ 886 No. 886 .... . 1202 (b.) 1887-91.. praNipAtasUtra Pranipatusutra Extent.-- fol. 8. Description.-- Complete. For other details see Paksikasutra . NO.1202 (a)..... . ..... 1887-91. Begins and Ends.-- fol. 8 icchAmi khamAsamaNo baMdiuM jAvaNa(Ni)jAe nisI - hiyAe matthaeNa vNdaami| N. B.- For further particulars see No. 884. 13 praNipAtasUtra Pranipatasutra. 1106 (10). . No. 887 1891-95. Extent.-- fol. 2b. Description. - Complete. For other details see Namaskaramantra ___No. 736. Begins and Ends-fol. 2 icchAmi khamAsamaNo etc. up to bNdaami| . . as in No 884. "N. B.- For additional information see No. 884.

Page #296
888.) III. 4 Malasutras 259 i tabba F urcargafestaTESTET . Bharatesvara-Bahubalisvadhyaya TECHN feS ("Bharabesara Bahuhalisajihava ) GUTTET TOT w ith Katbakosa and TabbA sahita No. 888 to 1307. ( 1886-92. Size.- 107 in. by s in. Extent.-- (text ) 816 folios ; 6 lines to a page ; 32 letters to a line. >> -(tabba), ,,,, >> >> >> ; 43>> >> >> >> Description.- Country paper tough and white ; Jaina Devanagari characters; this Ms. contains the text, its Sanskrit commentary and the interlinear tabba; big, legible and good hand-writing; borders ruled in three lines and edges in two, in red ink; foll, numbered in both the margins; fol. 1 and 816 practically blank; for, only the title etc. written on them; red chalk used; the first fol. slightly torn; condition on the whole good; the text, the commentary and the tabba complete ; very incorrect; the commentary composed in Samvat 1539 ; extent 25625 slokas. Age.- Samvat 1905. Author of the text.-- A Jaina saint. ,, ,,, com.- Subhasila, pupil of Munisundara Suri of the Tapa gaccha. He seems to be an author of several works such as Vikramacaritra (1490'), Punyadhananfpakatha ( 1496.), Prabhavakakatha (1504), Satrunjayakalpa and its commentary ( 1518'), Salivahananrpacarita (1540) etc. . .. onts i tabba: - Not mentioned. 268 This and the other years mentioned in this para belong to the Vikrama era, Por other works see No. 896 ,

Page #297
2,60 Jaina Literature and Philosophy 1.888. Subject. Eulogy of the male and female saints in 13 verses in Prakrit together with their explanations in Sanskrit' and Gujarati. The male saints here mentioned are as under : I (1) Bharatesvara alias Bharata, (2) Bahubalin, (3) Abhayakumara, (4) Dhandhanakumara, (5) Sriyaka, (6) Arnikaputra, (7) Atimukta, (8) Nagadatta, (9) Metarya, (10) Sthulabhadra, ( 11 ) Vajrarsi, (12) Nandisena, (13) Simhagiri, (14) Krtapunyaka, (15) Sukosala, (16) Pundarika, (17) Kesin, (18) Karakandu, (19) Halla, (20) Vihalla, (21) Sudarsana sresthin, (22) Sala, (23) Mahasala, (24) Salibhadra, (25) Bhadrabahusvamin, (26) Dasarnabhadra, (27) Prasannacandra, (28) Yasobhadra Suri, (29) Jambusvamin, (30) Vankacula, (31) Gajasukumala, (32) Avantisukumala, (33) Dhanyakumara, (34) Ilaciputra, (35) Cilatiputra, (36) Yugabahu muni, (37) Aryamahagiri, (38) Aryaraksita, (39) Aryasuhastin, (40) Udayana, (41) Manaka, (42) Kalika Suri, (43) Samba, (44) Pradyumna, (45) Muladeva, (46) Prabhavasvamin, (47) Visnukumara, (48) Ardrakumara, (49) Drdhapraharin, (50) Sreyamsa, (51) Kuragadu, (52) Sayyam. bhava and (53) Meghakumara. Out of these 53 male saints, those numbered as I, 2, 5, 6, 9, 10, 11, 14, 26, 27, 35, 37, 38, 39, 40, 49 and 50 are alluded to in the following gathas of Avasyakaniryukti : (a) 436, (b) 349, (c) 1248(?), (d) 1183, (e) 869-870, (f) 1284, (g) 736-739, (h) 846, (i) 846, (j) 1150, (k) 872-875, (1) 1283, (m) 775, (n) 1283, (o) 1185, (p) 952 and (q) 327. Saints numbered as 2 and 18 are referred to in Avasyakabhasya in gathas 32-35 (p. 153) and 205 (p. 716b) respectively. Saints numbered as 5, 6, 10, 13, 14, 19, 20, 22, 23, 26, 32 and 34 are referred to on the following pages of the edition containing Avasyakasutra, its niryukti and Haribhadra's Suri's commentary:: T ; I See No. 889 (description. '), p. 265.0 Wow

Page #298
888. ] III. 4 Malasatras 261 (a) 6936-6955, (b ) 6882-6892, (c) 6952-6982, (d) 293", (e ) 3536, (f-g): 679, (h-i) 2865, (j) 3599, (k) 6704-6700 and (1) 3596. Saints numbered as 7, 31, 43 and 44 are mentioned in * Antakrddasanga in the followiug places : (a) VI, 15, (b) III, 9 and (c-d) IV, 6-7. Saints numbered as 16 and 35 are referred to in Jnatadharmakathanga in chapters 19 and 18 respectively. Saints numbered as 17 and 18 are alluded to in Uttaradhyayanasutra in chapters 25 and 9 respectively. Saints numbered as 41 and 52 are mentioned in Dasavaikalikaniryukti in gatha 14, and the saint numbered as 48, in Sutrakstanga (II, 6). The names of the female saints referred to in the text are as under : (1) Sulasa, (2) Candanabala, (3) Manorama, (4) Madanarekha, (5) Damayanti, (6) Narmadasundari, (7) Sita, (8) Nanda, (9) Bhadra, (10) Subhadra, (11) Rajimati, ( 12 ) Rsidatta. (13) Padmavati, (14) Anjanasundari, (15) Sridevi, (16) Jyestha, (17) Sujyestha, ( 18 ) Mrgavati, (19) Prabhavati, ( 20 ) Cellana, ( 21 ) Brahmi, (22) Sundari, (23) Rukmini, ( 24 ) Revati, (25) Kunti, ( 26 ) Siva, (27) Jayanti, ( 28 ) Devaki, ( 29 ) Draupadi, ( 30 ) Dharini, (31) Kalavati, (32) Puspacala, ( 33 ) Padmavati, ( 34 ) Gauri, (35) Gandhari, ( 36 ) Laksmana, ( 37 ) Susima, ( 38 ) Jambuvati, (39) Satyabhama, ( 40 ) Rukmini, ( 41 ) Yakna, ( 42 ) Yaksadatta, ( 43 ) Bhuta, (44) Bhutadatta, (45) Sena, (46) Vena and ( 47 ) Rena. Out of these 47 female saints, those numbered as 2, 18 and 22 are mentioned in Avasyakaniryukti in the following gathas : (a-b) 520-521, and (c) 348 (p. 152a).

Page #299
262 Jaina Literature and Philosophy [888. Female saints numbered as 1, 13, 16, 17, 19, 20, 21, 26, 30, 32 and 41-47 are mentioned on the following pages of the edition of Avasyakasatra above referred to : (a) 6764-676deg, (b)7160-7173, (c) 676deg, (d) 6760-678', (e) 676', (1) 95deg and 6763-6785, (g) 153', (h) 676', (i) 223deg, (5) 6886-689deg and (k-1) 693". For female saints numbered as 10, 11, 18, 24, 25, 27, 29 and 33-40, the following works respectively may be consulted : (a) Dasavaikalikaniryukti v. 73-74, (b) Dasavaikalikavrtti by Haribhadra p.964-960, (c) Dasavaikalikaniryukti v. 76, (d) Bhagavati XV, (e) Jnatadharmakathanga XVI, ( ) Bhagavati XII, 2, (g) Jnatao XVI, and ( h-o ) Antakrd. dasa V. Begins.- (text) fol. 21 bharahesara bAhubalI abhayakumAro DhaMDhaNakumAro sirIyo aniAvuttau(tto) aI(i)matto nAgadatto a 1 ,,- (com.) fol. I OM zrI aha(ha)te namaH zrIsaMSezvarajI satya che yugAdau vyavahArAdhvA soM yena prakAsi(zitaH sa zrIvRSabhayogA(gI dau(dro) dadyAdvoya(? 'vya)yasaMpadaM 1 tyaktvA cakrizriyaM sayo lalo(lau) yaH saMyamaMzriyaM sa zrIzAMtijino bhUyAja(ja)nAnAM zivazampa(ma)Ne 2 je(ye)nAsau cAvatAreNa yadU(du)vaMsa(zaH) pavitritaH sa zrInemIjinAdhIso(zo) bhUyAda'vyayasaMpade 3 yasya nAmazrutervighne zreNiryAti kSayaM kSaNAt sa zrIpArzvaprabhU(bhu)rdadyAtkalyANaM kamalAsatAM 4 sevate aMkamiSAtsiMho yaM balena parAjitaH sa zrIvIravibhU(bhurvaryazriye bhUyAccharIriNaM(NAM) 5 mahAtmAnyAM(?nAM) mumukSUNAM satInAM ca suyoge(gi)nAM namonkIrtanamAtreNa zivazrIrjAyate nRNa(Na)6 'tapAgacchAdvi(?dhi)pA zrImanmunisuMdarasaMrayaH tacchiSya zubhazIlAbo bharatAdikathA vyadhAt . tathAhi etc.

Page #300
888.1 III. 4 Malasalras 263 Begins--(taboa) fol. 1 zrI arihaMtane namaskAra thAu zrIzaMSezvarajIneM namaskAra karUM yugarne Adi vyavahAramAraga saghalo jeNeM pragaTa kIdho te zrIRSabhadeva yogeMdra yo tumaneM akSaya saMpradA prate 1 cakravarttinI lakSmI chAMDIneM sIghra leto havo je saMyamazrI prata te zrIzAMtinAtha thAu lokaneM mokSanAM sukha bhaNI etc. Ends. - ( text ) fol. iccAi mahAsaio jayaMti akalaMkasIlakalilAo / avivajjai jAsaM jasapaDaho tihuyaNe sayale // 13 // ( com.) fol. 8144 tatazcyutvA bhavaM ( vAM) tare muktimapi gamiSyati tatastasyA zrImatyA sarve zrutvA (jA) tismRtirabhUta pazvAdbhavaM dRSTvA vizeSatastayA tapazcakre udyApanamapi kRtaM itI (ti) tapaH kRtvA zrImati devaloke gatAH tatazcyutvA rAjaputrI babhUva tata (to) vairAgyAtsaMyamaM prApya puNyapApaphalaM bhuktvA karmakSayAnmuktiM gatAH iti tapaviSaye zrImatIkathA samAptaH kAvya : zrI 'caMdra' gacchAMbarabhu (bhU/pako ( 'bhU) t 'tapA' gaNo bhAnuriveva (ddha) di (dI) tI / prabodhayan bhavyajanAMbujAnAM svagrete (go) bilAzai (sai) riva sAdhuvarge : 1 tatrAbhuvaJca guNagaNamaNI rohaNamahA ( hI ) dharaH pratimA paramaguru somasuMdara gu(ra) va [ra]: saMyamaramApatayaH 2 tacchiSyA munI suMdara guravo jayacaMdrasa (sU) rayo (S) bhu (bhU) van pAvaM (ra) gatAgamajalanidhApAraMgatA ruciraguNanI (ni) ca (la) yAH 3 (ta) cchiSyA vijayaMta (te) dadhataH zrI 'sarI' maMtra mahimabharata (m) zrIyuktaratne (tna)seSaragurava udayaMnaMdikharIvarAH 4 lakSmIsAgarasurIzA somadevAhvasUraya (:) vijayaMta (te) lasaDiyA vAddhimaMthana maMdi (da) ro (raH) 5 zrImansa (nIzamunI suMdararIrAjaH ziSyo manISizubhazIla iti pramukhya (:) etA (:) kathA vitanute sma navAMbareSu caMdra (1509) pramANasamaye kila vikramArkAva 6 I This verse is here reproduced from the printed edition as it has not been possible to trace it in the Ms. It must be however occurring just in the beginning of Silvatikatha. -

Page #301
264 Jaina Literature and Philosophy [888. bharahesarabAhUbalivRttIH subhasIlavibuddhacitteyaM / zodhyA suddhimadbhiH vibudhaiH kRtadApasarINa(? kuTApasAraNataH) 7 anAbhau (bho)gAdinA kiMcidyadevotsutraropaNaM cakre tadasti me mIthyA tamo(5)haMdAdisAkSIkaM 8 iti zrImat tapAgacchAdhirAjazrImunisuMdarasurIzISyapaMDitazubhazIlagaNIviracite bharahesarabAhUbalivivRttI nAnI kathAkoseM dvitIyo mahAsatyadhikAro samAptaH // yAdRzaM pustakaM etc. bhanapRSTI etc. jalA rakSe etc. This is followed by anet as under:jyahAM lage 'merU' aDaga he jyahAM lage zazI harasUra tyahAM lage A pothi sadA sadA rahe jo guNabharapUra 1 atita bhekha jaNameM base vace dije jIjIkAra huma tuma jesI prItaDI so jAnata he kiratAra 2 iti zrI saMpUrNa zlokasaMkhyA 25265 te TabArtha malI sudhAM saMvat 1905 nA varSe mAgasIramAse zuklapakSe tIthau 13 bhRguvAsare laSItaMga bhaTTArakazrIzrI1008 vijayasurendrasurIzvarajI tatpaTTe bhaTTArakazrIzrIvijayadhanezvara. sUrIzvarajI celA gulAbacaMdavAcanArthe zubhaM bhUyAt zrI zrI etc. Ends.- (tabba) fol. 815 surIpradhAna lakSmIsAgarasUrInA isa somadeva nAmeM sUrI vijayavaMtA havA vidyAiM sAvadhAna zrImata zrImUnInA Isa zrImunIsuMdarasUrIrAjanA siSya paMDIta subhasIla iti nAmamuSya tAie kathA prateM vistAratA havA saMvat 1508 nA varace graMthanI racanA thaI rAja thaki 6 bharesarabAhUbalInI TIkA subhasIla paMhiteM e racI bhalI buddhiiM e TIkA karI jANatAM thakAM ihAM kAMI 'dhIkuM uchU kAne mAtrai laSANu hoI te micchA mI dUkaDaM bharahe. sarabAhUbalInI vRttI TabArtha saMpUrNa e keNe bhareMsaravRti karI zrImunIsuMdarasUrInA sISya paMDIta zubhasIla paMDIte raci che zrI zrI zrI saMvat 1905 nA vara mAgasIramAseM zuklapakSe ekAdasI saumyavAsare 'muMbAInagareM e graMtha lakhyo che. Reference. The text is published in several editions of Prati kamanasatras. In Sukhlal's edition of Pancapratikramana, he has given in short, paricaya of all the saints (53+47) and in several places, he has mentioned the sources, too.

Page #302
8891 III. 4 Malasatras The text together with its Sanskrit commentary styled as Kathakosa is published in two parts as Nos. 77 and 87 respectively, in the Sheth D. L. J. P. F. Series, in A. D. 1932 and 1937 respectively. No. 889 bharatezvara bAhubalisvAdhyAya kathAkozasahita The second edition of a Gujarati translation of the Kathakosa is published by Maganlal Hathising, Ahmedabad, in A. D. 1902. For quotations see Peterson, Report IV, p. 110, and Mitra, Notices VIII, p. 163. For additional Mss. see B. B. R. A. S. vols. III-IV, P. 444. Age. 265 Bharatesvara-Bahubalisvadhyaya with Kathakosa 333. 1871-72. Size. 10 in. by 41 in. Extent. 249 folios; 13 lines to a page; 48 letters to a line. Description. Country paper tough and white; Jaina. Devanagari characters with occasional TS; small, legible and elegant hand-writing; borders ruled in two pairs of lines in black ink; red chalk used; white paste, too; fol. 1a blank; foll. 54-249 also numbered as 1, 2, etc. in the interlinear space; this Ms. contains the text as well as the commentary; both complete; in the latter we have kathas of Silavati, Nandayanti, Rohini, Ratisundari and Srimati, though these female saints are not mentioned in the text; these kathas commence after the completion of those of the crowned queens of Krsna; edges of the first and last foll. slightly worn out; condition on the whole good. Fairly old. 34 [J. L. P.]

Page #303
266 Jaina Literature and Philosophy ___(889. Begins- (text) fol. to bharaesara bAhubalI etc. as No. 888. , - (com.) fol. 1 60 // namaH) sarvajJAya // zrIzAradAyai namaH // yugAdI vyavahArA( dhvA ) savoM yena prakAzitaH / sa zrIvRSabhayomIMdro dadyAdvo(5)TayayasaMpadaM / 1 / tvaktvA cakrizriyaM sadyo lalo yaH saMyamAzrayaM / sa zrIzAMtijino bhUyAjjanAnAM zivazarmaNe // 2 // Ends.- (text) fol. incAi etc. '., - (com.) fol. 249- 'aduHkhadarzinIyA khyaM tapo yaH kurute tasya duHkhaM nAyAti tapAsvarUpaM proktavyamatra udyApane pAlakaM rUpyamayaM kaMcanaputrikApuraH sthale zarkarAdhyasthUlamodakarAzibhat tata etacchrutvA tayA tapaH kRtaM udyApanamapi kRtaM tayA dvijapanyA tasya tapasA(saH) prabhAvAnmRtvA(s)so zrImatI jAtA kramAnmuktimapi bhavAMtare gamiSyati tatastasyAH zrImatyA etatkRtvA jAtisma(smRotirabhUtpazcAdakaM dRSTA vizeSatastakA tapazcakre udyApanamapi kRtaM / iti tapaH tasminneva mace saMyama prANya karmakSayAnmuktiM gatA iti aduHkhadarzinItyaparAkhyAzrImatIkathA tapasi samAptA // cha / . . zrI'caMdragacchAMbarabhUSako(5)bhUta ___'tapAgaNo bhAnurivedIpti) . prabodhayan bhavyajanAMba(bu)jI(? jA)lI svagovilAsairiva sAdhuvagaiH1 tatrAbhU bha)tvA(ba)nvarayaNagaNamaNirohaNamahIdharapratimA paramagurusomasuMdaraNaru(ra)vaH saMyamaramApatayaH // 2 // tacchiSyA munisuMdaraguravo jayacaMdrasUrayo') bhUvana / pAra(3)gatAgamajalanidhipAraMgatA rucirgunnnilyaa:3| tacchiSyA vijayaMte dadhataH zrI mUri maMtramahimabharaM zrIyuktaratnazekharA(ra)gurava udayanaMdisarivasaH 4 / ___ lakSmIsAgarasUrIzAH somadevAhvasUrayaH vijayaMte lasadvidyAvArdhimaMthana maMdarA' 5 / zrImammunIzamunisuMdarasUrirAja- . ziSyo manISizubhazIla iti pramukhyaH .

Page #304
890.] III. 4 Malasutras . 26 enAM kathA vitanute sma navAMbareSu____ caMdra(1509)pramANasamaye kila vikramArkAt // 6 // bharahesarabAhubalIvRttiH zubhazIlavibudharaciteyaM / zodhyA sukhAddhimadbhirvibudhaiH kUTApasaraNataH // 7 // anAbhogAdinA kiMcidyadyatrotsUtraropaNaM / cakre tadastu me mithyA tamo(5)haMdAdisAkSikaM // 8 // iti zrImat tapAgacchAdhirAjazrImunisuMdaramariziSyapaDitazubhazIlagaNiviracite bharahesarabAhubalIvRttinAni kathAkoze dvitIyo mahAsatyadhikAraH // samApta // cha // saMpUrNa // cha. N. B.- For additional information see No. 888. bharatezvarabAhubalisvAdhyAya Bharatesvara-Bahubalisvadhyaya kathAkozasahita with Kathakosa 620. No. 890 1884-86. Size.- 9 in. by 44 in. Extent.-- 253 +2-1 =254 folios; 15 lines to a page ; 44 letters to a line. Description.- Country paper rough, brittle and grey; Jaina Deva nagari characters with occasional TATTIS; small, legible and good hand-writing ; borders ruled in three lines in red ink; red chalk and yellow pigment used; foll. numbered in both the margins; fol. 1* blank ; foll. 44 and 164 repeated ; fol. 101 appears to be missing but most probably foll. 102 etc. ought to have been numbered as 101, 102 etc. ; fol. 206th wrongly numbered as 205, since the following foll. are numbered as 207 etc., and there is continuity of matter this Ms. contains only the ist gatha of the text ; rest referred to by ityAdi 13; Kathakosa complete; a strip of paper pas ted to fol. 1*; condition very good Age.- Samvat 1661.

Page #305
268 Jaina Literature and Philosophy [f89d. Begins.-- (text) fol. rb TREET algasi etc. >> - (com. ) fol. 16 F: IsofETIT AA: 11 yitrai unertear etc. as in No. 888. 5 Ends.-- ( com. ) fol. 253 3: Bitui'ej etc. up to AETHET: FATA: as in No. 889. This is followed by a line as under : Ho ? AMTEULE 1 fil The II N. B.- For additional information see No. 888. 413. Hiasatangas Faretta Bharatesvara-Bahubalisvadhyaya: kathAkozasahita with Kathakosa No. 891 1879-80. Size.-- 104 in. by 43 in. Extent.-- 266 folios ; 15 lines to a page ; 41 letters to a line. ' Description.- Country paper thin and white; Jaina Devanagari * characters with occasional Centers; bold, big, legible and fair hand-writing ; borders ruled in two pairs of lines in black ink; red chalk used ; ist fol. slightly torn ; its edges worn out; a corner of fol. 13th damaged; edges of fol. 2666 slightly torn out; condition on the whole tolerably good; fol. ra blank; numbers for foll. entered twice as usual ; this Ms. contains only the first gatha of the text; the rest indicated by an 33 77:; marginal notes, added at times; Kathakosa complete. Begins. -- ( text ) fol. zb HEER algert etc. as in No. 888. >> -(com. ) fol. 10 TA: staigme I ll SAINETTA II zrIgurubhyo nmH|| this

Page #306
891.1 III. 4 Malasutras gital vyavahArAddha sarvo yena prakAzitaH / zrIvRSabhayogIMdro dayAho ( S) vyayasaMpadam // 1 // etc. C. Ends.-- ( com. ') fol. 2662 iti tapaH kRtvA tasminneva bhAvasaMyamaM prApya karmamuktiM gatA / iti aduHkhadarzinIparAkhyAzrImatIkathA tapasi samAptA // // 60 // zrI 'caMdra' gacchAMbarabhUSako ( 5 ) bhUt 'tapA'gaNI bhAnuviddhadIptiH / 269 prabodhayanbhavyajanAMbujAlIM svagovilAsairiva sAdhuvargeH / 1 tantrAbhUvamvaraguNagaNamaNirohaNa mahIdharapratimAH paramaguru somasuMdaraguravaH saMyamaramApatayaH / 1 tacchiSyA munisuMdaraguravo jayacaMdrasUrayo (S) bhUvan / pAragatAgamagatAgama ] jalanidhipAra (raM) gatA ruciraguNAnilayAH 3 tacchiSyA vijayaMte dadhataH zrI sUri' maMtramahimabharaM / zrIyuktaratna zekhara gurava udayamaMdisUrivarAH / 4 lakSmIsAgarasUrIzAH somadevAhnasUrayaH vijayaMte lasadviyAvArddhimaMthana' maMdarAH / 5 zrImanmunIzamunisuMdara sUrirAja ziSyo manISizubhazIla iti pramukha (khyaH) etAM kathAM vitanute sma navAMbareSu caMdra(1509)pra (mA)Nasamaye kila vikramAM (mArkAt / 6 / bharahisarabAhubalIvRttiH zubhazIlavibudharaciteyaM / zodhyA subuddhimadbhirvibudhaiH kra (ka ) TApasAraNataH 7 anAbhogAdinA kiMcidyadatrotsUtraropaNaM / ta(ca) kre tadastu me mithyA tamo (S) IdAdisAkSikaM // 8 // iti zrImata 'tapA' gacchAdhirAjazrImuni suMdarasUriziSyapaMDitazubhazIlagaNiviracite bharahasarabAhubalIvRttinAmni kathAkoze dvitIyo mahAsatyadhikAraH samAptaH // saMpUrNaH // // tatsamAptau samAptazvAyaM bharahesarabAhubalIvRttinAmA graMthaH lekhakavAcakazodhayitRvAcayitRzrotRRNAM ciraM vaM ( naM) datAdetad graMthapustakaM vAcyamAnaM // graMthAgraM 10000 // cha // zubhaM bhavatu // idaM pustakaM paripUrNa // cha // N. B. -- For additional information see No. 888...

Page #307
770 Jaina Literature and Philosophy 1892. bharatezvarabAhubalisvAdhyAya Bharatesvara-Bahubalisvadbyaya / kathAkozasahita with Kathakosa 308. No. 892 A. 1882-83. Size.- 9 in. by 44 in. Extent.-- 347+5=352 folios ; 13 lines to a page ; 35 letters to a line. Description.- Country paper rough, tough and white , Jaina Deva nagari characters; sufficiently big, legible and tolerably good hand-writing; borders ruled in two pairs of lines in black ink; red chalk used ; yellow pigment also ; foll. numbered in the right-hand margin only ; six foll. numbered as 172 the sixth 172a practically blank; only half a line is written on it ; fol. 1 blank ; edges of the first fol. slightly damaged; a careless attempt to separate the 68th and 69th foll. which must have stuck together owing to the presence of gum, has led to their tearing and thus damaging the Ms. ; similar is the case with foll. 121 and 122; condition on the whole good; the text complete so far as the ist verse is concerned ; fagetyr is complete; the narrative that follows viz. that of Srimati not complete; so Kathakosa thus ends abruptly, and that there is no colophon. Age.- Pretty old. Begins.- (text) fol. 1b PEET NIE&st etc. up to attento lle!!! , - (com.) fol. 1b Qall sfintiquat TH: 11 garat atret etc. as in No. 888. Ends. (com. ). fol. 347 tatastasyA zrImatyA etaskRpyA AtismRtirasUtpazrAdbhavaM dRSTravA vizeSatastayA tapazcakre / udyApanamapi kRtaM / iti tapaH katyA tasminneva bhave HUA gic * (This Ms. ends thus abruptly ). N. B.- For further particulars see No. 888.

Page #308
994.1 bharatezvara bAhubAle svAdhyAya kathAkAzasAta No. 893 Size. III. 4 Malasafras - rw Bharatesvara-Bahubalisvadhyaya with Kathakosa 94 in. by 4 in. Extent-288-3=285 folios; 15 lines to a page; 39 letters to a line. 271 Description.- Country paper thin and white; Jaina Devanagari characters with occasional TTS; big, legible and good hand-writing; borders ruled in four lines in black ink; red chalk used and yellow pigment, too; numbers for foll. entered twice as usual; fol. 1 blank; edges of the 1st and last foll. slightly damaged; this Ms. contains only the Ist gatha of the text, out of 13; foll. 179 to 181 lacking; fol. 100 numbered as 1001; foll. 162 to 193 worm-eaten; condition on the whole tolerably good; Kathakosa complete. Age. Not modern. Begins. (text) fol. rb E algae etc. as in No. 888. bharatezvara bAhubalisvAdhyAya kathAkozasahita 753. 1875-76. (com.) fol. 11 gar etc. as in No. 888. Ends.-- ( com. ) fol. 287 b iti tapaH kRtvA etc., up to maha( hAsa kiMkAra gur: as in No. 891. Then follows: zubhaM bhavatu // zrIrastu // N. B. For further particulars see No. 888. Bharatesvara-Bahubalisvadhyaya with Kathakosa 1306. 1886-92. No. 894 Size.-99 in. by 4 in. Exrent. 341 + + = 343 folios; 13 lines to a page; 32 letters to a line.

Page #309
Jaina Literature and Philosophy [ 894, Description. Country paper thin, rough and white; Devanagari characters with occasional gars; big, legible and tolerably good hand-writing; borders ruled in two pairs of lines in black ink; red chalk used; foll. mostly numbered in the right-hand margin only; fol. 203 repeated; so is the fol. 211; a piece of paper of the size of a fol. pasted to foll. ja and 341b; this Ms. does not seem to contain the complete text; only the Ist verse can be easily noticed; Kathakosa complete; some of the foll. slightly worm-eaten; condition good. Age.- Old. 272 Commentator. Subhasila, pupil of Munisundara Suri of the Tapa gaccha. He is an author of the works noted on p. 259. Furthermore, according to Jaina Granthavali etc, he has composed Pancastiprabodhasambandha, Danadikatha (1150 slokas in extent), Punyasarakatha (1311 verses), Silavatikatha (988 verses), Snatrapancasikakatha, Bhaktamaramahatmya, Unadinamamala and Pancavargasamgraha. For other details see No. 888. Kathakosa. Explanation in Sanskrit of Bharatesvara-Bahubalisvadhyaya along with about 100 narratives. These narratives depict lives of the male and female personages referred to in Bharatesvara-Bahubali-svadhaya and also those of 5 more. See p. 257. Begins. (text) fol. 1b wr bharasara bAhubalI etc. ( in the margin ) -- ( com. ) fol. rh namaH sarvajJAya / gar etc. as in No. 888. Ends.-- (com. ) fol. 340b 'aduHkhadarzinI' tyAkhyaM etc. up to dvitIyo mahAsatyadhikAra saMpUrNaH as in No. 889. N. B. For other details see No. 888. Others are probably not given. They seem to be alluded to, by the word 0 1 ityAdi. 2 See" upakrama (p. 6a) of the 2nd part of Sri Bharatesvara-Bahubalivrtti (D. L. J. P. F. Series, No. 87). a cand

Page #310
895.] III. 4 Malasatras 293 mahAvIrasvAmistuti Mahavirasvamistuti [snAtasyAstuti ] [ Snatasyastuti ) No. 895 1250 (29). 1884-87. Extent.- fol. ga to fol. 76. Description.- Complete. For other details see Adinathamaha. prabhavakastavana No.- 1250 (1). 1884-87.. Author.- Balacandra Suri, a pupil of Hemacandra Suri, the well known polygrapher. Subject. -- This metrical composition in Sanskrit is mostly recited on the 14th day of each fort-night by several Svetambara Jainas. The first verse deals with eulogy of Lord Mahavira, the 2nd with a panegyric of the Tirthamkaras, the 3rd with a stuti of holy scriptures and the 4th, with that of Sarvanubhuti yaksa. Begins.- fol. 7 snAtasyApratha(ti)masya 'merusi(zi)khare sa(za)cyA vibhoH zaizave rUpAlokanavismayAhRtaha(ra)sabhrAMtyA bhramaca(cakSuSA / unsRSTaM nayanaprabhAdhavalitaM kssiirodkaashNkyaa| vaktraM yasya punaH punaH sa jayati zrIvarddhamAno jinaH // 1 haMsAsAhatapadmareNukapizuzikSIrArNavAMbhobhRtaiH ___ kuMbhairapsarasAM payodharabharapraspaddhibhiH kAMcanaiH / yeSAM 'maMdara ratnazailazikhare janmAbhiSekaH kRtaH ___ sarvaiH sarvasurAsuresva(zva)rayu(ga)NaisteSAM nato(s)ha kramAtana) // 2 Ends.-- fol. 72 aIdvaktraprasUtaM gaNadhararacitaM / dvAdazAMgaM vizAlaM citraM bahvarthayuktaM / munigaNavRSabhairdhAritaM buddhimadbhiH mokSAnadvArabhUtaM vratacaraNaphalaM / jJeyabhAvapradIpaM / __bhaktyA nityaM prapadye zrutamahamakhilaM sarvalokaikasAraM / 3 niHppa(pokavyomanIladyutimalasadRzaM bAlacaMdrAbhadaMSTra -- mahamottaM ghNttaarvennu(nn)| prasRtamadajalaM pUrayaMtaM samaMtAta 1 This is the last work forming a part of Salavasyakasutra described as No. 731. 35 [J.LP.]

Page #311
Jaina Literature and Philosophy ArUDho divyanAgaM vicarati gagane kAmadaH kAmarUpI / yakSaH sarvvAnubhUtirdizatu mama sadA sarvakAryeSu siddhiM // 4 // aSTamIcaturdazIstuti ' // cha // Reference. - Published. See any printed edition of the Pratikramanasutras noted on p. 132 etc. See also p. 145 where all these four verses are given. 274 In Jaina-stotra-samgraha (pt. II, pp. 19-20 ), we have Sri-Vira-jinastuti which is a padapurti of the first carana of each of the four verses of this Mahavirasvamistuti. In the Limbdi Catalogue, a Sanskrit work in four verses by Balacandra is noted as No. 1550 and is styled as Paksikastuti. So one may naturally like to know if these two works are the same as the one described here; but no definite answer can be given at this stage. mahAvIrasvAmistuti No. 896 Extent. - fol. 404. Description. - Complete 4 verses in all. No. 735. Begins. - fol. 402 Mahavirasvamistuti 1269 (47). 1887-91. For other details see snAtasyApratimasya 'meru 'sa(zi) khare kSIrodakAzaMkayA [895. ( zacyA vibhoH zaizave ) rUpAlokanavismayAhRtarasabhrAMtyA bhramaccakSuSA / unsRSTaM nayanaprabhAdhavalitaM kSIrodakAzaMkayA / vaktraM yasya punaH punaH sa jayati zrIvarddhamAno jinaH / 9 // etc. 1 It is styled in the subsequent Ms. ( No. 896 ), as Mahavirastuti,

Page #312
896. ] Ends.- fol. 40" III. 4 Malasatras 275 niSpaMkavyomanIladyutimalasadRzaM bAlacaMdrAbhidaMSTraM / mattaM ghaMTAraveNa prasRtamadajalaM pUrayaMtaM samaMtAt / ArUDho divyanAgaM vya (vi) carati gagane kAmadaH kAmarUpI / yakSaH sarvAnubhUtirda (rdi) zatu mama sadA sarvakAryeSu siddhiM // 4 // iti mahAvIrastutiH / N. B. -- For additional information see No. 895.

Page #313
Jaina Literature and Philosophy (897. 296 namo'haMta' No. 897 Namo'rhat 1220 ( 28 ). 1884-87. Extent. -- fol. 1904. 1220 ( 1). Description.- Complete. For other details see No. 1884-87. Author.- Siddhasena Divakara (according to the Jaina tradition), author of Sammaspayarana etc. Subject.-- Salutation to the five paramesthins. Begins and Ends. - fol. 190FAT(S)Emeralafateuruhafargst: 1 Reference.-- Published. See any printed edition of the Prati kramanasutras. namo'rhata Namo'rbata No. 898 1270 (8). 1887-91. Extent.- fol. 26. Description.-- Complete. For other details see Namaskaramantra No. 734 Begins and Ends. -- fol. 26 FAT(s) arariteetAT9*(:) 1 N. B.-- For further particulars see No. 897. namo'rhata Namo'rhat 1269 (19) No. 899 1887-91. Extent.- fol. 22. Description.- Complete. For other details see Namaskaramantra No. 735. 1 This is same as the 8th work of Sacavasyakasutra described as No. 734.

Page #314
900. ] 111. 4. Malasatras, 277 Begins and Ends. fol. 22 TAT SEAT gratugrul Hafngra: 1 N. B.- For additional information see No. 897. namo'rhata Namo'rhat 1106 (7). No. 900 1891-95. Extent.- Complete. For other details see Namaskaramantra No. 736. Begins and Ends.- fol. 22 HAT(S)areaRITETITH AATExt: N. B.-- For additional particulars see No. 897.

Page #315
278 Jaina Literature and Philosophy 901. zrutasya bhgvtH| Srutasya bhagavatah (ETFE Haert ) ( Suyassa bhagavao ) No. 901 1269 ( 11 ). 1887-91. Extent.-- fol. 22. Description.- Complete. For other details see Namaskaramantra No. 735. Subject.-- A formula to be uttered when one is about to perform kayotsarga in connection with sruta. Begins and Ends.-- fol. 24 Wat TA TSFIT. Reference.- Published in any of the printed editions of Pancaprati kramanasutra. Also published in the edition (p. 788a ) of Avasyakasutra containing Haribhadra Suri's commentary. zrutasya bhagavataH Srutasya bhagavatah No. 902 1270 (19). 1887-91. Extent.-- fol. 46. Description.-- Complete. For other details see No. 734. Begins and Ends.-- fol. 46 UTFF Hai FRIA #17 #(F)SITI N. B.-- For further particulars see No. 901. zrutasya bhagavataH Srutasya bhagavatah No. 903 77( ). 1880-81. Extent.- leaf 1236. Description.-- Complete. For other details gee No. 77 (+).. 1880-81. Begins and Ends.-- leaf 1236 g (TDA TAHT ATA #ISFATT N. B.-- For additional information see No. 901. This is same as the 19th work of Salavasyakasutra described as No. 734.

Page #316
gos. 111. 4 Malasairas 279 zrutasya bhagavataH Srutasya Bhagavatah No. 904 1106 (18). 1891-95. Extent.-- fol. 3a to fol. 36. Description.- Complete. For other details see Namaskaramantra No. 736. Begins and Ends.-- fol. 38 to 3b Grka prasit *SITA #157* . N. B.- For additional information see No. 901. zrutasya bhagavataH Srutasya bhagavatah 1220 ( 21). 1884-87. No. 905 Extent.-- fol. 1902. Description. - Complete so far as it goes. For other details ser 1220 (1) No. 1884-87. Begins and Ends.-- fol. 1902 TFT Hotah #TA #137FROI N. B.-- For additional information see No. 901.

Page #317
280 vaiyAvRttyakarasUtra (veyAvaJcagarasutta) Jaina Literature and Philosophy No. 906 Extent. fol. 190a. Description.-- Complete. For other details see No. Author.- Not mentioned. [906 Vaiyavrttyakarasutra (Veyavaccagarasutta) 1220 (23). 1884-87. I 220 (1) 1884-87. Subject. Propitiation of a certain class of celestials whose activities are beneficial to the Jaina church. vaiyAvRttyaka rasUtra No. 907 Begins and Ends.-- fol. 1904 veyAvaccagarANaM saMtigarAgaM sammadiTTisamAhigarANaM karomi kAusa ( sa ) ggaM / / Reference. Published. See any printed edition of the Pratikramanasutras. Acaradinakara (p. 271) and Dharamasamgraha (p. 163) may be also consulted. Vandaruvrtti (p. 53) may be also referred to. In the introduction (p. 3*) to the edition containing Caityavandanasutra and Lalitavistara published in D. L. J. P. F. Series as No. 29, there is a remark as under- "ye vaiyAvRttyakarANAmityAdisUtraM devatAkAyotsargastatstutizva navyA ityAkhyAya tA apalapanti teSAM paramAbhinivezitaiva kevalA 31 Vaiyavrtyakarasutra 77 ( ). 1880-81. Extent. leaf 124. Description.-- Complete. For other details see Agamikavastuvi carasara No. 77 (1). 1880-81. Begins and Ends.-- leaf 124 4 beyAvaJcagarANaM saMtigarANaM sammadiTTisamAhigarANaM karomi kAussaggaM / N. B.--For further particulars see No. 906.

Page #318
910.) 111. 4 Malasatras 281 vaiyAvRttyakarasUtra Vaiyavrttyakarasutra No. 908 1269 ( 14 ). 1887-91. Extent.-- fol. 2a. Description.- Complete. For other details see Namaskaramantra No. 735. Begins and Ends.--fol. 20 veyAvaJcagarANaM etc. up to karomi kAussaggaM as in No. 906. N. B.-- For additional information see No. 906. vaiyAvRttyakarasUtra Vaiyavstyakarasutra No. 909 1106 (21). 1891--95. Extent.-- fol. 36. Description.-- Complete. For other details see Namaskaramantra No. 736. Begins and Ends.-- fol. 3deg veAvaJcagarANaM etc. up to karoma kAusa(ssoggaM as in No. 906. * N. B.-- For additional information see No. 906. vaiyAvRttyakarasUtra Vaiyavrtyakarasutra 1270 ( 22 ). No. 910 1887-91. Extent.- fol. s". Description.-- Complete. For other details see Namaskaramantra No. 734. Begins and Ends.-- fol. 5 veyAvaJcagarANaM etc. up to karomi kAussaggaM " as in No. 906. N. B.- For additional information see No. 906. 36 ( J. L. P.]

Page #319
282 sarvasyApisUtra ( savvassa vi sutta ) Jaina Literature and Philosophy sarvasyApisUtra No. 912 No. 911 Extent. fol. 190b. Description.--Complete. For other details see No. Author. A Jaina Saint. Subject. This small sutra in Prakrit deals with repentance concerning undesirable activities resorted to, during the day time. 1 [911. Sarvasyapisutra (Savvassa vi sutta) Begins and Ends. fol. 19ob savvassa vi devasiyaM duJcitiya dubbhAsiya ducci - yi icchAkAreNa saMdisaha / icchaM tassa micchA mi dukkaDaM // Reference. Published. See any printed edition of the Pratikramanasutras. For an extract see B. B. R. A. S. vols. III-IV, P. 399. The svopajna commentary on Yogasastra (pp. 245*245), Vandaruvrtti (p. 68) and Dharmasamgraha (p. 181a) may be consulted. No. 734. Begins and Ends. 1220 (33). 1884-87. dukkaDaM // cha // 1220 ( I ). 1884-87. Extent.- fol. 7b. Description. Complete. For other details see Namaskaramantra -N. B.- For further particulars see No. 911. Sarvasyapisutra 1270 (31). 1887-91. fol. 7 savvasa (ssa) vi etc. up to tassa micchA mi as in No. 911. 1 This is the 31st work which forms a part of Sadavasyakasutra described in No. 734.

Page #320
915. ] sarvasyApisUtra No. 913 sarvasyApisUtra No. 914 III. 4 Malasairas Extent. fol. 5a. Description.-- Complete. For other details see Namaskaramantra No. 736. Begins and Ends. - fol. 5 savvassa vi devasia etc. up to tassa micchA mi dukkaDaM as in No. 911. N. B. For additional information see No. 911. No. 735. Begins and Ends.- fol. 2b sarvasyApisUtra No. 915 283 Sarvasyapisutra 1106 (37). 1891-95. Extent. fol. 2b. Description. Complete. For other details see Namaskaramantra Sarvasyapisutra 1269 (24). 1887-91. N. B. For additional information see No. 911. savvassa vi etc. up to micchA mi dukkaDaM // cha // as in No. 911, 1 The word rAjJya is here substituted for devAsiya, Sarvasyapisutra 1106 (38). 1891-95. Extent. fol. 5a. Description. Complete. For other details see Namaskaramantra No. 736. Begins and Ends. fol. 5 savvassa vi 'rAIya duciMtiya dubbhAsiya da (du) - Tria icchAkAreNa saMdisaha icchaM tassa micchAmi dukkaDaM N. B. For additional information see No. 911.

Page #321
284 Jaina Lilerature and hilosophy [916. munivandanasUtra Munivandanasutra [aDDAijesusutta] [ Addhaijjesusutta ) No. 916 1270 (33). 1887-91. Extent.- fol. 76. Description.-- Incomplete. For other details see No. 734. Author.-. A Jaina Saint. Subject.-Salutation to the Jaina saints, no matter where they are found. The sutra given here occurs as a part of Sramanasatra. Begins and Ends.- fol. 7 aDrAije(je)sa / dIvasamuddesa / panara(sa) / kammabhUmIsa | jAvaMti ke vi sAhU / rayaharaNagucchapaDiggahadhArA paMcamahanvayadhArA / (sa)hasa(ssa)sIlaMgadhArA akhokho )vayA(yA)raca. This ends here thus. Reference.- Published. See any printed edition of the Pratikra manasutras and that of Sramanasutra ( p. 25b). zramaNopAsakaprati kramaNasUtra (samaNovAsagapaDi kamaNasutta') Sramanopasa kaprati kramanasutra ( Samaaovasagapa dikkamanasutta) 1220(42). 1884-87. No.917 Extent.- fol. 19rb to fol. 1920. Description.- Complete; so verses in all For other details see No. 1220 (1). 0.1884-87. Author.- A srutastharvira according to Ratnasekhara Suri. See his Arthadipika. I This is styled as Gthipratikramanasutra by Ratnasekhara Suri in his Arthadipika. 2 This is the name given in its Curni. Sec No. 924.

Page #322
917. ] 111. 4. Malasatras 285 Anandasagara Suri believes that this Vandittusutra is composed by one who has composed alapakas pertaining to the vows of a sravaka which are given in the Avasyaka sutra. See his prastavana (p. 1* ) of Arthadipika. Subject. This is a metrical composition in Prakrit in so verses. It is usually known as Vandittusutra. It mainly deals with partial transgressions on the part of a sravaka and his repentances for the same. It also refers to 15 karmadanas in verses 22-23, which are treated in Avasyakasutra on p. 829a. The partial trangressions pertaining to the vratas here referred to in verses 6, 10, 12, 14, 16, 18, 19, 21, 24-26, 27, 28, 29, 30 and 33 respectively are mentioned in Avasyakasutra on pp. 811', 8182 and 8185, 8205, 8229, 823a and 8235, 8256, 827deg, 8289, 8302, 8316, 834, 8356, 837o and 839a. Upasakadasangasutra, too, treats these topics (see the portion pertaining to the life of Ananda sravaka ). They are also treated in Tattvarthadhigamasutra in chapter VII in sutras 18, 20, 21, 22, 23, 24, 25, 30, 27, 28, 26, 29, 31 and 32. Pancasaka I. v. 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30 and 32 may be also consulted. The 48th gatha of Vandittusutra occurs as the 1271st gatha of Avasyakasutraniryukti, and its 49th and soth gathas are found in Sramanasutra. Begins.- fol. 1915 vaMditu savvAsiddhe / dhammAyagare ya savvasAhU yA icchAmi paDikamiUM(u)sAvayadhammAiyArassa [sAvagadhammAiyAramsa // 1 jo me vayAirassa(1) nANe taha daMsaNe caritte ya / UERTT ATT(TT) ar a fe TTEITA 112 etc. Ends.-- fol. 1926 khAmami sabve jIve(ve) savve jIvA khamaMta me| mittI me savvabhUesa gheraM majjha na kenni|| 49 This very verse with a variant it for an and the next with some variants occur in Avasyakasutra on p. 763a. The first verse may be compared with the following verse of Brhatpratikramana (a Digambara work) : "khAmemi savvajIve savve jIvA khamaMtu me| mattI me savabhUesu veraM majjhaM na kenni||"

Page #323
286 Jaina Literature and Philosophy gaardiga fifty arika gufsa (a+i) tivihe paDikkato vaMdAmi jiNe cauvIsaM // 50 I Reference. Published. See any printed edition of the Pratikramanasutra. Haribhadra Suri's commentary (p. 778b) to Avasyakasutra, Sraddhapratikramanasutra (D. L. J. P. F. Series, No. 48) and Vandaruvrtti (pp. 86-159) may be consulted. See also B. B. R. A. S. vols. III-IV, pp. 397 and 399. My article in Gujarati which is entitled as " samaNovAsagapaDikkamaNasutta yAne vaMdittasUtra " and which is published in Jaina satya prakasa (vol. III, No. 7, pp. 256-258) may be consulted. zramaNopAsakapratikramaNasUtra No. 918 917. aaa etc. as in No. 917. Ends.- fol. 4a Sramanopasakapratikramanasutra Extent. fol. 3a to fol. 4a. Description.-- Complete; 50 verses in all. For other details see Namaskaramantra No. 735. Begins.-- fo. 3a 1269 (28). 1887-91. evamahaM Aloya etc. up to jiNe cauvvIsaM // 50 // No. 917. This is followed by the line as under : iti zrAvakapratikramaNasUtraM samAptaM // cha // N. B.- For additional information see No. 917. as in I In Arthadipika (pp. 202b-203a), its author Ratnasekhara Suri refers to the opinion of some who do not losk upon this work as genuine and old, since there is no niryukti on it.

Page #324
920.] 11.4Malasatras 237 zramaNopAsaka SramanopasakapratikramaNasUtra pratikramanasutra 74 (i). No. 919 1880-81. Extent.-- leaf 1934 to leaf 1976. Description.- Complete ; the last verse numbered as 53. For further particulars see Upadesamala No. 74.28. Begins.-- leaf 1939 vaMdittu satvasiddha etc. Ends.- leaf 1970 ___ savvassa jIvarAsissa etc. up to savvassa ahiyaM pi' // 53 // as in No. 877. N. B.- For additional information see No. 917. zramaNopAsaka SramanopasakapratikramaNasUtra pratikramanasutra 771 ). . No. 920 1880-81. . Extent.- leaf 91a to leaf 966. Description.- Complete ; the last verse numbered as 53. For further details see Agamikavastuvicarasara No. 1880-81..! Begins.- leaf 918 ___vaMdittu samvasiddha etc. Ends.- leaf 96 sabassa jIvarAsissa bhAvaM uvaM me nihIya nishcito| savvaM khamAvaittA khamAmi sabassa tiviheNaM // 53 // ||ch|| N. B.- For additional information see No. 917. 1 This is the 3rd and the last verse of Acaryadiksamanaka. So it appears that the two preceding verses also must be belonging to the same work, and that through oversight, the scribe may have combined Vandittusutra ( verses 50 ) with this work. As the Ms. is not with me any more, I cannot say anything definitely. The same remark holds goods for No. 920.

Page #325
288 zramaNopAsakapratikramaNasUtra No. 921 Jaina Literature and Philosophy vaMde satvasiddhe etc. zramaNopAsakapratikramaNasUtra No. 922 Extent. fol. 14a to fol. 15b. Description.- Complete ; 50 verses in all. For other details see No. 736. Begins. fol. 14 2 Sramanopasakapratikramanasutra Ends.-- fol. 15b evamahaM Aloiya etc. up to zrAvakapratikramaNasUtraM samAptaM // N. B.-- For additional information see No. 917. [921. 1106 (55). 1891-95. Sramanopasakapratikramanasutra iMgAlI vaNasADI bhADI phoDI suvi ( ?va)jjae kama (mmaM ) / vANijaM (jjaM ) ceva daMtala (ka) kharasakesavisavisayaM / 22 // 1270 (34). 1887-91. Extent. fol. 1o to fol. Tob. Description. The work begins abruptly with a concluding portion of the 2oth verse, and it ends also abruptly with a por tion of the 38th verse. For other details see No. 734. Begins.-- fol. ro (a) in guNaore niMde | 20 // saJcitte paDibu(ba)ddhe / appaDa (po) laduppau (ppo ) la (li) yaM ca AhAre tucchosahibhakkhaNayA / paDikkame dekhiyaM savvaM / 21 / etc.

Page #326
923.] Ends- fol. 1ob sammAhaTTI jIvo jai vi hu pAvaM samAyare kiMci / appo si hoi bNdho| jeNa na niddhaMdhasaM kuNai // 36 // taM pi hu sapaDikamaNaM / sappariyAvaM sauttaragu[ru]NaM ca // vippaM uvasAmeha | vAhi vva susikkhio vijjo // / 38 / / jahA bisaM ku(TTagayaM). It ends thus. III. 4 Malasutras N. B. -- For additional information see No. 917. zramaNopAsaka pratikramaNasUtra No. 923 37 [J. L. P. Sramanopasakapratikramanasutra 1269 (18). 1887-91. 289 Extent. - fol. 24. Description.- jAvaMti ceiyAiM and jAvaMti (ta) ke vi sAhU are looked upon by the scribe as the 1st two verses. So it appears that these two verses along with the two following ones given here form a fragment of Vandittusutra. Out of these, the first two are already here assigned Nos. 760 and 764. respectively. So nothing can be done now at this stage. For other details see Namaskaramantra No. 735: Begins and Ends.- fol. 2a cirasaMciyapAvapaNAsaNiya bhavasaya sahassamahaNIe / caDavIsa jaNa viNaggayakahAu bolaMtu me dIhA // 3 // mama maMgalamarihaMtA / sa (si) ddhA sAhU suhaM ca dhammo ya / sammAhaTTI devA diMtu samAhiM ca bohiM ca // 4. N. B. - For additional information see No. 917.

Page #327
290 Jaina Literature and Philosophy [924. zramaNopAsaka Sramanopasaka. pratikramaNasUtra pratikramanasutra cUrNisahita with curni 1212. No. 924 1887-91. Size.-- II in. by 4g in. Extent.-- 83 folios ; 15 lines to a page ; 64 letters to a line. Description.-Country paper very thin and white; Devanagari characters with pRSThamAtrAs; small, legible and good handwriting ; borders ruled in three lines in red ink; yellow pigment used; foll. numbered in the right-hand margin only; fol. I blank ; edges of the first and last foll. slightly worn out; condition on the whole good ; the text and the commentary as well, complete ; extent 4590 slokas; the commentary composed in Samvat 1183, Age.- Samvat 1525. Author of the curni-Vijayasimha Suri, pupil of Santi muni. Subject. - The Vandittusutra along with a commentary mostly in Prakrit. The latter elucidates the former here styled as Samanovasaga padikkamanasutta (Sk. Sramanopasaka prati kramanasutra ). Begins.- (text) fol. 20 vaMdittu savvasiddha dhammAyarie ya savvasAhU ya / icchAmi paDikkAmauM sAvagadhammAiyArassa / / ___ Then runs the com. as under :-- baMditvetti yadi abhivAdanastutyoH vaMdaNaM pUyaNaM namasaNaM(ti)tti / pajjAyA taM caM dadhvao karacaraNAIhi muddAsannAso (1) bhAvao ya maNaso egattIkaraNaM (1) kriyAyAzca sAdhyaM kAha | savvasiddhe ityAdi gAthApUrvArddha yAvat atra sarvazabdo niHzeSArthaH // etc. --(com.) fol. I OM namo jinAya // siddhaM siddhatthasuyaM suyadhammapayAsayaM sayAloyaM / loyaNatullaM loyANa namaha sirimaM mahAvIraM // 1

Page #328
924. 1 III. 4 Malasutra's samaNovAsagapaDi (kka) maNasuttacuniM bhaNAmi leseNa / maMdamaINa vibohaNa heDaM suttANusAreNaM // 2 ma viva ( ? ) mao itthaM avarajjhai no na yAvi suyadappo / kougadhammajjhANaM muttuM nanno ihaM heU // 3 " tA uttamAvi nisuNaMtu kougA majjhimA vi bohAya / avasaddacchidavidavaNabhaiyA hutu nIyA vi // 4 Ends. -- ( text ) fol. 83 (jA?) ijammajarAmaraNanIraparipUriyaMmi bhIsaNavivAgamaNo vAyuvegucchalaMta - kohAvaikasAyavalayAmuhAipAyAla kalasa saMkkhubbhamANamajjhami vI paraMparAsaMghaDaNavihaDaNapaDimasaMjogaviogapauraMmi rAgaddosavikakhobhiyaMmi bahujaMtumagaramaccha kacchavAiMmi aidullaMghaNIya mohamahAvattaruddAma saMsAramahAsamumi / io tao ucchuduNa nibbuduNappAyaM bhavajjhamaNaM uccanIyA jAIsu kuNatehiM bhinnapoehiM va pANIhiM kahavi saMpunnapunnavasA pAvijjae bhavanIranAhatAraNarakasaM dhammajANavattaM ti / taM pi salilapavesaghAehiM aiyArehiM viNAsabhAvajjamANaM AballAiussivaNasameNa AvassaeNa daDhIbhavai / ao paidiyahaM sAhuNA sAvaeNaya sammatta mahanvayANuvvayAiyAraviso hikaraNanimittaM avassakaraNijvaMti AvassayaM / etc. evamAloie niMdiya garahiya duchiya (sammaM ) / tivihiNe paDikkato vaMdAmi jiNe cauvvIsaM // 50 // 291 - ( com. ) fol. 834 kayA savvajIvarAsikakhAmaNA saMpai paDikkramaNaM nima ( ? ) mile avasANamaMgalamAha || This is followed by the Joth verse noted above. Then we have : ( com. ) fol. 834 evamiti pratikramaNasUtrabhaNitaprakAreNa Alocya niMditvA garhitvA ku ( ja ) gupsitvA trividhena manovAkkAyalakSaNena pratikrAMtI nivRttaH / pratikrAMtavyAtizcAragozvarAditi // jattha // 'jo me devasiuM aiyAro kao kAito' iccAiNA daMDageNa AlokaUNa micchAdukkaDakaraNeNa AloyaNArihaM pacchittaM bhaNiyaM / duzcitiya dubbhAsiya / duciTTiyamevamAiyaM bahuso uvautto vi na yANai jaM devasiyAi airAI / savvesa vi bIyapae daMsaNanANazcaraNAvarAhesu / uvauttassa visohIjaiNo AloyaNA bhaNiyA // niMdA pacchAyAvaruvA / garihA gurusamakkhaM saduvvariyAe / AloyaNA / tatazva / ' taM niMde taM ca garihAmi' / iti vacanoccAraNena niMditvA garhitvA ca kiM bahunA pratikramaNasarvasvamAha / tiviheNa paDikkato / jaM kiMci kayamattaM sahasA pamAyamAIhiM // maNaSAyAkAhiM / tasmA (? mmA) haM naNu paDikkato //

Page #329
292 Jaina Literature and Philosophy [924 . uttarottaradharmavRddhyarthe maMgalamAha / / baMdAmi jiNe cuvviisN|| siririsahanAhapaDhamaM namAmi sirivaddhamANapajjate / cauvIsaM titthayare diMtu sivaM maMgalaM aMte / evaM sammattA pddikkmnnsuttvuttii(?cunnii)| cha / / -: namo suyadevayAe bhagavaIe // jayai jiNasAsaNamiNaM / jami nilINo suheNe(Na) bhaviyajaNA / laMghati bhavaM bhImaM // jANeNa va jattiyA jalahI / jayai iha 'caMda'gaccho caMdo iva bhatriyakumuyabohayaro / / uvasamajuNDaputro samaNajaNArNadaNo sayalo // osiyasIlapaDAgo tvniymrhNgsNgysughoso|| guNagaruo gaccharaho dhavalahiva jehiM ujjU(?)Dho / sirisavvaeva sirinemicaMdanAmadheyA muNIsarA guNiNo / hutthA tatthaM pasatthA tesiM sIsA mhaaminno|| je pasamassa nidasaNamudahI dAmvannavArivArassa / / kanvarayaNANarohaNI khANI khamiNo amiyavANI / sirimaM saMtimuNiMde tesiM sIseNa maMdamaiNA vi / / AyariyavijayasIheNa viraiyA esa cunni tti / / jakipi mae usmuttamiccharayaM maIe doccalA // taM me khamaMtu sohaMtu suyaharA guggahaM kAlaM // egArasahiM saehiM tesIiahiehiM (1983) vikkamanivAo / / samaicchiehi citte mAsaMmi samatthiyA esA || cha / sAvagapaDikkamaNasuttacunnI [sasamattA // cha // grNthaan| zlokasaMkhyA // 4590 // // cha // saM0 1525 varSe phAlguNasadi 13 zukre laSitaM padamAkena / ch| zubhaM bhavatu // cha / ence.-This carni is referred to, on p. 203* of the edition containing Sraddhapratik ramanasutra and Arthadipika published in D. L. J. P. F. Series as No. 46. The pertinent line is as under:___ "zrAddhapratikramaNasUtrasya ca vikrama 1983 varSe zrIvijayasiMhasUri-zrIjinadevamUrikRte cUrNibhASye api staH ." It seems that this very curni is referred to, in the line " zrAvakapratikramaNasUtracUrNAvapyuktam" occurring on p. 163deg of this edition.

Page #330
925.] 111. 4 Malasatras 293 with curni 199. zramaNopAsaka Sramanopasa kapratikramaNasUtra pratikramanasutra cUrNisahita No. 925 1873-74. Size.- 134 in. by sfin. Extent.-- 44 folios ; 22 lines to a page ; 84 letters to a line. Description.- Country paper thin, rough, brittle and greyish; Devanagari characters with TAISTS; very small, quite legible, uniform and good hand-writing ; borders ruled in four lines in black ink ; red chalk used; yellow pigment, too; foll. numbered in the right-hand margin only; fol. 1a blank; edges of some of the foll. slightly worn out ; condition tolerably good ; both the text and the commentary complete ; extent 4590 slokas. Age.- Pretty old. Begins.- ( text ) fol. 2a sorang wartet etc. as in No. 924. >> (com.) ,, 10 11 gol F frar II ra fagrous etc. as in No. 924. Ends. (text) fol. 446 edhamAloIya etc. up to cauvvIsaM as in No. 924. .- (com.) fol. 446 watte etc. up to juti sqlser 8490 as in No. 924. N. B.- For further particulars see No. 924.

Page #331
194 zramaNopAsakapratikramaNasUtra arthadIpikAsahita Jaina Literaturite and Philosophy [ 926. Sramanopasakapratikramanasutra with Arathadipika No. 926 1213 1887-91. Size.-- 104 in. by 48 in. Extent.-- 244 folios ; II lines to a page ; 42 letters to a line. Description.--- Country paper thin, rough and white; Jaina Deva nagari characters with FRETS ; big, legible and good hand-writing ; borders ruled in four lines in black ink ; red chalk rarely used; yellow pigment rather profusely ; foll. numbered in both the margins ; foll. ra and 244" practically blank, except that the title etc., written thereon ; edges of the first fol. and those of the last slightly worn out; condition on the whole good; both the text and the commentary complete ; the latter composed in Samvat 1496; its extent 6644 slokas. Age.-- Pretty old. Author of the commentary.- Ratnasekhara Suri, pupil of Bhuvana sundara Suri, pupil of Somasundara Suri. He should not be confounded with the author of Sirisirivalakaha. Our Ratnasekhara Suri is an author of Sraddhavidhiprakaranavstti, Arthakaumudi and Vidhikaumudi referred to, on pp. 5o, 1885 and 2039 of the edition containing Arthadipika. Subject.-- A religious sutra pertaining to the pratikramanakriya of sravakas along with its explanation (vstti)' in Sanskrit. This explanation is called Arathadipika. Therein the text is styled as Gthipratikramanasutra, in the beginning and as Pratikramanasutra, Sravakapratikramanasutra and Sraddhapratikramanasutra in the end. 1 This is styled as tika, too.

Page #332
926.] ...III. 4 Malasalras... 395 Begins. -- (text) fol. 36 ___vaMdittu sabbasiddhe etc. as in No..917... "- (com.) ,, Ib jayati satatodayazrIH etc. as in No. 928. Ends.- (text) fol. 2426 evamahaM AloIe etc. as in No. 918. , - (com.) ,, ,, evamAlocya niMditvA garhitvA jugupsitaM duzcikitsitaM vA avinArajAtaM samyaka trividhena manovAkkAyalakSaNena pratikrAMtaH kRtapratikramaNazvaturviMzatiM jinI( nA )n vaMde iti prAMtagAthArthaH 50 / ___ atrAha paraH idaM pratikramaNasUtraM kena kRtaM ucyate yathA'parapratikramaNa sUtrANi zrutasthavirakRtAni tathaitadapi yaduktamAvazyakabRhadvRttI 'akkharasannI 'ti gAthA( vyAkhyAne aMgapraviSTaM gaNadharakRtamAcArAMgAMdi anaMta(ga)praviSTaM tu sthavirakRtamAvazyakAdIni atha zrAvakapatikramaNasUtrasya yadyApatvaM tadA kiM na tasya niyu(yu)ktibhASyAdIti cet tarhi Avazyaka-dazavaikAlikAdidazazAstrIvyatiro(re )keNa zeSANAM niyuktayabhAvAdIpapAtikAya( grupAM)gAnAM ca cUrNerapyabhAvAdanApatvaprasaMgastasmAnna kiMcidetata / zrAddhapratikramaNasUtrasya ca vikrama 1183 vArSaH(rSe) zrIvijayasiMhasUrizrIjinadevasUrikRte cUrNi-bhASye api sto vRttayazca bahavyaH ataH zrutasthavirakRtatvena sarvAtIcArAvizodhakatvena ca zrAvakairetadupAdeyameva sAdhubhiH svapratikramaNasUtrAmiSa evaM sati ye svakadAgrahamAtrAbhiniviSTadRSTayaH pAzcAtyena kenaciskRtaM sarvathA'nupAdeyamidamiti Dhavate na vidmasteSAM kA gatiH sarvajapraNItaprAcInasthavirAcaritasamyagamArgasyopamardanAt tadbha( dU)bo(ce) ranno ANAbhaMge ikka(kkucia mi(ni)ggaho havai lora sambanA(mA)NAbhAM(bha)ge aNaMtaso niggahaM lhr| nanu zrAvakasya pratikramaNakara(Na )mevA'saMgata dUre(S)stu pratikramaNasUtravicAraH tadapi pralApamAnaM siddhAMte zrAddhAnAmanekA tasyoktavAdyadanuyogadvArasUtraM " se kiM taM louttariDaM bhAvAvassayaM jana samaNo vA samaNI gA sAvao vA sAdhiA thA tazcitte / jAva ubhao kAlaM AvasmayaM karei ti" tathA tatraiva " 'samaNeNa sAvaeNa ya avassavA(? kA )yavvaM havai jamhA aMto ahonisassA tamhA AvassayaM nAma / 1 / 1 See p. 30a of Anuogaddara ( Samiti edn.)." 2 Jbid., p. 3ra..

Page #333
296 Jaina Literature and Philosophy [926. mavAMgavRttikadabhayadevasUri - kalikAla sarvajJa zrIhe masUripramukha pUrvAcAryaraciteSu paMcAzakavRtti yogazAstrapravRttigraMtheSu na zrAddhAnAM pratikramaNaM sAkSAdbhuktaM sarvaprasiddhameva tacca paMcabhedaM devasikaM 1 rAtrikaM 2 pAkSikaM 3 cAturmAsikaM 4 sAMvatsarikaM 5 ceti eSAM kAlAvadhyAdi mankRtavidhi - kaumudyA avadhA vikhyAta 'tape tyAkhyA jagati jagaccaMdrasUrayo'bhUvan // zrIdevasuMdaragurUttamAzca tadanu kramAdviditAH // 1 // paMca ca teSAM ziSyAsteSvAyA jJAnasAgarA guravaH vividhAvacUrNilahariprakaTanataH sAnvayAhvAnAH // 2 // zrutagatavividhAlApakasamuddhRtaH samabhavaMzva sUrIMdrAH // kulamaMDanA dvitIyA zrIguNaratnAH tRtIyA // 3 // SaT (i) darzanavRttikriyAratnasamuccayavicAranicayasRjaH // zrIbhuvanasuMdarAdiSu bheje vidyAgurutvaM ye // 4 // zrI somasuMdaragurupravarAsturyA ahAryamahimAnaH // yebhyaH saMtatiruccairbhavati dvedhA sudharmmabhyaH // 5 // tijItakalpa (vi) ( ta )zva paMcamAH sAdhuratnasUrivarAH // yairmAdRzo'pyaSyata karaprayogeNa bhavakUpAt // 6 // zrIdevasuMdaraguroH paTTe zrI somasuMdaragaNeMdrAH / yugavaravadvijayaMte teSAM ziSyAzca paMcaite // 7 // mAtyavamanirI ( rA ) kRti sahasranAmasmRtipravRttikRtyaiH // zrI munisuMdaraguravazciraMtanAcAryamAhima (bhU )taH // 8 // zrIjayacaMdramunIMdra (drA ) nistaMdrAH saMghagacchakAryeSu // zrI bhuvanasuMdara vija ( varA ) dUravihArairgaNopakRtaH // 9 // ekAMgo (gA) apyekAdazAMginazva jinasuMdarAcAryAH // nirgrathA graMthakRtaH zrImajinakIrttiguravazva // 10 // eSAM zrIgurUNAM prasAdato'bde SaDaMkavizva 14 ( 9 ) 6 mite // zrIratnazeSa (kha) ragaNivRttimimAmakRta kRtituSTayai // 11 // caturvidyodadhibhirdadhizuddhaparamaparabhAgaM / / sA ( S) zodhyata prayatnA (l ) lakSmIbhadrAhvavibudheMdraH // 12 // Si( bi ) jJAvataMsavihitaprazaMsagaNi satyahaM savibudhAyaiH // su(B) rubhaktyA'syAH prathamAdarza sAnnidhyamAdhAyi // 13 // etasyAM TIkAyAmanuSTubhAmarthadIpikAnAmyAM // SaTSaSTizatIcatvAriMzaccatu (ru) sarA'numitA // 14 // varacUrNivividhaTTasyAdyamusRtya kRteyamalpamatinA (s ) pi // utsUtramantra vibudhaiH zodhyaM jIyAdiyaM ca ciraM // 15 //

Page #334
927.) III. 4 Malasutras 297 iti zrI tapA'zrI(zrA)ddhapratikramaNasUtravRttau zeSAdhikAraH paMcamaH cha graM0 411 samApta(tA) ceyamarthadIpikAnAmnI zrAvakapratikramaNa sUtraTIkA cha sarvAgraM0 6644 // // Reference. - Both the text and Arthadipika are published in A. D. 1919 in D. L. J. P. F. Series as No. 48. In this edition we have Sanskrit introduction, a table of contents, an alphabetical index of quotations, and that of proper names, maxims etc., and laukika nyayas. For Mss. containing the text and Arthadipika see Limbdi Catalogue No. 2612. zramaNopAsaka SramanopasakapratikramaNasUtra pratikramanasutra arthadIpikAsahita with Arthadipika 817. No. 927 1895-1902. Size.- 10 in. by 4g in. Extent.- 174 folios ; 15 lines to a page ; 40 letters to a line. Description.- Country paper rough, thin and white; Devanagari characters, big, clear and good hand-writing ; borders ruled in two lines and edges in one, in red ink ; yellow pigment profusely used; foll. numbered in the right-hand margin only ; fol. 1* blank; a strip of paper pasted to fol. 1a; edges of the first and last foll. slightly worn out; condition on the whole good; both the text and the commentary complete ; the extent of the latter 6644 slokas Age.- Not modern. Begins -(text) fol. 3a slegt Fare TIC OAS etc., as in No. 91%. ,, -(com.) fol. Ib sty Fat AA: 11 Fyfa Fatayat: etc., as in No. 930. 38 (J. L. P.)

Page #335
298 Jaina Literature and Philosophy [ 927. Ends -(text) fol. 1736 STAF SIMIT etc., as in No. 917. , -com.) fol. 173. Taarisy partrar fram etc., up to starred Trai as in No. 926. This is followed by the lines as under :iti zrI'tapAgacchazrAddhapratikramaNasUtrattau zeSAdhikAraH paMcamaH samAptA ceyamarthadIpikA naamniiH|| zrAvakapratikramaNasUtraTIkA samAptAH graMthAya 6988 Il fill 11 N. B.- For further particulars see No. 926. zramaNopAsaka SramanopasakapratikramaNasUtra pratikramanasutra arthadIpikAsahita with Arthadipika 767. No. 928 1899-1915. Size.- 99 in. by 4} in. Extent.-- 217-8=209 folios ; 13 lines to a page ; 38 letters to a line. Description. - Country paper rough and white; Devanagari characters with gears; small, legible, uniform and good hand-writing ; borders ruled in four lines in red ink ; red chalk used; foll. numbered in the right-hand margin only; unnumbered sides have a small disc in red colour, in the centre only; the numbered, in the margins, too; fol. ra decorated with a design in various colours ; foll. 40 to 47 missing; otherwise both the text and the commentary complete ; foll. 123 to 136, 147 to 179. etc. slightly wormeaten ; condition tolerably good ; extent of the commen tary 6644 slokas. Age.-- Samvat 1697. Begins.- (text) fol. 36 afat FENTE Artfog etc., as in No. 917.

Page #336
929.1 .4Malasatras (299 299 Begins.-- (com.) fol. !' jayati satatodayazrIH etc., as in No. 930. .. Ends.- (text) fol. 2176 __ evamahaM Aloia etc., as in No. 927. ,, -- (com.) fol. 217deg evamAlocya niMditvA garhitvA etc., up to samAptA / ceyamarthadIpikAnAmnI shraavkprtikrmnnsuutrttiikaa|| cha / gaMthAnaM 6644 as in No. 926. This is followed by the lines as under :-- yAvad vyomasaraHkroDarAjahaMsa virAjate / vibudhairvAcyamAnApi tAvannaMdatu pustikA // 1 // cha / saMvat 1697 varSe caitramAse zuklapakSe tritIyA ravivAre zrAddhapratikramaNasUtravRtti(:) samAptA // yAdRzaM pustakaM etc. N. B.- For additional information see.No. 926. zramaNopAsakapratikramaNasUtra arthadIpikAsahita Sramaaopasakapratikramanasutra with Arthadipika 679. No. 929 1892-95. Size.-- 102 in. by 43 in. Extent.-- 194-1 = 193 folios ; 12 lines to a page ; 35 letters to a line. Description.--Country paper rough, thin and white; Devanagari characters with pRSThamAtrAs; big, clear and tolerably good handwriting ; borders ruled in four lines in black ink ; this Ms. contains the text as well as its commentary; foll. numbered in the right-hand margin only; edges of the first fol. slightly worn out; a portion of the second fol. gone%3; fol. 159 to 168 have only the left-hand corner worn out, whereas fol. 169 to 194, the right-hand one as well; condition unsatisfactory; fol. 166th missing; both the text and the

Page #337
300 Jaina. Literature.and Philosophy [929. commentary incomplete; this Ms. contains 49 complete gathas of the text and soth partly and the commentary pratically up to that of 49th gatha; red chalk used; fol. I' blank. Age.-- Old. Begins.-- (text) fol. 3* vaMdittu savvasiddha etc. as in No. 924. ,, - (com.) ,, jayati satatodayazrIH etc. as in No. 930. Ends.-- (text) fol. 194 khAmami savvajIve haM savve jIvA khamaMtu me| mittI me savvabhUesu bera majjha na keNai // 49 / / (evamahaM) Aloia naMdiagarahia. This Ms. ends thus abruptly. ,-(com.) fol. 194deg uktaM hi jJAnAMkuze maniMdayA yadi janaH paritopameti nanvaprayAsatito(? sulabhoDa)yamanugraho me| zreyorthinA(no) hi puruSAH paratuSTiheto-- duHkha (khA)jitAnyapi dhanAni parityajati // 1 // etc. evamanena prakAreNA'haM samyagAlocya ' This ends thus abruptly. N. B.-- For Mss. of the text see Limbdi Catalogue Nos 2617 2620. For additional information see No. 926. zramaNopAsakapratikramaNasUtra arthadIpikAsahita Sramanopasakapratikramanasutra with Arthadipika No.930 1307. 1891-95. Size.-- 102 in. by 48 in. ! See p. 2020 of the printed edition.

Page #338
930. ] III. 4 Malasutras Extent.-- 92 folios; rs lines to a page; 58 letters to a line.. Description.-- Country paper thin, rough and grey, Devanagari characters with garars; neither too big nor too small, bold, clear and good hand - writing ; borders rather carelessly ruled in two pairs of lines; the space between these pairs coloured red; preceding the first fol. there is a blank fol. ; therein only the title of the Ms. is written ; so is the case with fol. 92b ; fol. ra blank ; unnumbered sides decorated with a small circular disc in red colour in the centre ; the numbered, with two more, one in each of the two margins ; red chalk used; incomplete ; for, it contains 27 gathas of the text and a commentatry of 26 gathas completely and that of a part of the 27th; condition very good. Age.-- Pretty old. Begins.-- ( text) fol. 2b vaMditta savvAsaddhe dhammAyarie a savvasAhU a / icchAmi paDikamiuM sAvagadhammAiArassa || 1 | etc. ,,, --( com. ) fol. r // 60 // 33 jayati satatodayazrIH zrIvIrajinezvaro'bhinava bhAnuH / kuvalayabodhaM vidadhati gavA (vAM) vilAsA vibhoryasya // 1 // etc. zrI somasuMdara gurupravarAH prathitA' stapA' gaNaprabhavaH / pratigautamataH saMprati jayaMti niSpratimamahimabhRtaH // 3 // teSAM vineyavRSabhA bhAgyabhuvo bhuvanasuMdarAcAryAH / vyAkhyAnadIpikAdyairgrathaiyeM nijayazo'grathnana // 4 // teSAmeSAM'tipadaMtimaH kimapyAdadhAti sukhabodhAM / vRttiM svaparahitArthe gRhipratikramaNasUtrasya // 5 // etc. 301 "" fol. 90deg iti zrI tapAdeg zrAddhapratikramaNasUtravRttau guNavratAdhikArastRtIyaH / Ends.- ( text) fol. gob tivihe duppaNihANe aNavaTTANe tahA saibihUNe / sAmAia vitaha kae paDhame sikkhAvae niMde / 27 /

Page #339
302 [.990. Jaina Literature and Philosophy Ends. :-( dom. ). fol. 92a ballIo velAe phalaMli sayalAo coriA ulyaa| takAlameva jAyai jIha mahi dariho vi // 30 // ..... tA kiM karissa minhiM ahavA jaM hoi hou taM savvaM / . . coriM maMcAmi kaha jAe vilasAmi (sacchaMdaM? 41) .... . It ends thus. N. B.-- For additional information see No. 926. - - zramaNopAsaka SramaaopasakapratikramaNasUtra ..... . pratikramanasutra vivaraNasahita with vivarana No.931 - 1293 (.).... 1886-92.. , Extent.-- fol. 14 to fol. 20'. Description.-- Complete. For other details see Caityavandanavrtti No. 847. Author of the commentary.- Sritilaka Suri, pupil of Sivaprabha Sari, sucessor of Cakra Suri. Subject.- The text along with its explanation in Sanskrit. Begins.-(text) fol. 14 baMditta savvAsiddha dhammAiyare savyasAhU a| icchAmi paDikkamiDe sAvagadhammAiyArasya // 1 ,-(com.) fol. 14 prA(pra)NidhAye zrIvIraM / svalparucInAM kRte samAsena vivaraNamidaM kariSye gRhipratikramaNasUtrasya / / tatrAvo maMgalAbhidheyapratipAdikeyaM // etc. Ends.--(text) fol. 206 eva(maha)mAloiya niMdiya garAihaya dugaMchiya(yaM samma) . tiviheNa paDikkato vaMdAmi jiNe cauvIsaM // 50 // _I See p. 152a of the printed edition.

Page #340
9221 tot 4 Malasatras 3p Ends.- (com.) fol. 200. . ........" " evaM pratikramaNasUtraNitaprA(pra)kAraNAlocya niMditvA garhitvA jugu" psitvA vividhena prazaMti (?saMprati ) jinAna(n) vaMde nmskaa(k)romiityrthH| pratikramaNavivaraNaM // ........... ........... zrIcakramarigurupaTTamahodayAdri pradyotanopamaM(ma) zivaprabhasUriziSyaH / zrIprAkpadastilaka'mAriradhIdhanoDa)pi / zrAddhapratikramaNasUtramidaM vivad // 1 iti zrItilakAcAryaviracitA zlokazatavyapramANA pratikramaNasUtralaghu vRtti) samarthayAMcave ||ch / Then in a different hand we have : kartA tilakasUriH Reference.-- See Jaina granthavali (pp. 30-31 ). zramaNopAsaka pratikramaNasUtraH - vivaraNa Sramanepasakapratikramanasutra vivarana ..... _200 (f). No.932... ... .... ... 1873-74 Extent.-- fol. 18s to fol. 21b. Description.-- Complete ; extent 200 slokas. For other details see % 200 (a).. No. 1873-74 Author.-- Sritilaka Suri. For particulars see p. 302. Subject.-- A small commentary in Sanskrit explaining the Van dittusutra. Begins.- fol. 186 // 6 // praNidhAya zrIvIraM svalparucInAM kRte smaasen| . ........... vivaraNamidaM kariSye gRhipratikramaNasUtrasya // 1 // etc. 1 This means Sritilaka. 2 This ought to be Sritilaka and not Tilaka.

Page #341
304 Jaina Literature and Philosophy [932. Ends.-- fol. 21 iti zrItilakAcAryaviracitA zlokazatavayapramANA zrAvaka pratikramaNasUtravRttiH // 200 graMthAgraM ||ch / maMgalaM mahAzrIH // zubhaM bhavatu lekhakapAThakayoH // kalyANaM bhavatu kRtInAM // N. B.-- For reference see No. 931. zramaNopAsaka SramanopasakapratikramaNasUtra pratikramanasutrabAlAvabodha balavabodha No. 933 821. 1892-95. Size.- Ion in. by 4g in. Extent.-- 18 folios ; 14 lines to a page ; 46 letters to a line. Description.-- Country paper rough, tough and white; Devanagari characters; big, clear and tolerably good hand-writing ; borders ruled in two pairs of lines in black ink; the space between these pairs coloured red; yellow pigment used; foll. numbered in the right-hand margin only; the numbered sides have a small design in red colour at least in the centre; condition excellent; this Ms. contains the pratIkas of the text; complete. Age.-- Old. Author.-- Not mentioned. Subject.-- An explanation in Gujarati of the Vandittusutra, based upon the commentary composed on it by Sricandra Suri. Begins.-- fol. I" 5 60 // vaMdittu sabbasiddhe / ityAdi / baMditta vAMdI karI | etc. Ends.- fol. 18deg iti zrIcaMdrasarikRtamahArthazrAddhapratikramaNavRttyanusAreNa vaMditta bAlAvabodhaH samAptaH / zreyase(5)stu lekhakavAcakayoH / Reference.-- For an anonymous balavabodha see Limbli Catalogue ___No. 2618.

Page #342
934.] 111. 4. Malasatras 305 trividhAhAropavAsa TrividhabaropavasapratyAkhyAna pratyakhyana (tivihAra-uvavAsa (Tivihara-uvavasapaccakkhANa) paccakkhana) 1220 (37). No. 934 1884-87. Extent.-- fol. 1914. _1220 (1).. Description.-- Complete. For other details see No. 1884-87. Author.-- A Jaina saint. Subject.--A Prakrit formula representing a vow undertaken by one who wants to observe abhatha, a Jaina fast, but does not want to refrain from drinking water during the day time. Begins.-- fol. 1912 mUre uggae anbhattaTuM paJcakkhAi tivihaM pi vA(?A)hAraM / .. asaNaM pANaM khAima sAima | etc. Ends.- fol. I9I sahasAgAreNaM mahattarAgAreNaM / samma(?tva )samAhivattiyAgAreNaM vosirAmi / / upavAsapaccakkhANaM // cha / / Reference.-- Published. For a parallel extract see B. B. R. A. S. Vols. III-IV, p. 399. See Vandaruvrtti (p. 75). In the edition containing Pratyakhyana, Sarasavata vibhrama, Danasattrimsika, Visesanavati and Vimsatika, and published by Sri Rsabhadevji Kesarimalji Samstha, Rutlam in A. D. 1927, we have pratyakhyana-sutras. granthisahita pratyAkhyAna (gaMThisahiya paccakkhANa) Granthisa hita pratyakhyana (Ganthisahiya paccakkhana) 1269 (34). 1887-91. No. 935 Extent.- fol. 4. Description.- Complete. 39 J.LP.] For other details see No. 735.

Page #343
306 Jaina Literature and Philosophy [935 Subject. - This is a pratyakhyana whereby every time one wants to take any kind of food, one has to untie a knot and after taking food one has to tie a knot again. Thus this is a sanketika pratyakhyana, one of the varieties of pratyakhyana noted on p. 312. Begins and Ends.-tol. 4 gaMThisahiyaM paJcakkhAmi caunvihaM pi AhAraM __ asaNaM 4 annattha / sahasA ! mahattarA / savvasamAhi / vosirAmi // 4 Reference.- Published practically in any edition of Pancaprati kramanasutras. vikRtipratyAkhyAna Vikstipratyakhyana (vigaipaccakkhANa) (Vigaipaccakkhana) No. 936 1269 (35). 1887-91. Extent.- fol. 4. Description.- Complete. For other details see No. 735. Subject.- This is a vow undertaken by one who wants to refrain from taking any of the vikstis. Begins and Ends.- fol. 4 vigaio paJcakkhAmi annattha / sahasA / levAleveNaM gihatthasaMsiTreNaM / ukkhittavivegeNaM / paDucca makkhieNaM / pAriTrAvaNiyagAreNaM mahattarA / satvasamAhi / bosirAmi // cha / 5 Reference.-- Published. This very pratyakhyana occurs in the svopajna commentary (p. 189b) on Dharmasamgraha, with this difference that instead of paccakvAmi and vosirAmi we have paccakkhas and vosirai respectively. ekAzanAdipratyAkhyAna | (egAsaNAdipaJcakkhANa) Ekasanadipratyakhyana ( Egasanadipaccakkhana ) 1220(35). 1884-87. No. 937 Extent.- fol. 190deg to fol. I910

Page #344
938. III. 4 Malasatras 307 Description.- Complete. For other details see No. Author. A Jaina saint. - Subject. A formala for taking a vow of abstaining from several articles of food etc. Perhaps this work is same as No. 935. dvividhihAraikAzana pratyAkhyAna (duvihAra-egAsaNapaccakkhANa ) 1220 (1). 1884-87. Begins and Ends. fol. 190b gaMThisahiyaM paJcavakkhAmi / cauvvihaM pi AhAraM / asaNaM pANaM khAimaM sAimaM / annatthaNAbhogeNaM / sahasAgAreNaM / mahattarAgAreNaM savvasamAhibattiyAgAreNaM vosirAmi || || cha | ekAsaNAviniya (?)paccakhANaM // cha // Reference.-- Published. An edition (p. 8534 ) containing Haribhadra Suri's commentary to Avasyakasutra mentions this as a sutra of Avasyakasutra. -- Vandaruvrtti ( pp. 72-73 ) may by consulted. For an extract see B. B. R. A. S, Vols. III-IV, p. 399. Dvividhaharaikasanapratyakhyana ( Duvihara-egasana (paccakkhana ) 1269 (36). 1887-91. .No. 938 Extent. fol. 4a. Description.- Complete. For other details see No. 735. Subject. This is a pratyakhyana whereby meals can be taken only once, but water and svadima (relishes), a number of times. It also includes Desavakasika vrata with all sorts of limitations except those pertaining to dravya and sacitta. Begins and Ends. - fol. 42 egAsaNaM paccakkhAmi duvihaM pi AhAraM asaNaM khAimaM / annattha sahasA | sAgAriyAgAreNaM AuMca (TeTa)NapasAraNeNaM guruanbhuTThANeNaM / pAriTTA / maha savvasa dravyasAcittadesAvagAsiyaM avabhoyaparibhogaM paccakkhAmi / anna saha / mahanta savvaMsa / vosirAmi // cha // 6

Page #345
308 Jaina Literature and Philosophy (938. Reference.-- Published practically in most of the editions of Panca, pratikramanasutras. For comparison see p. 853a of the the edition of Avasyakasutra containing Haribhadra Suri's commentary. fragtitra DvividhaharaikasthanapratyAkhyAna pratyakhyana (duvihAra-egahANa ( Duvibara-egatthanapazcakkhANa) paccakkhana No. 939 1269 (37). 1887-91. Extent.-- fol. 4a to fol. 46. Description.- Complete. For other details see No. 735. Subject. - This is a pratyakhyana whereby meals can be taken only once and that, too, by keeping all other limbs except mouth and hand steady. It is permissible to drink water and to take svadima as many times as one pleases. Begins and Ends -- fol. 4" gurgrui fate gras sigri SHU ETEA 37 #El amoti 1637 I FEI FETE I DETTA II E IL Reference.-- Published mostly in any of the editions of Panca pratikramanasurtas. abhaktArthapratyAkhyAna ( 3744184&halut) Abhaktarthapratyakhyana ( Abljattatthapaccakkhana ) 1269 ( 38 ). No. 940 * 1887-91. Extent.-- fol. 46. Description.-- Complete. For other details see No. 735.

Page #346
941.] III. 4 Malasatras 309 Subject.-- This is a pratyakhyana whereby one undertakes to observe a fast, and there too, to drink water after a specified interval. Herein is included Desavakasika vrata which ordinarily sets a limit in 14 ways, but here two of them are excluded. Cf. Nos. 934 and 938. Begins and Ends. - fol. b sUre uggae abhattaTuM paJcakkhAmi tivihaM pi AhAraM asaNaM khAima anna / sahasA / pAri / maha / savva / pANahAra gaThisahiyaM paJcamkhAmi / anna / saha / dravya / sacittaniyamudesAvagAsiya bhogaparibhoga / annattha / saha | savva / bosirAmi // 8 Reference.-- Published. For comparison see the pratyakhyana given in the commentary (p. 188b) on Dharmasamgraha. divasacarimapratyAkhyAna Divasacarimapratyakhyana (divasacariyapaJcakkhANa) (Divasacariyapaccakkhana) 1220 (38). No.941 1884-87. Extent.-- fol. 1914. Description -- Complete. For other details see No. : 1220 (1). Author.-A Jaina saint. Subject.-- A Prakrit formula representing a vow undertaken by one at about sunset (that is why it is called divasacAriyaM paJcakvANa) with a view to abstain from at least food and khadima. This means that there are three varities of this pratyakhyana viz. (I) caturvidhAhAradivasacArama, (2) trividhAhAradivasacArama and (3) dvividhAhAracArama. In the Ist variety all the four types of food are given up; in the 2nd all except drink, and in the third, all except drink and relishes. Begins.--fol. 1912 divasacarimaM paJcakkhAmi / duvihaM tivihaM caubvihaM pi AhAraM etc. Ends.-- fol. 19r* anatthaNAbhogeNaM sahassAgAreNaM mahattarAgAreNaM savvasamAhi vattiyAgAreNaM vosirAmi // cha / rAtripratyAkhyAnaM // ch||

Page #347
310 Jaina Literature and Philosophy [ 941. Reference. Published. For an extract see B. B. R. A. s. Vols. III-IV, p. 399. Cf. Vandaruvrti (p. 76). caturvidhAhAradivasacarimAdipratyAkhyAna ( cauvvihAradivasaafkengyszczelo) Caturvidhaharadivasacarimadipratyakhyana (Cauvviharadivasacariyaipaccakkhana) 1269 (39). 1887-91. No. 942 Extent.- fol. 4. Description.--Complete. For other datails see No. 735. Subject. This is a formala meant for one who wants to observe Caturvidhaharapratyakhyana and Desavakasika as well. Begins and Ends. fol. 45 divasaca [ 2 ]rimaM paJcakkhAmi cauvvihaM pi AhAraM asaNaM / 4 anna / sa ma / savva / desAvagAsiyaM bhogaparibhogaM paccakakhAmi / ana / saha / maha / savva samA / vosirAmi // cha // 9 // cha // zrIH Reference. Mostly published in some of the editions of Pancapratikramanasutras. sAkArabhavacarima pratyAkhyAna (sAgArabhavacarimapaccakkhANa ) Sakarabhavacarimapratyakhyana (Sagarabhavacarimapaccakkhana) 75 (b). 1898-99. No. 943 Extent.-- fol. 3. Description. Complete. For other datails see No. 407. Subject. This is a pratyakhyana whereby fasts are undertaken till death, and that only water is allowed to be drunk. But under certain abnormal circumstances, one may not carry out this vow. Begins and Ends.-- fol. 30 sAgArapaccakhANa gAthA ||

Page #348
945.] III. 4 Malasatrar 31 jai me hujja pmaao| // bhavacAramaM pnyckkhaaii| tivihaM pi AhAraM / asaNaM khAimaM sAimaM annatthaNAbhogeNaM / sahasAgAreNaM / 0 / arihaMta sakkhiyaM / siddhasa devasa0 appasa vosiraha / Reference.-- Published. sAkArapratyAkhyAna Sakarapratyakhyana (sAgArapaccakkhANa) ( Sagarapaccakkhana ) 76 (15). No.944 1880-81. Extent.-- leaf 80deg to leaf 814. Description.-- Complete. For other details see Dasavaikalikasutra niryukti No. 711. Begins.- leaf 80b sa karemi paNAmaM jiNavaravasahassa vaddhamANassa sesANaM ca jeNANaM sagaNaharANAM ca savvesiM / 1 etc. Ends.- leaf 81 iti sAgArapratyAkhyAnaM samApta cha / cha / N. B.- For additional particulars see No. 943. anAkArabhavacarima AnakarabhavacarimapratyAkhyAna pratyakhyana (aNAgArabhavacariya ( AnagarabhavacariyapaccakkhANa) paccakkhana ) No. 945 75 (0). 1898-99. Extent.-- fol. 36. Description.- Complete. For other details see No. 407. Subject.-- This is a pratyakhyana whereby one undertakes to re frain from all the varieties of food except drinks, and that too, even under adverse circumstances. tivihaaranshngaathaa| bhavacAramaM nirAgAraM pnyckkhaai| cauvihaM pi AhAraM / savvaM asaNaM savvaM pANaM / savvaM khAimaM / satvaM sAimaM / annatthaNAbhogeNaM / sahasAgAreNaM mahattarAgAreNaM / savvasamAhivattIyAgAreNaM vosirai ch| ||shrii||shrii|| Reference.-Published.

Page #349
312 Jaina Literature and Philosophy [946. namaskArasahita Namaskarasahita pratyAkhyAna pratyakhyana (namukkArasahiya (Namukkarasahiya paccakkhANa) paccakkhana) No. 946 1106 (49). 1891-95. Extent.- fol. 6. - Description.- Complete. For other details see Namaskaramantra No. 736. Subject.- This pratyakhyana is one of the ro varieties of Addha pratyakhyana. It means denial of taking any type of food, drink, etc. for 48 minutes. For details see the following table : 6 pratyAkhyAna uttaraguNa sarvamUlaguNa (pazca mahAvrata) dezamUlaguNa (pazca aNuvrata) sarva uttaraguNa deza uttaraguNa (3 guNavrata + 4 zikSAvrata) anAjAlAna kATAhata pAvana sAkAra karaNArA anAgata atikrAnta koTisahita niyantrita sAkAra anAkAra parimANakRta niravazeSa sAGketika addhA / / .. . namaskArasahita pauruSI purimA ekAzana ekasthAna AcAmla abhaktArtha carima abhigraha vikRti Beging and Ends.- fol. 6. atha dazapaccakkhANa likhyate uggee sUre namu . kArasahiyaM paJcakkhAi caubdhihaM pi AhAraM asaNaM pANaM khAimaM sAima annatthaNAbhogaNaM sahassAgAreNaM vosirai 1 1 See Avasyakasutraniryukti v. 1563-1565 and 1597.

Page #350
948.] III. 4 Malashtras 32 Reference. - This very pratyakhyana is published in the syopajna commentary (p. 184") on Dharmasamgraha. Cf. Avasyakasatra (p. 849). namaskArasahita Namaskarasahita pratyAkhyAna pratyakhyana No.947 1269 (31). 1887-91. Extent.- fol. 4'. Description.-- Complete. For other details see No. 735. Begins and Ends.-- fol. 4 // 6 // uggae sUre namokArasahiyaM paJcakkhAmi / caunvihaM pi AhAraM asaNaM pANaM khAimaM sAimaM / annatthaNAbhogeNaM sahasAgAreNaM vosirami // cha / 1 Reference.-- In the svopajna commentary (p. 1846 ) on Dharma samgraha, this pratyakhyana is given, but instead of vosirAmi, there is vosirai. N. B.- For subject see No. 946. pauruSIpratyAkhyAna Paurusipratyakhyana (porisIpaccakkhANa) (Porisipaccakkhana) 1269 (32). No.948 1887-91. Extent.- fol. 4 Description.-- Complete. Through oversight this work is styled as Upavasapratyakhyana on p. 153. For other details see No. 735. Subject.-- This is a pratyakhyana whereby one binds oneself for refraining for one eighth of a day, from taking any kind of food whatsoever. 40 [J.L. P.]

Page #351
314 Jaina Literature and Philosophy [948. Begins and Ends.-- fol. 4 porasiM paJcakkhAmi uggae sUre cauvihaM / pi [Api AhAraM asnnN||4 annatthaNA (0) sahasA (0) pacchannakAleNaM disA moheNaM sAhavayaNaNaM savyasamAhivattiyAgAreNaM bosirAmi / / 2 cha Reference.- Published in several editions of Pratikramanasutras. See also p. 8520 of the printed edition of Avasyakasutra containing Haribhadra Suri's commentary. Herein it is given as one of the sutras of Avasyakasutra. purimArdhapratyAkhyAna Purimardhapratyakhyana (purimaDapaccakkhANa) (Purimaddhapaccakkhana) 1269 (33). No.949 1887-91. Extent.-- fol. 4*. Description.-- Complete. For other details see No. 735. Subject.-- This is a pratyakhyana whereby one binds oneself to refrain from taking any article of food, drink etc., for the first half of the day. Begins and Ends.--fol. 4* sUre uggae purimaDUM paJcakkhAmi cauvihaM pi AhAraM asaNaM / 4 annatthaNA / sahasA / pacchanna / disA / sAhu / mahattarAgAreNaM sabasamAhivattiyAgAreNaM bosiraami||3 Reference.-- Published in several editions of Pancapratikramana sutras. AcAmlapratyAkhyAna Acimlapratyakhyana (AyaMbilapaccakkhANa) (Ayambilapaccakkhana ) 1220 (36). No. 950 1884-87. Extent.- fol. 1918. Description. Complete. For other details see No. 728_42. 1884-87. Author.- A Jaina Saint.

Page #352
951. ] [1]. 4 Malasatras 315 Subject.- A Prakrit formula pertaining to a vow to be undertaken by a person who wishes to observe a penance known as Acamla along with Desavakasika vrata. This Acamla resembles ekasana but there are limitations regarding the varieties of food etc. to be taken. Begins.- fol. 1914 JOIT ET ATT gitag ar ya FATA I goreng for AhAraM / etc. Ends.- fol. 1918 Here I HOTEITHIST I SHTETRTOTTHIATO I FERNTRU sabasamAhivattiyAgAreNaM bosirAmi // AMbilaM paccakkhANaM / Reference.-- Published. Cf. B. B. R. A. S. Vols. III-IV, p. 399 and Vandaruvstti (pp. 74-75.). pratyAkhyAnasUtra Pratyakhyanasutra (982elga) (Paccakkhanasutta ) TabbAsahita with tabba No. 951 1273. 1891-95. Size.- 9 in. by 48 in. Extent.- 2 folios ; 6 lines to a page ; 42 letters to a line. Description.- Country paper thin, rough and greyish ; Devanagari characters with occasional quale ; this Ms. contains the text and its interlinear tabba; the latter written in a very small hand; clear and good hand-writing; borders and edges ruled in two pairs of lines in black ink; the space between the pairs coloured red; yellow pigment used ; foll. numbered in the right-hand margin, only; bits of paper pasted to fol. 2b; edges of both the foll. slightly worn out ; condition tolerably good ; complete ; various agaras etc. presented in a tabular form on tol. 2a, Age.- Old. Author of the text.-- Not mentioned. >> >> >> tabba >>

Page #353
36 Jaina Literature and Philosophy [981 Subject.-- Sutras for the pratyakhyanas pertaining to upavasa, acamla, etc. in Prakrit along with their explanation in Gujarati: Begins.-- (text) fol.I. 6 / / uggae sUre nmukkaarshi| etc. .. , -(tabba ) fol. I' UgIyA sarija / eka pramANa muhUrta / etc. Ends. - (text) fol. 20 sabasamAhivittiyAgAreNa vosirai |ch / iya . paccakhANasuttaM sNpunn| , - ( tabba ) fol. 2' AhArAdi kcho| cha / saMpUrNa vaSANyau pacaSANa / iti / zrIsitapatre likhitaM vA jJAnamaMdi( ? )gANa likhitaM / / pratyAkhyAna (?) * Pratyakhyana (?) TabbAsahita with tabba No. 952 743 (f). 1875-76. Extent.- fol. 122 to fol. 126. Description.- Complete. For other details see No. 7 746 (a). 1875-76. Author of the text.- Not mentioned. " " , tabba.-, Subject.- Denials to temptations in Prakrit along with their ex planation in Gujarati. Begins.- (text) fol. 12*. cattAri do duvAlasa | vAsaM cAlIsa hoti ujjoyaa| desaa rAiya pakkhiya | cAumAse a varise a|| 1 // etc. ,, - (com. ) cyAri logano kAusaga vijo0 12 logassa vIsaM comAsa. ....cAlIsa logasa 40 logasa ujoigare mAtalA Ends --( text ) fol. 12b devasia cAUmAsia / saMbaccharia esu pddikmnnmjhe| muNiNo khAmijjaM ttiA timni tahA paMca satta kamA // 4 // iti paccakkhANaM ti // . . . ..

Page #354
952.] . III. 4.Malasutras:: :...', ju Ends- (com. ) fol. 12b ... devasi paDIkamaNai caumAsI pratikramaNai saMvaccharI paDIkamaNA mAMhi munIvara sAdhu SAmijaI tina nima pAMca sAta anukrame joDavA 4 iti pacaSyAmi 4 pacaSAMNa kahai. pAkSikakSAmaNAsUtra Paksikaksamanasutra (pakkhiyakhAmaNAsutta) ( Pakkhiyakhamanasutta ) No. 953 750 (b). . 1892-95. Extent.-- fol. 11b. Description.-- Hand-writing somewhat small; complete. For other details see No. 750 (a).. - 1892-95. Subject.- One of the sutras recited at the time of the fortnightly pratikramana. This work consists of four parts. Out them the first part deals with an inquiry on the part of a sisya, regarding his guru's passing a fortnight in the way desired. The second part deals with salutation to the caityas and saints. The third part refers to the mithyadusksta on the part of the sisya in connection with outfit and study. The fourth part refers to the obligations of the guru. Begins.-- fol. IIdeg icchAmi khamAsamaNo piyaM ca me jaMbhe haTANaM tudrANaM appANaM kANaM abhaggajogANaM susIlANaM etc. Ends.- fol. II sAhaTTa nittharissAmi ttikaTTa sirasA magasA matthaeNa vaMdAmi nitthAraga pAraga hoha iti guruvacanaM tataH ziSyavacanaM icchAmo aNusiTiM 4 iti pAkSikakSAmaNAsUtraM / Reference.-- Published in some of the printed editions of Panca pratikramanasutras. It is also published on p. 14* of the edition of sAdhupratikramaNAdisUtrANi published by the Secretary of Sri Atmananda Jaina Sabha in A. D. 1921. Furthermore, this sutra is published in the edition (p. 7938 and 7936) of Avasyakasutra containing Haribhadra Suri's com mentary.' For a Ms, see Limbdi Catalogue No. 1545. 1 See p. 1356

Page #355
318 pAkSikakSAmaNAsUtra No. 954 Extent. fol. 8b. Jaina Literature and Philosophy pAkSikakSAmaNAsUtra [954. Description.-- Complete. For other details see No. 1174 (a ) 1887-91. Begins. fol. 8. icchAmi khamAsamaNo piaM ca me jaM me haTTANaM tuTTANaM appA etc. Ends.-- fol. 86 nittharissAmi tti kaTTu sirasA maNasA matthaeNa vaMdAmi / nitthArage pAraga hohA guruguNehiM ghaDDhAhiM // iti pAkSikakSAmaNakaM // N. B.-- For further particulars see No. 953. Paksikaksamanasutra 1174 ( h ). 1887-91. pAkSikakSAmaNA sUtra No. 956 Paksikaksamanasutra 1269 (d). 1887-91. No. 955 Extent. -- fol. rrb Description.-- Complete. For other details see Namaskarmantra No. 735. Begins fol. Irb icchAmi khamAsamaNo piyaM etc. Ends.--fol. 11* sAhaDa(Da) dittharissAmi etc. up to nitthAraga pAragA (gga) hoha as in No. 954. This is followed by the lines as under:-- guruNo vayaNAI etc. pakhiyaM pakakhiyakhAmaNayA sammattA // pakhiyasuttaM saMmattaM // N. B. For additional information see No. 953. Paksikaksamanasutra 751 (b). 1892-95. Extent.- fol. 4. Description. - Complete. For other details see No. 75 1 ( a ) 1892-95.

Page #356
958. 1 III. 4 Malasatras Begins. fol. 4deg icchAmi khamAsamaNo etc. as in No. 953. Ends. fol. 4deg sAhaTTu nittha etc. up to vaMdAmi as in No. 953. This is followed by the lines as under iti pAkSikakSAmaNakAni samAptAni likhitAni haMsalAvaNyapaThanArthaM salavare (?) saMvat 1540 (?) N. B.-- For further particulars see No. 953. pAkSikakSAmaNAsUtra No. 958 Extent.--- fol. 45. pAkSikakSAmaNAsUtra No. 957 Extent. fol. rrb to fol. 122. Description. Complete. For other details see Namaskaramantra No. 736. Begins.-- fol. rr icchAmi khamAsamaNo piaM ca me etc. as in No. 953. Ends.-- fol. 124 imAo cAuraMtasaMsArakaMtArAo sAhaddu nitthara (ri) ssAmi etc. up to icchAmo'NusiddhiM 4 as in No. 953. This is followed by the line as under : iti pAkSa (kSi) kakSAmaNA samAptaM // N. B.-- For further particulars see No. 953. Paksikaksamanasutra 1106 (52). 1891-95. 'pA0 kSAmaNA // cha // cha // 319 Paksikaksamanasutra 1282 (b). 1891-95. Description.--- Complete. For other details see No.Begins. --- fol. 45 icchAmi khamAsamaNo piyaM ca me etc. Ends. fol. 4deg imAo cAuraM (ta) saMsArakaM (kaM) tArAo rissA[te] mi kiTTu sirasA maNasA matthaaiNa as 1282 (a). 1891-95. in No. 953. N. B. For additional information see No. 953. pAkSika. sAhaddhu (Da) nissa (ratha) - vaMdAmi // 4 iti

Page #357
13020 pAkSikakSAmaNasUtra No. 959 Extent. fol. 8b, Jaina Literature and. Philosophy pAkSikakSAmaNAsRtra No. 960. Extent. -- fol. 8a to fol. 8b. Description.-- Complete. _1202 ( a ). No.1887-91. 1174 (a ) 1887-91. Description.-- Complete. For other details see No. - Begins.-- fol. 86 icchAmi khamAsamaNo piaM ca me etc. - as in No. 953. Ends. fol. 8b imAo cAuraMta etc. up to nitthAraNa pAragA hoha | guruguNehi bAhiM // iti pAkSikakSAmaNakaM // zrIH // N. B.-- For additional information see No. 953. 1.959. pAkSika kSAmaNA sUtrAva cUrNi Paksikaksamanasutra 1174 (h). 1887-91. No. 961 Extent. -- fol. 224 to fol. 22b.. Paksikaksamanasutra 1202 (c). 1887-91. For other details see Paksikasutra Begins. fol. 8 icchAkAreNa saMdesaha bhagavan pakkhia khAmaNA khAeM icchaM icchAmi khamAsamaNo piaM ca me jaM me etc. Ends. fol. 8b sAhaTTa nittharissAmi etc. up to nitthAra (ga) pAragA as in No. 934. This is followed by the line as under :-- hohati iti pAkSikapratikra maNakSAmaNakAni sUtrANi likhitAni cha / N. B.- For additional information see No. 953, Paksikaksamanasutrava curni 1182 (c) 1884-87.

Page #358
9621 Hi. 4 Malasatras 3 . Description.-- Complete; condition tolerably good; 3700 slokas in extent; composed in Vikrama Samvat 1180. For other details see No. 728. Author.--Yasodeva Suri. Subject.-- A small commentary in Sanskrit on Paksikaksamanasutra. Begins.--- fol .22* zrI0bha0 pUjyA nanu kathaM zrutAdhiSThAtRdevyA vyaMtarAdiprakArAyAH parakarmakSapaNe sAmarthya ? / ucyate tadvocarazubhapraNidhAnasyApi smrtuH| karmakSayahetutve nAbhihitatvAt // cha / yahA rAjAnaM puSpamANa 2 kA atikrAMte mAMgalyakAyeM bahu mnyte| yaddhata akhaMDitabalasya te kAle gate / anyo(s)pyevmevopsthitH| evaM pAkSikaM vinayopacAraM dvitIyakSAmaNakasUtreNa tathAsthitA eva sAdhavaH / AcAryasya nu(kuti / taccedaM icchA. i. abhilapAmi etc. Ends.-- fol. 22 saMsArasamudratIragAmino bhavata yUyamityAzIrvacanAmiti // cha / / iti kssaamnnaakaavcuurnninnH|| zrIcaMdrasUreH pAdapaMkajasevanAt / dRldheyaM prastutA vRttiH ||shriiyshobhdrsuurinnaa // 1 ekAdazazatairadhikarazItyA vikramo j(gotH|| he sahasre zatairadhikaiH saptamaigraMthamAnataH // 2 // pAkSikastuti Paksikastuti No.962 1106 (37). 1891-95. Extent. - fol. 5. Description.- Three verses in all. Fo. other details see Nama skarainantra No. 736.. Author.- Not mentioned. Subject.- Hymns comprising 3 verses recited at the time of the fortnightly pratikramana. The first verse is a panegyric of Srutadevata, the second, that of Bhavanadevi, and the third, that of Ksetradevata. 11 [J. L. P.]

Page #359
322 Jaina Literature and Philosophy 1962. Begins.-- fol. 5. ........kamaladalavipulanayanA kamalamapI(khI) kamalaga samagaurI . kamale sthitA bhagavatI dadAtu zrutadevatA saukhyaM 1 jJAnAdiguNayutAnAM svAdhyAyasaMja(ya)maratAnAM .............. vidadhAtu bhavanadevI zivaM sadA sarvasAdhUnAM 2 Ends.---fol. yasyA(:) kSetraM samAzritya sAdhubhiH sAdhyate kriyA sA kSetradevatA nityaM bhUyAnme mukhadAyinI 3 iti pAkSikastutiH - Reference.- Published in several editions of the Pancapratikra.. manasutras. In the Limbdi Catalague, Paksikastuti by ....... Balacandra in four verses in Sanskrit is noted as No. 1550. But it is difficult to say for certain as to what this work is. . .... . Narina namo'stu vardhamAnAya Namo'stu Vardhamanaya [vardhamAnastuti'] [Vardhamanastuti] . ........... .. .... 1106641). No.963 - 1891-95. Extent.- fol. sb. Description.- Complete ; 4 verses in all. For other details see ............. - Namaskaramantra No. 736. Author.-- Not mentioned. Subject.-- A small work in Sanskrit in four verses. The first of them is a hymn praising Lord Mahavira alias Vardhamanasvamin; the second praises all the Tirthamkaras; the third, the speech of the Ganadharas i. e, scriptures and the fourth, Srutadevi. Begios.-- fol. sb namo(s)stu varddhamAnAya sparddhamAnAya karmaNA tajja(ja)yAvAptamokSAya parokSAya kutIrtha(rthi)nAM 1 etc. 1 This is the name mentioned,by:the scribe.

Page #360
964. ] til. 4 Malasatras Ends.-- fol. 5b kaSAyatApAdita etc. up to vistaro girA 3 as the 3rd verse. zvasiti surabhigaMdhAlundhabhaMgI kuraMgaM mukhazazinamajalaM bibhratI yA bibharti vikacakamalamuccaiH sA(s)stvaciMtyaprabhAvA sakalasuSa(kha)vidhAtrI prANibhAjAM zrutAMgI iti zrIvardhamAnastutiH 1 . Reference.-- The portion containing the ist 3 verses is published in various editions of Panca pratikramanasutras. The succeeding verse does not seem to be a part and parcel of this work. There is a reference about this Namo'stu Vardhamanaya in Senaprasna where it is said that all recite the rest of this work after two verses are recited singly. . . ol. zramaNasUtra Sramanasutra (FHUET) ( Samanasutta ) 251. No. 964 1871-72. Size = 10 in. by 4.5 in. . Extent.-- 6 folios : 6 lines to a page ; 26 letters to a line. Description.-- Country paper rough and white; Devanagari cha racters; this contains the text and the tabba to a certain extent; the former written in a bigger hand ; clear and good hand-writing ; borders ruled in two lines and edges in one, in red ink ; foll. numbered in the right-hand margin only; the last fol. written in somewhat smaller hand-writing ; condition very good; the text complete. Age.-- Not quite modern. ...... . Author.--- Not mentioned.. Subject:-- This work seems to be varionsly named e. g. Sahupadi. .. kkamanasutta and Yatipratikramanasutra. The ending portion contains Addhaijjesu,' and the last two gathas occurring in Vandittusutra. I Sec p. 284.

Page #361
524 Jaina Literature and Philosophy [964. Sramanasutra deals with the following topics :-- (1) tvagvartanasthAnAticAra, (2) gocarAticArapratikramaNa, (3) svAdhyAya. praticArapratikramaNa, (4) ekavidhAdipratikramaNa, (5) tIrthaGkaranamaskAra, (6) pravacanavarNana, (7) addhAnAdisvarUpa, (8) asaMyamAdityAga, (1) munivandana and (10) sarvajIvakSAmaNa. Out of these the 4th topic refers to the following sub-topics: (1)3 daNDa, 3 epti, 3 zalya, 3 gaurava and 3 virAdhanA; (2) 4 kaSAya, 4 saMjJA, 4 vikathA and 4 dhyAna ; (3) 5 kriyA, 5 kAmaguNa, 5mahAvrata and 5samiti ; (4) 6 jIvanikAya and 6 lezyA; (5) 7 bhayasthAna; (6) 8 madasthAna; (7) 9 brahmacaryaguptiH (8)1. zramaNadharma; (9) 11 upAsakapratimA; (10) 12 bhikSupratimA; (II) 13 kriyAsthAna; (72) 14 bhUtagrAma ; (13) 15 paramAdhArmika ; (14) 16 gAthASoDaza-samayAdi adhyayana : (15) 17 asaMyama; (16) 18 abrahma (17) 19 jJAtAdhyayana; (18) 20 asamAdhisthAna; (19)21 zabala; (20) 22 parIbaha (21) 23 sUtrakRtAdhyayana; (:22) 24 deva ; ( 23 ) 25 bhAvanA; (24) (24) 26 dazakalpavyavahAroddezakAla; (25) 27 anagAraguNa; (26) 28 AcAraprakalpa ; (27) 29 pApazrutra ; ( 28)30 mohanIyasthAma; (29) 31 siddhaguNa ; (30) 32 yogasaMgraha and (31) 33 AzAtanA. Begins.-- (text) fol. 1. zrIgurubho(bhyo) namaH icchAmi paDikvamiGa pagAmasijjAe nigAmAsajjAe saMthArA uvaTa(dR). gAe pariyaTTaNAe pasAraNAe AuMTTa(Ta)NAe chappiyA saMghaTaNAe kuIekkakkarAIe chIe ja(ja)mAie Amose sasarapA(ksAmose AulamAulAe sa(soyaNavittiyAra etc. , -(com.) fol. " icchAmi paDika icchAmi kahatAM vAchau paDikkamiyA bhaNi cyAri puhara suvaiMkari naiM aticAra lAgA huiM ghaNi ghelA zuvaI karI je atIcAra lAgA huI saMthArA utAraNA TAli Adhika upagaraNa ghAlibaI pujyA pApaI pAsAneha pheri tiNe karI DIlane aticAra lAgI hui etc. irds:-( text) fol. 6 Ai)DhAi(jo dIvasahadeva pannarasa kamAmA (dha mIsa jAti(ta) keSi sAhurahU) rayaharaNagucchapaDigA(ga)hadhArA paMcamahaba(bboyadhArA aTTArasa(sa)ha(ssa)sIlaMgadhArA akkhayAyArAca(caritA)te sabai(bbe) sirasA mamatA matye(tyo eNa baMdA(mi) cha

Page #362
Malasairas kkhAmi sava (ve) jIve sabve jIvA khamaMtu me mittI me sava (sva) bhUesa veraM majhaM (jjhaM) na keNai 1 evamahaM Aloiya niMdiya garIhia dukkhaM (gaM) cchia (paM) samaM tiviNa paDikaMto vaMdAmi jiNe cauviza (saM) 2 iti zrIyatipra (ti) kra (maNa ) samApataM zrI ' suratabaMdara ' madhe la (SitaM ) Ends.-- ( com. ) fol. 3 lobha kaSAyeM karine paDika chu cihna saMjJAyahaM karI je aticAra lAgu AhArasaMjJA karInahaM bhayasaMjJA karI methunasaMjJAye karI aticAra lA parigrahasaMjJAye karIne aticAra. It ends thus abruptly. Reference.-- This is an old sutra to be found in the edition of Avasyakasutra containing Haribhadra Suri's commentary to it. See Agamodaya Samiti edition p. 573 ff. This work together with the balavabodha of Nayavimala Gani alias Jnanavimala Suri has been published in Dayavimala Jaina Granthamala as No. 6, in. A. D. 1917. The text is also published on pp. 24 to 42 of the edition of sAdhupratikramaNAdisUtrANi published by the Secretary of Sri atmananda Jaina Sabha, in A, D. 1921. 965.1 * zramaNasUtra No. 965 4 325 For a Sanskrit commentary of Sramanasutra see " zrIbhramaNapratikramaNasUtravRttiH " published in D. LJ. P. F. Series as No. 2 in A. D. 1911. Herein we have the vyakhya ot karomi bhaMte (Samayikasutra ) on pra. This is followed by the vyakhya of cattAri maMgala, cattAri loguttamA, cattAri saraNa, IryApathikIsUtra styled as gamanAgamanAticArapratikramaNa etc. Srmanasutra 1106 (51). 1891-95. Fxtent. -- fol. 8h to fol. rrb. Description. Complete. For other details see Namaskaramantra No. 736.

Page #363
326 Jaina Literature and Philosophy [965. Begins.--fol. 8' arhato bhagavaMta indramahitA siddhAzca siddhisthitAH AcAryA jinazAsanonnatikarAH pUjyA upaadhyaaykaaH| zrIsiddhAntasupAThakA munivarA ratnatrayArAdhakAH ... paMcaite paremeSThinaH pratidinaM kurvantu no maMgalam // 1 // ' cattAri maMgalaM arihaMtA maMgalaM siddhAmaMgalaM sADU maMgalaM kevalipannatto dhammo maMgalaM cattAri logUttamA arihaMtA loguttamA siddhA loguttamA sAhU loguttamA - kevalipannato dhammo loguttamo cattAri saraNaM pavajjAmi arihaMte saraNaM pavajjAmi etc. Ends.-fol. IT' evamahaM Aloia niMdia garihia dugaMchia samma / tibiheNa paDikkato baMdAmi jiNe caudhvIsaM // 2.. ..... iti sAdhupratikramaNasUtraM samAptaM / / N. B.--For further particulars see No. 964. zramaNasUtra. .... .... Sramanasutra No. 966 1269 (40). ......... ..... ......... .. .... 1887-91. Extent.-- fol. 4 to fol. 5.. Description.- Complete. For other details see Namaskaramantra - No.735. .. ........ .... . ... . Begins.-- fol. 4deg icchAmi paDimiyaM pagAmasijjAe etc. as is No. 964. Ends.- fol. sb adA(DA)i(jja) etc. up to cauvIsaM / / as in No. 964. This is followed by 40 iti sAhupaDikkamaNasuttaM // cha etc. .. N. B.-- For further particulars see No. 964. 1 This verse is composed by Jinapadma Suri whose Nandimahotsava took place in Samvat 1389. This is what we learn from Ksamakalyanaka's Pattavali (p. 121) referred to by Muni Himathsuvijaya in his article on this verse published in "Jain" (28th March 1937).

Page #364
967.] III. 4. Malasatras ....... 327 178.. zramaNasUtra Sramanasutra No. 967 1875-76. Size.-- 104 in by 4; in. Extent.-16 folios ; 10 lines to a page; 28 letters to a line. Description.--Country paper rough and white; Devanagari char racters; big, clear and good hand-writing ; borders not ruled; toll. numbered in the right-hand margin only, fol. I blank; red chalk and yellow pigment used ; complete; condition very good. Age.- Samvat 1863. Begins.- fol. I' namo arihaMtANaM etc. Ends.- fol. 166 evamahaM Aloiya niMdiya garahiya duggaMchiyaM savvaM / tiviheNa paDikato baMdAmi jiNe cauvvIsaM / / iti zrIsAghupatikramaNasUtraM ' samAptaM / / saMvat 1863 kA mIti zrAvaNavadi 14 maMgalavAre liSataM vaktarAma laSaNeo madhye kalyANamastu / / N. B.-- For additional information see No. 964. I In the edition of Sadhupratikramapadisatrapi referred to in No. 954 on p. __we have the following works:-- (1) navakAramantra (p. 14),(2) karemi bhaMte (p.1),(3) icchAmi ThAmi kAussaggaM jo me devasio (p.1b), (4) devatika aticAra (ThANe kamaNe caMkamaNe) (pp. 16-24), (5) rAtrika aticAra (saMthArA ubaTTaNakI) (p. 23), (6) zramaNasUtra (pp. 20-40), (7) pAkSika aticAra (pp.40-6%), (8) pAkSikasUtra (pp. 60-130), (9) pAkSikakSAmaNA (p. 140), (10) aticAranI gAthA (sayaNAsaNannapANa, one verse, p. 14deg ), (11) gocarInA 47 doSa in 7 verses in Prakrit along with an explanation in Gujarats (pp. 14b-160), (12) gocarI AlovavAno vidhi in Gujarati (pp. 166-174), (13) sthaMDilazuddhino vidhi (p. 174), (14) saMthArAporisIno vidhi (p. 170), (15) pAkSika, cAturmAsika athavA sAMvatsarika pratikramaNamAM koine chIMka Ave to tenI zuddhi karavAno vidhi (pp 17b-189), (16) vArSika kAussagga karavAno vidhi (p. 189) (17) savAranI paDilehaNA (p. 18-180), (18) sAMjanI paDilehaNA (pp. 186-194), 19) parisIvidhi (p. 199) and (20) pratyAkhyAna pAravAno vidhi (pp: 194-201.....

Page #365
328 zramaNa sUtra Jaina Literature and Philosophy No. 968 Extent. fol. 426 to fol. 46b. Description. Complete. For other details see No. 708. Begins fol. 42b Ends.- fol. 46b icchAkAreNa saMdisaha bhagavam uvttttiomi| amitarapaksviyaM khAmemi / panarasanhaM divasApAM panarasanhaM rAINaM etc. zramaNasUtra bAlAvabodhasahita No. 969 Srmanasutra 1171 (c). 1887-91. 968. qaga etc. up to as in No. 967. This is followed by the line :- zrIvidhisaMghabhaTTArakasya ciraM naMdatAda / N. B.- For further particulars see No. 964. Age.-- Pretty old. Author of the balavabodha.-- Not mentioned. Sramanasutra with balavabodha 1292. 1886-92. Size. 10 in. by 4 in. Extent. 7 folios; 13 lines to a page; 32 to 42 letters to a line. Description. Country paper thin, rough and white; Devanagari characters with quars; this is a ferret Ms.; the text written in a bigger hand; the commentary in a smaller one; legible and tolerably good hand-writing; borders ruled in four lines in black ink; fol. ra blank; foll. numbered in the right-hand margin, only; condition very good; both the text and its Gujarati explanation complete.

Page #366
970.] Iti. 4 Malasatras 329 Subject.--The text. in Prakrit together with its explanation in Gujarati, styled in the Ms. as laghuvrtti. In the text, we have in the beginning the indication of the sutras to be recited before the recitation of the Gramanasutra. Thus it tallies with the Sramanasutra published in the edition of sAdhupratikramaNAdisUtrANi noted on p. 325. Begins.--( text ) fol. I' namo arihaMtANaM karomi bhaMte cattAri maMgalaM icchAmi paDikami iriyAvahiyAe / icchAmi (paDi)kamiGa pagAmasijjAe nigAma sijjAe saMthArA ubattaNAe etc. - , -- (balao) fol. I' pahila navakAra pachai karemi bhaMte pachai cattAri maMgalaM pUru pachai icchAmi paDikamAuM pachai iriyAvahIyA kahAI etc. Ends.- ( text ) fol. 7 aDrAijesu dIvasamuddesau / etc. up to cauvvIsaM 50 as ..... in No. 966. Then we have : iti pratikramaNAsUtra saMpUrNa // ,, - (balai) fol. 7 sarva jIva hu~ khAmauM anai sarva jIva mAharaiM kihasiuM nahI isI pariiMha(1) pApa AlouM naMdauM AtmA sASi garahauM guru sASi valI valI niMdauM sAtha / ima mAni vacani kAya karI pApa thiku nivartauM teha bhaNI cauvvIsaM jinaM vAMdauM mAMgalIka bhaNI 50 iti zrIsAdhUpratikramaNAsUtralaghU(ghu)vRtti samAptaH // cha / // cha / majhanaI khamuM sarva jIvasaM majhanai maitrI huvayA zramaNasUtra Sramanasutra 613 (0). - No. 970 1884-86. Extent.---- fol. 21a to fol. 226. Description.-- Complete. For other details see Paksikasutra 613 (a). .. . No.1884-86..... -Begins.-fol. 21 60 e icchAmi paDikkamiDaM / pagAmasijjAe / nimAmasijjAe - uattnnaae| priattnnaae| etc... Ends.- fol. 220 ........ . evamAloIa niMdia garihia dugaMcchia (samma) tiviheNa paDikkaMto vaMdAmi jiNe cauvvIsaM / iti sAdhupratikramaNa samAptaM N. B.-For further details see No. 964. 42 [J.L. P.]

Page #367
330 Jaina Literature and Philosophy [97.. yatipratikramaNasUtra YatipratikramanasutravyAkhyAna vyakhyana 217. No. 971 1873-74. Size.- 10 in. by 41 in. Extent.- 8 folios ; 14 lines to a page ; 44 letters to a line. Description.-Country paper rough and whire%3 Devanagari cha racters; small, clear, uniform and good hand-writing; borders ruled in three lines and edges in two, in red ink; red chalk and yellow pigment used; foll. numbered in the right-hand margin only; fol. I blank; the first fol. partly worn out; otherwise the condition is good; complete. Age.-- Samvat 1851. Author.-- Sritilaka Sari. Subject.--A commentary in Sanskrit on Yatipratikramanasutra. Begins.- fol. I zrIvIrajinavareMdraM natvA stutvA ca svasya bodhkte| vakSyAmi vyAkhyAnaM yatipratikramaNasUtrasya // 1 // iha sarva paMcaparameSThinamaskArapUrvakaM karma kartavyamityAdau saMprapadyate samabhAvasthena pratikramitavyamityataH sAmAyikasUtraM karemi bhaMte ityAdi uccaryate etc. Ends.-- fol. 8' itthegaIyA ducceNaM bhavaggahaNeNaM satta bhavaggahaNAiM nAikamaMti tasmAt pAlemi pAliMto ityapi paThatAM zreya eva manyate // iti zrItilakAcAryaviracitA sAdhupratikramaNasUtravRttiH samAtA // saMvat 1851 varSe zrI benAtaTa'grAme likhitaM kamanaMdanamuninA zrIrastuH //

Page #368
331 973.] III. 4 Malasatras yatipratikramaNasUtra YatipratikramanasutravyAkhyAna vyakhyana 802. No.972 1892-95. Size:-- 103 in. by 4g in. Extent.-- II folios; 13 lines to a page; 36 letters to a line. Description.-- Country paper thin, rough and greyish ; Devanagari characters; big, legible but poor hand-writing ; borders ruled in three lines in red ink ; red chalk used; yellow pigment, too, but rarely; the last line on the last fol. written in red ink; condition very good; complete. Age.- Does not appear to be old. Subject.- A small commentary on Yatipratikramanasutra based upon the preceding work, if not identical with it, Begins.-- fol. I' paMDi( ta )zrIzubhavijayagaNigurubhyo namaH / / zrIvIrajinavarendraM namAsatvA svalpabuddhibodhakRte / vakSyAmi vyAkhyAnaM yatipratikramaNasya sUtrasya // 1 // etc. Ends.-- fol. II muccaMti / parinivvaMti savvadukkhANamaMtaM karaMti / acchegaiyA duccaNa bhavaggahaNaNaM / sattaha bhavaggahaNAI nAikkamati tasmAt pAlemi / ityapi paThatAM / zreya eveti gamyate / iti ytiprtikrmnnsuutraavcuurnniH|| paMDitazrI5 zubhavijayagaNiziSyANunA lAlavijayena lipIlatA / zubha bhavatu etc. Reference.-- See B. B. R. A. S. vols. III-IV, p. 397. yatipratikramaNasUtra Yatipratikramanasutram vRtti vrtti No. 973 646. 1884-86. Size. -- 101 in. by 4.3 in. Extent,-6 folios ; 19 lines to a page ; 82 letters to a line.

Page #369
332 Jaina Literature and Philosophy [973 Description.- Country paper very thin, rough and white; Deva nagari characters with occasional pRSThamAtrAs; very small, legible, uniform and good hand-writing ; borders ruled in four lines in black ink ; the space between the pairs coloured red ; red chalk used ; foll. numbered twice in the right-hand margin, once as876,877 etc. and once as 1,2 etc.; this Ms. contains the sales of the text; complete; condition very good. Age. - Samvat I497. Begins.-fol. 1 || 60 // ahe / / natvA zrIvIrajinaM sNkssiptruciinnugrhiitumnaaH| . . sugamIkaromi kiMcid yatipratikramaNasUtramahaM // 1 etc. Ends.- fol. 6deg samAptA ceyaM yatipratikramaNasUtravRttiH // cha / ... iti sAdhupratikramaNavRttiH saMpUrNA // cha // zrI saMvat 1497 varSe mArgazIrSavadi 11 zukre zrI kharataraM gacche upAdhyAyazrIjayasAgarANAmupadezena sAdhupratikramaNavRttilikhitA // sA ciraM naMdatu // cha / . . . zivamastu sarvajagataH parahitaniratA bhavaMtu bhUtagaNAH / doSAH prayAMtu nAzaM sarvatra sukhIbhavatu lokaH / / cha / zrIrastu SaDAvazyakasUtra Sa davasyakasutra laghuvRttisahita with laghuvitti No. 974 597. 1895-98.. Size.-- 10 in. "by 41 in. Extent.- (text) 16 folios ; 7(8) lines to a page ; 44 letters to a -,-(com.) , , Io(?) lines to a page ; 6o-letters to a. line. line. Description.-Country paper rough, thin and grey; Devanagari ... characters with occasional pRSThamAtrAs; this is a tripATI Ms.; the hand-writing of the text is slightly bigger than that of the commentary ; borders ruled in four lines in black ink; yellow pigment used; foll. numbered in the right-hand

Page #370
974.] Age.--- Old. Author of the commentary. - Sritilaka Suri, pupil of Sivaprabha Suri, successor of Cakra Suri. See No. 975. III. 4 Malasatras 333& margin only; edges of a few foll. slightly worn out; a part of the last fol. torn; condition tolerably good; the text and the commentary complete; extent of the commentary 200 slokas. Subject. The pratikramanasutras commencing with Navakara and ending with Vandittusutra together with their explanation in Sanskrit. To mention in details, the sutras are as under: " - ( 1 ) navakAra, ( 2 ) iriyAvahiya, ( 3 ) tassa uttarI, (4) anattha, ( 5 ) namutthu NaM up to jiyabhayANaM, ( 6 ) logassa, ( 7 ) suguruvandanasUtra, ( 8 ) icchAkAreNa etc. jo me devAsao aiyAro kao etc., ( 9 ) abbhuo, ( 10 ) pratyAkhyAnas such as uggae sUre cauvihaM upavAsa, porisI, purima, vigaI, AyaMbila, ekAsaNa etc., and ( 11 ) vaMditsUtra. Begins.--( text) fol. 1b Namo arihaMtANaM Namo siddhANaM Namo AyariyANaM Namo uvajjhAyANaM Namo loe savva sAhUNaM 1 icchAkAreNa saMdissaha bhagavana iriyAvahiyaM paMDikamAmi etc. -0 (com) fol. rb ahe // zrIvIrajinavareMdra vaMditvA caityavaMdanAdIni alparucisattvahetorvivariSye gamanikAmAtraM 1 ' "iha caityavaMdanAdInAM vRttirArabdhA // evaM iriyA vahIyAe || apADekaMtAe / kappai kiMci / ceIvaMdaNasajjhAyA ItyAgamAt // prathamaiyApathikIsUtrameva vyAkhyAyate / taccedaM icchAmItyAdi / icchAmi abhila khA ( pa ) | pratikramituM nivarttituM / IraNaM IrSyA gamanaM / tayuktaH paMthA IryApathaH / sUtrabhavA / airyApathikI virAdhanA etc. - na Ends. (text) fol. 16b evamahaM AloIya: niMdiya gahiya durgAcchiyaM sammaM / tiviheNa paDikkato vaMdAmi jiNe cauvvIsaM 50 iti zrAddhapratikramaNasUtraM // 11 1 This very verse occurs in Nos. 847 and 848.

Page #371
314 Jaina Literature and Philosophy [974 Ends.- (com.) fol. 16deg saMprati pratikramaNaM nigamayan parvatamaMgalamAha / evami tyAdi / evaM pratikamaNasUtramANitaprakAreNAlocya niMditvA garhitvA jugu. psitvA trividhena krAMtaH caturviMzatijinAna vaMde namaskaromItyarthaH // 50 // iti pratikramaNavivaraNaM // iti zrIzrItilakAcAryaviracitA // zlokazatadvayapramANA zrAvakapratikramaNasUtralaghuvRttiH samarthitA // par3Avazyakasatra Sa davasyakasutra.lapravRtti laguvrtti No. 975 __136. 1872-73. Size.- In in. by 4g in. Extent.-- 18 folios; 15 lines to a page ; 48 letters to a line. Description.--Country paper very thin, rough and white; Deva nagari characters; small, clear and fair hand-writing ; borders ruled in four lines in red ink; red chalk and yellow pigment used; foll. numbered in the right-hand margin only; fol. I blank ; edges:of several foll. slightly damaged; condition tolerably good; complete ; this Ms. contains the gates of the text. Age.-Pretty old. Author.-Sritilaka Suri. Subject.-A small commentary in Sanskrit, explaining some of the ___satras. For comparison see Nos. 847 and 848. Begins.- fol. 1 zrIjinAya namaH // zrIvIrajinavareMdra etc. as in No. 974. Ends.-- fol. 18 saMprati pratikramaNaM etc., up to pratikramaNavivaraNaM as n No. 974. This is followed by the lines as under : samAptaM // zrIcakramari rupaTTamahodayAdri prdyotnopmshivprmsrishissyH| / zrImApadastilakasUriradhIdhano(7)pi zrAddhapratikramaNasUtramidaM vavave // 1 iti zrItilakAcArya etc., practically as in No. 974,

Page #372
996.) 111. 4. Malasatras SaDAvazyakasUtra Sa davasyakasutra anuSThAnavidhi with Anusthana vidhi (vandAruvRtti)sahita ( Vandaruvstti ) No. 976 1235. 1884-87. Size.- II} in. by 4 in. Extent. - So folios; 16 lines to a page ; 58 letters to a line. Description.-- Country paper thin, rough and greyish ; Devanagari characters with TASTIS; small, legible and good handwriting ; borders ruled in two pairs of lines in black ink; the space between these pairs coloured red; unnumbered sides have a small disc in red colour in the centre; the numbered, in each of the two margins, too; red chalk used; fol. 1a blank ; edges of the first fol. slightly damaged ; condition tolerably good; both the text and the vitti complete. Age. - Samvat 1616. Author of the text.-- More than one saint. >> >> >> commentary.- Devendra Suri, pupil of Jagaccandra Suri, originator of the Tapa gaccha. Over and above this Vandaruvstti, Devendra Suri has composed the following works :( 1 ) Sraddhadinakstyavstti. (2)3 Karmavipaka and its svopajna 4 commentary, (3) Karmastava (4) Bandhasvamitva (5) Sadasiti (6) Sataka (7) Siddhapancasikasutravstti. 1 The scribe has noted this work as Sravakanusthanavidhi. It can be also styled as Upasakanusthanavidhi ( vide v. I, p. 336). 2. This work is quoted on p. 2 in the svopajna commentary on Karmavipaka. There it is named as Dinakstyatika. Here the page-number refers to the edition mentioned on p. 336. 3 Works 2-6 (text) are collectively known as 5 Navya Karmagranthas. They are mentioned in Gurvivali (v. 117 ) and in Gurugunaratnakarakavya (v. 40). 4. Svopajna-Karmavipaka is alluded to on p. 67 in the gvopajna commentary on Karmastava, and svopajna Karmavipakatika on p. 79 of the syapajna commentary on Karmastava as well as on pp. 164 and 183 of the svopejsa commentary on Sadasiti.

Page #373
7336 Jaina Literature and Philosophy (8) Dharmaratnaprakaranabrhadvrtti. (9) Sudarsanacaritra. (10) Caityavandanadibhasyatraya. (11) Siri-Usabha-Vaddhamanaitthava. (12) Siddhadandika. (13) Cattari-attha-dasagathavivarana. 23 According to Gurvavali (v. 147) Devendra Suri died in Samvat 1327. He must have been made a Suri in a year not earlier than Samvat 1285. Vijayacandra Suri seems to have been made a Suri after his suripada. See Gurvavali (v. 107). Subject. A number of sutras meant to be recited by a Jaina while performing the religious duties. They are explained in Sanskrit along with narratives. In this explanation 1 are quoted several gathas from the Caityavandanabhasya and Guruvandana bhasya. f Begins. (text) fol. 1 at gard etc. - For his life in Gujarati see "Prastavana" (pp. 16-20) to four Karmagranthas and their commentaries published by Jaina Atmananda Sabha, in A. D. 1934. [:976. ( com. ) fol. rb // 60 // OM namaH sarvajJAya // baMdAruvRMdArakartRdabaMrtha praNamya vIraM jitamAravIraM / upAsakAnAmupakAraheto- - vakSyAmyanuSThAnavidhi subodhaM // 1 iha tAvacchrAvakeNApi pratyahaM trIna paMca sapta vA vArAn darzanavizuddhayartha caityavaMdanAbhidheyA | etc. Ends. (text) fol. 5ob a etc., up to fato as in No. 984. (com..) fol. 5ob is mixgagPdga etc., up to Ta nachgentia as in No. 983. This is followed by the lines as under : This is based upon Brhadvrtti and Curni. See p. 342.

Page #374
977.] III.4 Malasatras 337 graM0 2728 // saM0 1616 varSe kArtika zu.1 bhaumavAsare zrI ahi. madanagara' vAstavyamahaM zrIlaTakaNabhAryApUtali zrutamahaMnAthAbhAnAyakahe jJAtAdharmakathAMgapustikA uddharitA // Reeference. The text along with Vandaruvstti is published in A. D. 1912 in the D. L. J. P. F. Series as No. 8. It' is again published with this very commentary in A. D. 1928 by Rsabhadevaji Kesarimalaji Samstha, Rutlam. The sutras given in the text of this Ms. occur in one or the other printed edition of Pancapratikramanasutras noted in No. 730. For description of Mss. having the text and Vandaruvrtti, see B. B. R. A. S. vols. III-IV, pp. 399-400. SaDAvazyakasUtra Sa davasyakasutra anuSThAnavidhisahita with Anusthanavidhi No. 977 1347. 1886-92. Size.- 101 in. by 43 in Extent.- 58 folios; 15 lines to a page ; 54 letters to a line. 1 Herein we find the followirg 27 sutras :-- (1) navakAramaMtra (p.2), (2) IpithikI (p.24), (3) tassa uttarI (p. 27), (4) annatya (p. 27), (5) praNipAtadaNDaka (zakastava ) (p. 29ff.),(6) caityastavadaNDaka (arihaMta ceiyANaM) (p. 36), (7) caturviMzatistava (p. 40), (8) pukkharavara (p. 45), (9) siddhANaM buddhANaM (p. 49), (10) veyAvaccagarANaM (p. 53), (11) jaya vIyarAya (p. 54). (12) vandanakasUtra (suguruvandana) (p. 63), (13) devasikAle canA (p:67), (14) savvassa vi (p. 68), (15) annahio (p. 68), (16) uggae sUre paccakkhANa (p. 71), (17) porisIpaccakkhANa (p. 72 ), ( 18 ) purimaTTapaccakvANa ( p. 73 ), (19) egAsaNapaccakkhANa (p. 73 ), (20) egaTTANapaccakkhANa (p. 74), (21) AyaMbilapaccakvANa (p. 74 f), ( 22 ) abbhaTrapaccakkhANa (p. 75), (23) divasacariyaMpaccakvANa (p. 76), (24) aMgusahiyapaccakvANa (p.76), (25) vigaipaccakkhANa (p.76), (26) karomi bhaMte (p.85) and (27) vaMdittu (p. 86ff). 43 [J.LP.]

Page #375
338 Description. I 977. Jaina Literature and Philosophy Country paper thin, rough and white; Devanagari characters with occasional S; very small, legible, good and uniform hand-writing; borders ruled in four lines in black ink; foll. numbered in the right-hand margin only; fol. ra blank; both the text and the commentary complete; condition very good; fol. 58b practically blank; for, only fafa etc. written on it; extent 2720 slokas. Age. Pretty old. Begins. 39 -- "" (text) fol. 1bar afgaroi etc. (com.) namo vItarAgAya // baMdAruvRMdArakavRMdavaMdyaM etc. as in No. 976. "" Ends.--(text) fol. 58a gang etc., up to practically as in No. 976. - - (com.),, kaMThyAH navaraM etc., up to varacUrNiNatazva as in No. 982. This is followed by Sar3avidha AvazyakavidhiH cha evaM graMthAgraM 2720 cha etc. N. B. For further particulars see No. 976. dw as in No. 976. wr Sa davasyakasutra with Anusthana vidhi SaDAvazyaka sUtra anuSThAnavidhisahita No. 978 Size. 10 in. by 44 in. Extent. 63 folios; 15 lines to a page; 46 letters to a line. Description.- Country paper very thin, rough and greyish; Devanagari characters with occasional ; small, legible and good hand-writing; borders ruled in four lines in black ink; red chalk and yellow pigment used; foll. nunbered in the right-hand margin; fol. 1a blank; so is the fol. 63; edges of the first and last foll. slightly damaged ; strips of paper pasted to fol. 63b; condition on the whole good; both the text and its commentary complete; extent 2778 (?) slokas. 196. 1873-74.

Page #376
979.] Age. Pretty old. Begins. dw Ends. (text) fol. 63a "9 III: 4 Malasatras (text) fol. 1 gari etc. ~( com. ) fol. rb OM namo bhagavate zrIpaMcaparameSTi // rar etc. as in No. 976.. -- e etc; as in No. 976. ( com. ) fol 634 'malparucisava etc., up to cUrNitazrva // 1 // as in No. 977. This is tollowed by the line as under :-- iti zrAvakAnuSThAnavidhiH // graMthAgraM 27278 ( ? ) // cha / ! etc. N. B.-- For additional information see No. 976. as in No. 976. 339 Sa davasyakasutra with Anusthanavidhi 405. 1880-81. SaDAvazyakasUtra anuSThAnavidhisahita No. 979 Size.-11 in. by 4 in. Extent. 50+ 1-8 + 1 = 44 folios, 15 lines to a page; 67 letters to a line. Description.-Country paper thin and grey; Devanagari characters with gears; small, clear and good hand-writing; borders ruled in two pairs of lines in black ink; the space between these pairs coloured red; red chalk used; numbers for foll. entered twice in one and the same margin, once as 1, 2, etc. and once as 703, 704 etc.; a piece of paper of the same size as the fol. pasted to fol. 1a; edges of the first few foll. more or less worn out; unnumbered sides decorated with a small circular disc in red ink in the centre; the numbered, with two more, one in each of the two margins; the 3rd fol. repeated; foll. 5 to 12 lacking; fol. 735 repeated; the last fol. numbered as 751 and 50 as well; a piece of paper of the size I Letters are gone owing to the corresponding portion of the paper worn out.

Page #377
340 Age. Seems to be old. Begins. dr Jaina Literature and Philosophy [ 979. of a fol. affixed to the last fol. extent 2720 slokas; condition fair. dr (text) fol. 1 -- ( com. ) fol. rh roi etc. 60 // zrIsarvajJAya // r etc. as in No. 976. Ends. (text) fol. 55b evamahaM Aloiya niMdiya garahiya dugaMchiyaM sammaM / tiviheNa paDikkato vaMdAmi jiNe cauvvIsaM // 50 // -- (com) fol. 51 ityevamalparuci sattvAvibodhanAya varacUrNitazva as in No. 977. zrISaDAvazyaka vRttiH saMpUrNA / graMthAgraM 2720 // N. B. For further particulars see No. 976. SaDAvazyaka sUtra anuSThAnavidhisahita No. 980 etc., up to This is followed by iti Sadavasyakasutra with Anusthana vidhi 300. A. 1883-84, Size.-- 10 in. by 4 in. Extent. 61 folios; 15 lines to a page; 48 letters to a line. Description. Country paper thin and white; Devanagari characters with Is; bold, small, legible and good handwriting; borders ruled in four lines in black ink; red chalk used; numbers for foll. entered twice as usual; the oth fol. slightly torn; on fol. 28a there is a tabular representation of the lengths of shadows in different months; foll. 41 to 43 and 50 and 51 damaged in three places; a bit of paper pasted to fol. 5oa; condition tolerably good; both the text and the commentary complete, Age. Appears to be old.

Page #378
981.] III. 4 Malasatras 341 Begins.- (text) fol. b namo arahaMtANaM etc., as in No. 979. , -- (com. ) fol. ' vRMdAruvRMdAraka etc., as in No. 976. Ends.--( text ) fol. 65 evamahaM Aloiya etc., as in No. 976. , -- ( com. ) fol. 61 ityevamalparuci etc., up to varNitazca as in No. 977. This is followed by the line as under :-- SaDvidha AvazyakavidheH // evaM graMthaM 725 // N. B.- For further particulars see No. 976. SaDAvazyakasUtra Sadavasyakasutra anuSThAnAvidhisahita with Anusthanavidhi 347 No. 981 A. 1882-83. Size.--94 in. by 43 in. Extent.-- 78 folios; 15 lines to a page ; 36 letters to a line. Description.-- Country paper thin, brittle and grey ; Devanagari characters ; bold, big, clear and good hand-writing; borders ruled in three lines in red ink and edges singly; numbers for foll. entered twice as usual ; a piece of paper of the same size as the fol. pasted to fol. 1deg and one similarly affixed to fol. 786 : red chalk and yellow pigment used; both the text and the commentary incomplete as the Ms. ends abruptly; the text goes up to the 47th verse of Vandittusutra. Age.-- Samvat 1737 Begins.-- ( text ) fol 1 namo arihaMtANaM etc., as in No. 976. ,, - ( com. ) fol. I sakalapaMDitapuraMdarapaM0zrIpazrIlakSmIvijayagaNicaraNe. bhyo nmH| praNaumi mahimAMmeyaM vAmayaM taM jgdguruN| IpsitArthapradAtAraM zrImajjIrapurI'pra // 1 // vRMdAruvRMdAraka etc., as in No. 980. Ends.- ( text ) fol. 79* mama maMgalamarihaMtA // 47 // ,, -- ( com.) fol. 79" ihApi jIvayogyatAyAM satyAmapi tathA tathA pratyUha vyUhanirAkaraNena devA api yakSAMbAprabhUtayaH samAdhibodhidAnena samarthA bhavati metAryAdirivatyaMto na nirarthakA tatprArthane. This Ms. ends thus. N. B.-- For further particulars see No. 976.

Page #379
342 Jaina Literature and Philosophy [982. SaDAvazyakasutraH Sadavasyakasutra anuSThAnAvidhisahita with Anusthanavidhi No. 982 1233 1891-95. Size.-- 104 in. by 41 in. Extent.--47- 12 - I = 34 folios ; 17 lines to a page; 54 letters to a line. . Description.--Country paper very thin, rough and greyish; Devanagari characters with pRSThamAtrAs; small, legible, and good hand-writing ; borders ruled in two lines in black ink; red chalk and yellow pigment used; foll: numbered in the right-hand margin ; fol. ra blank; this Ms. contains the text as well as the commentary; foll. I7 to 28 and 36 missing ; otherwise complete; a bit of paper pasted to fol. 47deg; edges of the first and last foll. slightly worn out ; condition tolerably good ; extent 2720 slokas. Age.-- Samvat 1469. Begins.- (text) fol. b namo arihaMtANaM 1 namo siddhANaM etc. as in No. 981. , - ( com.) fol. 1 // 6 // OM namaH zrIsarvajJAya baMdArubaMdArakavRMdavaMyaM etc. as in No. 976. Ends.-- ( text ) fol. 47 evamahaM Aloiya / niMdi0 // 50 // , -- (com.) fol. 47b. ityevamalparucisattvavibodhanAya zrAddhapratikramaNasUtravivRttireSA / kiMcinmayA prakaTitA(Da)tra tu vistarArthoM jJeyo vRhadvivRtito varacUrNitazca SaTri 4 // Avazyakavidhi // graMthAnaM // 2720 saMvat 1469 varSe ASADhasudi 2 gurau liSitaM N. B.-- For further particulars see No. 976..

Page #380
.983. j Age. -- Samvat 1524. Begins.-- ( com. ) fol. 3 SaDAvazyaka sUtra anuSThAnavidhisahita No. 983 Size.-- 11++ in. by 44 in. Extent. - 31 - 2 = 29 folios ; 21 lines to a page; 70 letters to a line. " ril. 4 Description.-- Country paper thin and white; Devanagari chara cters with occasional pRSThamAtrAs; small, clear and good handwriting; borders ruled in four lines in black ink; red chalk used; black ink used instead of yellow pigment; numbers for some of the foll. entered twice in the righthand margin ; foll. I and 2 lacking ; otherwise both the text and the commentary complete; condition very good. Ends~~ ( text ) fol. 31b I Malasatras mastiSTA ca sAdhakaM / anenApakRtaM kiM te kathaya zlathaya krudhaM // 72 // babhASe rAkSaso'pyeSa cikIrSurmA vaze ( s) ya tat / saptarAtrakSudhArttena mahAmAMsaM mayA ( S)ryate // 73 // etc. Sadavasyakasutra with Anusthanavidhi 676 1875-76. * ( com. ) fol. 6b adhunA caityavaMdanA sA tridhA // navakAreNa jahannA daMDagathuijuyalamajjhimA neyA / saMnA ukkosA vihiNA khala baMdaNA vivihA // evamahaM Aloiya niMdiya marahiya dugaMchiyaM sammaM / tiviheNa paDikkaMto vaMdAmi jiNe cauvIsaM // I 343 ( com. ) fol. 31deg sAMprataM pratikramaNAdhyayanamupasaMharannavasAne maMgalapradarzanArthamAha / This is followed by the verse noted above. Then we have : kaMThyA / nabaraM dugaMchiyaM sammaM ti / jugupsitatvAtsamyagiti // ityevamalparucisattvavibodhanAya / 'zrAddhapratikramaNasUtra vivRttireSA || This is same as Vandittusutra.

Page #381
344 Jaina Literature and Philosophy [983. kiMcinmayA prakaTitA(s)tra tu vistarArthoM jJeyo bRhadvivRtito varacUrNitazca // 1 // iti zrIzrAvakAnuSThAnavidhiH smaaptH| graM0 2720 // akSaramAtra etc. zrIzramaNAdicaturvidhasaMghazreyo'stu / saM0 1524 varSe Azvinavadi 2 mNgle| N. B.- For other details see No. 976. SaDAvazyakasUtra anuSThAnavidhi tathA TabbA sahita Sa davasyakasutra with Anusthanavidhi * and tabba 403 1880-81. No. 984 Size.- 9 in. by 4g in. Extent.--/ text ) 228 folios ; 12 lines to a page ; 36 letters to a line. ,-(tabba) , , , , , ,; 44 " "" " Description.- Country paper thick and white; Devanagari chara cters; bold, big, clear and good hand-writing ; borders ruled in two lines in red ink and edges singly; red chalk used ; yellow pigment rarely; fol. I. blank ; this Ms. contains the text, its commentary in Sanskrit and its explanation in Gujarati; a piece of paper almost of the same size as the fol. pasted to an edge of fol. 228deg; on this is written the table of contents of some of the narratives like sRgAvatIkathA, naravarmakathA etc.; the commentary furnishes us with many stories illustrating the different vows; all complete, condition very good.... Age.- Samvat I781. Author of the tabba- Devakusala. Subject. -The pratikramanasutras fora Jaina layman together with their elucidation in Sanskrit and their explanation in Gujarati.

Page #382
98.] III. 4 Malasatras Begins.-- ( text ) fol. 2' namo arihaMtANaM / namo siddhANaM etc. . ,, - (com.) fol. 5 zrIzAradAya namo namaH // - vRMdAradvaMdArakavRMdavaMyaM / praNamya vIraM jitamAravIraM // upAsakAnAmupakAraheto vakSyAmyanuSThAnAvidhi(dhi) subodhaM // 1 // etc. >> --( tabba ) fol. sa bAlAnAM suhitArthAya devAdikuzalo budhaH / vRMdAruvRttisUtrasya TabAthai liSyate mayA // vAMdavAno zIla chaI jehanUM ehave devatAiM samUhahaM vAMdyA chaI etc. Ends. - (text ) fol. 228a evamahaM AloIya niMdIya garahIa dugaMcchiya samma / tivehaNa paDikkrato baMdAmI jiNe covIsaM // 50 // , -- ( com.) fol. 228a . ityevamalparucisattvavibodhanAya zrAddhapratikramaNasUtravivRttireSA kiMcinmayA prakATatA'tra vistarArtho jJeyo bRhadvivRtito baracUrNitazca Savidha Avasyaka vitti IvaM saMgha 270020 jinasAsanAya sarvAmitmumatijJAneMdukAMtivirAjamAnasarvAgAvayavayasuMdarabhaTTArakazrIsomatilakapAda. ziSyalavena laSitamasti iti zrIvRMdArakavRtyasUtra saMpUrNa samAptaH saMvat 1781nA varSe jeSTa mudi 13 ravau vAre sakalapaMDitazrI108pradharakavi. kulAlaMkAramugaTAmANapaMDitazrIsaMghacaMdragaNiziSyapaMDitazrIlAlacaMdragANatavaziSyapaM maMgaladagaNicelAmANakacaMdapaThanArthe cIraMjIvI // zrIgoDIjI prasAdAt zrI pattanna'nagare / - (tabba ) fol. 228dege cha prakAra Avazyakano vidhi kahio graMthAna 270020 / TabArthena kRtA buddhe devakusalena liSitA paM.devakusalena 'jIrNadurga'madhye sUtraTabAthai kRtyate saMvatsaMjamasararasa( 1756 )mite hi varSe sumAghasite pakSe dazamIzuM ravau pUraNau liSitaM 'jIrNadurage'(7)smin 'velAula baMdare graMthAgraMtha sarva malIne 3250 , jI / jehabuM dIDhaM teha laSyu che / ____ iti zrIvRMdAruvRttasUtraTabo saMpUrNa samAptaH paM0maMgalacaMdreNa laSitaM gaNimANakacaMdapaThanArtha // N. B.-- For additional information see No. 976. 44 [J.L.P.1

Page #383
346 Jaina Literature and Philosophy SaDAvazyaka sUtra eggrafafa tathA TabbA sahita No. 985 Size. 10 in. by 4 in. Extent. (text) 181 folios; 7 lines to a page; 34 letters to a line. -(tabba),, dr 39 dr ; "2 "2 "" Description. Country paper tough and white; Devanagari characters; this Ms. contains the text as well as the tabba; the former written in a very big hand whereas the latter in a very small one; legible and tolerably good hand-writing borders ruled in three lines and edges in one, in red ink; red chalk used; yellow pigment, too; foll. numbered in both the margins as usual; foll. ra and 181b blank; fol. 126th wrongly numbered as 125 in the right-hand margin; similar is the case with fol. 179th; the text, the tika and the tabba complete; extent 2700 slokas. dr Sadavasyakasutra with Anusthanavidhi and tabba upAzakAnAmupakArato Ends. (text) fol. 179b dw rw z dr [985. dr Age. Samvat 1801(?). Author of the tabba-Pandita Devakusala. See No. 984. Subject. The text and a Sanskrit commentary to Sadavasyakasutra together with an interlinear explanation in Gujarati. Begins (text) fol. 1 a garoj etc. 22 Y -- ( com. ) fol. r // 60 // zrIgurubhyo namaH Zanzarazza praNamya vIraM jitamAravIraM fagraggianafa gari etc. - ( tabba ) fol. 1 // 60 // zrIgurubhyo namaH // anoni sitariu Jaritgadi gu: vRMdAruvRttisUtrasya bArtha laSIte mayA 1 etc. 769 1875-76. evamahaM Aloiya nadiya garIhIya durgacchIya savaM tivINa paDIkaMto | vaMdAmi jaNe couvIza 50

Page #384
986.1 iii. 4 Malasatras Ends-- ( com. ) fol. 1798 navara dugaMdhiya zammaM ti jugupsitvA samyagatiM ityevamalparucisattvavibodhanAya zrIzrAddhapratIkramaNasUtravRrtireSA kaMcinmayA pragaTitA atra vIstaratArathe jJeyo vRhadvivRtito varacUrNitava || "" 347 -- ( tabba ) fol. 179deg Sadva AvazyakavRtti idaM saMbaMdhaM paM0 devakuzaleNa bArthataM paropakArAyaH // graMthAgraMtha zloka sakhyA satAvIse 2700 viza 20 // zlokasaMkhyA kRtaM // iti zrIvRMdAravRtagraMtha samAptaM sapUrNa bhavati // saMvata 1801 mUnA varSe vesASavada 13 dine vArabudhe nakSatra azvani yoga sobhAgya paMcamo 5 dRSTikaraNe kRSNapakSe uSNamAse || zrIzejayakara mokSyanAdya aneka zukratakAraka mahoupAdhyAya zrI zrI 19 zrI bhAnucaMdragaNI tataH sIdhyapaMDitazrIzrI zrI bhAva caMdragaNI tatzISyapaMDitazrI zrIkanakacaMdragaNI tataH sISyaitsar kapUracaMdragaNI tatziSya paMDita zrI 5 zrI mayA caMdragaNI tatzISyapaMDitazrIbhakticaMdragaNI tatziSya paM. zrIudayacaMdragaNI tatzISagaNI uttamacaMdalapIkRta Atamai paThanArthaM / zrImahAvIraprasAdAt zrI' DIsA 'nagare zrIrastu kalyANamastu // yAdrIsaM pustakaM..... jatnena parIpAlayet 3 fol. 180deg e chae prakAre Avazakano vidha kahIu chiM || e zaMbaMdha vRMdAravRtano paM. devakuzale TabA'rthanI racanA karI chi || pArakA upagArani hete karI chiM graMthAgraMthazlokasaMkhyA 2700 viza 20 zlokanI e zaMSyA kRtAM iti zrIvRMdArasapUrNa samAptA saMpUrNa bhavati saMvat 1812 nA varaSe jeSTha zuda 2 dane vAra cAme laSu puru bhayo chi sahI // vRta anuSThAna vidhi (vandAruvRtti) No. 986 Size. 101 in. by 48 in. Extent.-- 48 folios; 17 lines to a page; So letters to a line. Description. Country paper thin, rough and white, Devanagari characters ; small, legible and good hand-writing; borders ruled in three lines in red ink; yellow pigment used; foll. numbered in the right-hand margin; this Ms. contains mostly the safes of the text; complete; edges of the first and last few foll. slightly worn out; condition tolerably fair ; extent 2720 (?) slokas. Anusthanavidhi (Vandaruvrtti) 641 1884-86.

Page #385
388 Jaina Literature and Philosophy [987 Age.- Pretty old. Author.-Devendra Suri. For details see No. 976. Subject.-An explanation of Sadavasvakasutra. Begins.-- fol. 10 // ja0 // OM namaH zrIsarvajJAya dAruvadArakavaMdayaM praNamya vIraM jitamAravIraM / / / upAsakAnAmupakAraheto vakSyAmyanuSThAnavidhiM subodhaM // 1 // etc. Ends.-- fol. 486 ityevamalparucisattvavibodhanAya zrAddhapratikramaNasUtravivRttireSA kiMcinmayA prakaTitA / a(s)va tu vistarArtho bRhaTTattito varacUrNitazca jJeyaH // cha / iti SaDvidhAvazyakavidhiH samAptA // cha / graMthAgaM 720 (2)||ch / zubhaM bhavatu // cha / Reference.- Published. See No. 976. SaDAvazyakasUtra Sa davasyakasutra vandAruvRttyavacUrNi with Vandaruvrttysahita avacurni 1346 No. 987 1886-92. Size.- IoT in. by 41 in. Extent.- (text) 22 folios; s lines to a page ; 28 letters to a line. ___ , -(com.) , , ; 16 ,, ,, ,, ; 44 , ,,, Description.- Country paper thin and greyish ; Devanagari cha racters%3 bold, clear, big and good hand-writing%3; borders ruled in four lines in black ink and edges in two in red ink; this is a pazcapATI Ms. ; red chalk used ; yellow pigment, too%3; ___fol. I blank; a small strip of paper pasted to fol. 103; edges of the first and the last foll. worn out; condition fair; the text and its commentary complete so far as they go. - It appears that this line should be as under: "zeyo bRhadvitito paracUrNitazca"

Page #386
988. 1 Age.-- Pretty old. Author of the avacurni. -- Not mentioned. ill. 4 Malasatras Subject. The text along with a small commentary on Devendra Suri's Anusthanavidhi alias Vandaruvrtti. -- Begins.-- ( text ) fol. 1 namo arihaMtANaM etc., as in No. 981. dr - - ( com. ) fol. 1b iha tAvadAstikenApi nityaM trIn vArAn sapta paMca vA vArA (na) darzanazudadhyai caityavaMdanA vidheyA / yadAha sAhUNa satta bArA ityAdi / etc. Ends.~~ ( text ) fol. 22b evamAloiya etc., up to iti zrAddhapratikramaNasUtraM. This is followed by the lines as under :-- aDDhAijjesu dIvasa mudde paMnarasa kammabhUmIsa etc. akkhayAyAracaritA te savve sirasA maNasA matthaeNa vaMdAmi // cha // ( com. ) fol. 22b ityevamalparucisattvAvibodhanAya / $49 zrAddhapratikramaNasUtravivRttireSA / kiMcinmayA prakaTitA'tra tu vistarArtho / jJeyo bRhadvivRtito varacUrNitava / the iti zrIdeveMdrasUriSkRtavRtteravacUrNiH samAptA / This is followed by comments on the concluding verse which arun as under : SaDAvazyaka sUtra vRttisahita No. 988 manasA aMta:karaNena mastakena baMde bAcA vaMde iti kriyApadamAvRttyA yojyaM / ityavacUrNi ( : ) pratikramaNasUtrANAM / N. B. For further particulars see No. 976. Sadavasyakasutra with vrtti 1234. 1884-87. Size - 11 in. by 4g in. Extent. -- 133 folios; 14 lines to a page ; 62 letters to a line.

Page #387
350 faina Literature and Philosophy 1988. Description.- Country paper thin, rough and greyish ; Devanagari characters with occasional pRSThamAtrAs; small, clear and good hand-writing; borders ruled in four lines in black ink; red chalk used ; a piece of yellowish paper pasted to foll. 1* and 1335; edges of some of the foll. slightly worn out; condition tolerably fair ; foll. numbered in both the margins; in the left--hand margin in a big hand and in the right-hand one in a small hand just at the foot of the fol. ; so, in some cases the numbering is worn out; this Ms. contains the text as well as its explanation with the colophon ending abruptly. Age.- Pretty old. Author of the commentary.- Tarunaprabha (c. Samvat 1411). Subject.- Salavasyakasutra together with its explanation in Gujarati. Several quotations in Prakrit enhance the importance of this explanation. At times narratives are given with a view to elucidate some of the topics. The text starts with Navakara and ends with Vandittusutra. Begins.--(rext) fol. 6. namo arahaMtANaM namo siddhANaM etc., as in No. 979. / ,, --(com.) fol. I' arha // zrIgautamasvAmine namaH // murAsurAdhIzamahIzanamyaM praNamya smygjinraajviirN| subodhamartha dinakRtyasatkaM likhAmyabuddhipratibodhanAya // 1 paDhamaM nANaM tao dayA evaM cii svvsNjue| annANI kiM kAhI kiMvA nAhI cheya pAvayaM // 2 pahilau jJAnutanu pAchai dayA jIvaM viSai kRpA evaM iNi krami ciTTai / kisau argha rahai / kauNa rahai guNazreNi isau A pahe jANivau / kauNa mAhiM sabasaMjae / / saMjao duviho sabasaMjao sAha desasaMjao sAva o| savvasaMjatahI mAhi desasaMjatahI maahi| annANI kiM kAhI kiMvA nAhI cheya pAvayaM vi / ajJAnu kiM kariSyati / kiM sau karisihi / kiMvA jJAsyati / athavA kisau jANisii / cheu puNyu / pAvayaM pApu / iti / supuNi jJAnu yogya rahaI dIjai / ayogya rahana dIjai / jogya zuzrAvaka * aha mAhi ekavIsa guNa huyii||

Page #388
988.1 111. 4 Malasairas dhammarayaNassa juggo akkhudo 1 rUvayaM 2 pagaisomo 3 logapio 4 akUro 5 bhIrU 6 asaDho 7 sadakkhinnU 8 lajjAluo 9 dayAlU 10 majjhatyo 19 somadiTTi 12 guNarAgI 13 sakkaha sapakkhajutto 14 sudIhadasI 15 visesannU 16 buTTANuo 17 viNIo 18 kayantuo 19 parahitthakArI 20 ya / tahaceva laddhalakkho 21 igavI saguNo havai saDDho || dharannu samasta samIhita dAna tara ciMtAmaNi / dharmmarantu teha rahaiM yogya adhikArI va saDDo / isau chehilau paduIhA joDiyai | sahadu zrAvaku huyaI etc. Ends. (text) fol. 133a " evamAloiya niMdia etc., as in No. 976. -- (com) fol. 133 deg isI pari AloIya sakalAticAra guru Agai prakAzI karI niMdI karI garahI karI duggaMchI karI bhAvasuddhipUrva / tiviheNa paDikkato iti / trividha mani vacani kAyi karI pApa hUMtau pratikrAMtu nivarttiGa hUMtau baMdAmi jiNe cauvvIsaM // caDavIsa jiNa // RSabhAdika varddhamAnAvasAnavarttamAnacavIsa saMsthAna vAdauM namaskarauM / / 50 iti zrIzrAvakaprati kramaNasUtra vivaraNaM samAptaM // cha // zrIH // cha // 50 // jayati 'caMdra'kulaM subhasaMkulaM kuvalayojvalannaika kalAkulaM / gurucakoravaravrajamaMjulaM / vimalako malagokamalAkulaM // 1 yaH staMbhanAdhIzvarapArzvanAtha prasAdamAsAya navAMgavRttiM / labdhA babaMdhe kimatra citraM / so'trAjaniSTA'bhayadevasUriH // 2 tadIyapAdayapadmasevA madhuvrataH zrIjinavallabho'bhUt / yadaMgaraMge vrata narttanena kiM nRtyatAkIrttidhanaM na lebhe // 3 tatpaTTazaile(s) jani yogarAjaH sunataH zrIjinadattasUriH / tatiSaccaika udaitkalAvAn vinA kalaMkaM jinacaMdrasUriH // 4 ziSyo'sya jajJe jinapatyAbhikhyaH 35% pravAdinAgeMdrajaye mRgeMdraH / jinezvarAkhyo (S) sya babhUva ziSyaH - prabhAvanodbhAvanasiddhirAmaH // 5 See Viyaralava (pp. 86-87) of Pradyumna Suri.

Page #389
152 Jaina Literatore and Philosophy [988 jinaprabodhAbhidhasUrirAsI() ttpdrpuurvaaclcNddbhaanuH| pade tadIye jinacaMdrasAra___rasUnmanobhUjayakAramUrtiH // 6 yeSAM yugapradhAnAnAM prasadya padadaivataM / dakSiAciMtAmaNI mahyaM jJAnatejasvinI dadau // 7 pitRbhyo(s)vyativAtsalyaM yenAdhyAyitarAM mayi / yaza-kIrtigaNirmA sa pUrva vidyAmabhANayat // 8 rAjeMdracaMdrasUrIMdrarvidyA kAcana kAcana / jinAdikuzalAkhyaizca dApyAcAryapadaM ca me // 9 aMbhokUNya( ? )karaMdabiMdunikarAllAtvA yathA SaTpadaH / __svAM vRttiM tanute tathA zrutakaNAnAdAya ruccaiH pdaiH|| sUriH zrItaruNaprabhaHpramitaye mugdhAtimugdhAtmanAM / poDhA(55)vazyakasUtravRtti vyAliSa............padaM // 10 yanmithyA()bhidadhe mayA matimahAmAdyAdasamyakpade / vyAkhye pAdathavA tadatra sudhiyA saMzodhya nirmatsarAH / vyAtatvaM tathetikAM gatadhiyo niHsNshyaanaa......| ... ... ... ... ... ... ... // 11 ....... zedhanadIdhite...kRte vivRteryadupAjayaM / upacitaM sukRtaM sukRtepsitaM ...... bhavI ... Reference.-Extracts from Tarunaprabha Suri's Sadavasyaka. balavabodhavrtti composed in Samvat 1411 are given by Kalyanavijaya in his article "paMdaramI sadImA bolAtI gujarAtI bhASA". These extracts are published on pp. 54-55 of "chaTTI gujarAtI sAhitya pariSadake ahevAla ane nibaMdhasaMgraha" in A. D. I923. For a Ms. having the vstti given here see Limbdi Catalogue No. 2664. This Ms. is written in Samvat 1419 and as such it is very important. SaDAvazyakasUtra Sa davasyakasutra avacUrNisahita with avacurni 853 No. 989 1892-95. Size.-- Iot in. by 4t in. Fxtent.-(text) 8 folios; II lines to a page; 38 letters to a line. , -(com.), , , 31 " ," , 56 , ,, ,

Page #390
989.] III. 4 Malasatras 393 Description.-Country paper very thin and white; Devanagari characters with pRSThamAtrAs; this is a paJcapATI Ms., containing the text as well as a small commentary; the latter written in a very small hand ; legible, uniform and good handwriting ; borders pertaining to the text as well as those regarding the commentary ruled in three lines in red ink; red chalk used : foll. numbered in the right-hand margin only; edges of some of the foll. slightly damaged; condition tolerably good; both the text and the commentary complete. Age.-- Old. Author of the commentary- Not mentioned. Subject.- This Ms. contains a number of sutras in Prakrit together with their explanation in Sanskrit. Some of the sutras are as under : (1) navakAramantra, (2) praNipAtasUtra, (3) iriyAvAhiya, (4) tassa uttarI, (5) annattha, (6) namutthu Na (styled as the last sutra of the second adhikara), (i) arihaMtaceiANaM, (8) logassa ( styled as the Ist sutra of the 4th adhikara), (1) puksa ravara, ( styled as the Ist sutra of the 6th adhikara), (10) siddhANaM buddhANaM ( styled as the Ist satra of the 9th adhikara), (II) veyAvaccagarANaM, (12) jAvaMta ke vi sAhu, (13) uvasaggaharaM, ( 14 ) jaya vIyarAya, (15) icchAmi etc. aNujANaha (suguruvandanamUtra), (16) devasikAlocanAsUtra, (17) anbhuTrio and (18) vittapatra. Begins.- (text) fol. I* namo arihaMtANaM etc. - (com.) , 1 iha caityavaMdanAdarzanazuddhayartha tathA vaMdanakaM guruNAM guNavatpratipanneyaM AvazyakaM sarvAticAravizuddhayarthe hiravazyamanuSThIyate / etc. Ends.- ( text ) fol. 80 .. evamahaM Aloiya etc. up to cauvvIsaM // 50 // This is followed by the line as under : iti zrAvakapratikramaNasUtraM saMpUrNa // cha metc. --(com.) fol. 8 45 [J.L.P.1

Page #391
354 Jaina Literature and Philosophy [9882 ityevamalpacisattvavibodhanAya : ....... zrAddhapratikamaNasUtravivRttireSA kiMcinmayA prakATatA( 5 ) nu(tu ) vistarArthoM ...' jJeyo bRhadvRtitorava (bara)cUrNitazca // ch|| iti zrAddhapratikramaNasUtrAvacUrNiH samAptaH // cha / padAna ... .... .... SaDAvazyaka ...... ....... ' SadavasyakasUtrAvacUri sutravacuri 765. No. 990 .. ......... ...... 1892-95.1 Size,-9. in. by 41 in. Extent.- 32 folios ; 18 lines to a page ; 52 letters to a line. Description.-Country paper thin, rough and white: Devanagari characters with occasional ASIS ; small, legible and good hand-writing: borders ruled in four lines in black ink; - red chalk used : foll. numbered in both the margins%3; fol. ta blank so is the fol. 32b; 'this Ms. contains the gates (.. . of the satras; the last fol. slightly worn out; condition ...... good; complete; extent 2001 slokas. ... Age.- Samvat I622. Author:- Not mentioned. .. Subject.- A small commentary in Sanskrit explaining the prati ir kramanasutras beginning with Navakara and ending with ...... Vandittusutra. . Begins.- fol. !" ahe // i tAvat zrAvakeNApi pratyahaM trIna paMca sapta vArAn darzanavizuddhayartha caitya: vaMdanA vidheyA yadAhuH // sAhUNa satta vArA / hoha ahoracamajjhayAraMmi / gihiNNA puNa ceivaMdaNa / tiya paMca satta vA vArA // 1 // tathA vaMdanakaM cASTa kAraNAnyAzritya guNavatpratipattaye ga(gurUNAM dAtavyaM / tathA sarvAticAravizuddhayartha pratikramaNaM cobhayakAlaM avazyamanuSTheyamiti / tatra caitatsarvamapi / anuSThAnaM sAkSAdeva gurvbhaavo| sthApanAcArya / sthApanApUrva

Page #392
990 111. 4 Malasatras .. -.. "kameva vidheyaM / yadAhuH duHkhamAMdhakAra sNsaarnimgnjinbhdrgnnikssmaashbhnnpaadaadaaH)|| gurudhirahami ya ThavaNA / guruvaesovadaMsaNatthaM ca / jiNavirahami vi jiNabiMbaM sevaNAmaMtaNaM sahalaM // 1 ranno pi parukkhassa vi / jaha sevAmaMtadevayAe vaa| __ tahaceva rukkhassa vi / guruNo sevA viNayaheU // 2 sA ca namaskArapUrvikaivetyataH sa evAdau vyAkhyAyate / iti tatsUtra cedaM namo arihaMtANamityAdi / namo namaskAro arhadbhayaH zakrAdikRtAM pUjA siddhiMgati ....."vA ahaMtIti arhataH tebhyaH yathA / etc. . Ends.- fol. 324 saMprati pratikramaNAdhyayanamupasaMharana(na)nuttarottaradharmavRddhayarthamaMtya maMgalamAha // evamahaM AloIya ityAdi vyAkhyA // eva(ba) prakAreNAI samyagAlocya guronirvevya(?) niMditvA duSTakRtamiti svamakSaM gArhatvA tadeva gurusamakSaM jupsitvA dhiggAM(gmA) pApakariNaM ityAdinA samyagiti sarva yojyaM / dugaMchiyaM iti pATe tu ebamAlocya tA (?) niMditvA garhitvA jugupsitaM duzcikitsitaM vAcicArajAtaM / samyag trividhana manobAkAyalakSaNena pratikrAMtaH sakatAt) iti pratikramaNazcaturviMzatijinAn vaMde iti gaathaarthH||50|| iti pratikramaNavaMdanakasUtrAvacUri samAptaH // cha / tailAdrakSejjalAdrakSe / rakSeta zithilabaMdhanAt / parahastagatA rakSet / evaM vadati pustikAH // 1. adRzyadoSAn mtivimrmaacc| pramodito vA galitaM yadi syAt / .. yAvaryaH parizodhanIyaM / prAyeNa muhyati hi leSatAraH // 2 // yAdRzaM pustake dRSTaM etc. 3 graMthasyeva pramANastu / zlokasahasradvayaM pi c| prAyaH graMthasya vAcogmi / kartA puruSeNa veditA // 4 // graMthAna 2001 // zubhaM bhavatuH // zrIrastuH // kalyANamastuH // saMvat 1622 varSe kArtika zudi 8 gurau 'jhalutarAgrAme / municelAratnasaMyamamuniliSitaM / svahitArthAya vAcA(ca)nArthe pramAdaM vihAya sampagbhAvena ityaadrbhilkhitaastiH|| cha / klyaannmstuH|| .. prAyeNa muhAta

Page #393
356 Jaina Literature and Philosophy [991 paDAvazyakasUtra Sadavasyakasutra avacUrNisahita with avacurni No. 991 1306 1891-95. Size.-- 104 in. by 41 in. Extent.-- (text) 23 folios ; 7 lines to a page; 40 letters to a line. --(com.), , ; 10 , ,, ,, ; 45 , ,, , Description.- Country paper thin and greyish ; Devanagari cha racters with pRSThamAtrAs; bold, big, clear and good hand-writ_ing; borders ruled in four lines in red ink ; this is a tripATI Ms.; it contains both the text and the commentary; the text written in the middle and in a bigger hand; fol. 19 blank; fol. 23deg is also blank except that the title is written on it; edges of the first fol. slightly damaged ; red chalk and yellow pigment used; the text and the commentary complete so far as they go ; extent 1000 slokas; condition tolerably good. Age.-- Pretty old. Author of the text-More than one saint. , ,, com.- Not mentioned. It may be Devendra Suri,in case this commentary is really the same as Vandaruvstti. Subject. This work deals with the following sutras which are to be recited at the time of performing a religious function viz. pratikramana. (1) navakAramaMtra, (2) iriyAbahiya, (3) tasma uttarI, (4) annattha, G) namutthu NaM, (6) arihaMta ceiyANaM, (7) logassa, (8) pukkharavara, (7) siddhANaM buddhANaM, (10) jAvaMti ceiyAI, (II) namo'haMta , (12) (13) uvasaggaharaM, (14) jaya vIyarAya, (15) saMsAradAvAnala, (16) jagAciMtAmANa, (17) suguruvaMdana, ( 18 ) devasia Alou, (19) savvassa vi (?), (20) anbhuTrio, (21-30) dasa paccakkhANa, (31) atIcAragAthA, (32) karemi bhaMte, (33) vaMdittu (zrAddhapratikramaNamatra ), (34) Ayariya uvajjhAe, (35) zrutadevatAstuti, (36) namo'stu barddhamAnAya, (37) barakanaka and (38) vizAlalocana.' These sutras are briefly explained in the avacurni. 1 Thus the text contains some more sutras than what we find in the printed edition containing the Vandaruvstti and its text.

Page #394
.... .. 99r: ..111. 4 Mulasatras . . 37 Begins.r- (text) fol. 1 // 6 // namo arihaMtANaM / namo siddhANaM namo aayaaryaannN| namo ubajhA. yANaM / namo loe savvasAhUNaM / eso paMca namukkAro savvapAvappaNAsaNo / maMgalANaM ca savvesiM paDhamaM havaha maMgalaM / / / 3 Il etc. - (com.) fol. I" 60 // nmo'hNdbhyH| vaMdArubaMdArakavRMdavaMdyaM / praNamya vIraM jitamAravIraM / ... upAsakAnAmupakAraheto. vakSyAmyanuSThAnavidhi saboghaM // 1 // etc. Ends.-- ( text ) fol. 22* evamahaM Aloiya nidia gI(ga )ri( ra )hiya (u)duggAMchiya( yaM) s(sN)mN| tiviheNa paDikkato vaMdAmi jiNe causiM / / 50 // iti shraaddhprtikrmnnsuutr| , -(com.) fol. 220 nivedaM gatvA samyag zuddhyA trividhena manovAkAyAdinA prati 0 // pramA dAdikRtAnivRtta san vaMde aMtyamaMgalamiti // 50 // ........ . iti zrAvakapratikramaNasUtrAvacUrNiH smaaptaa| ,, - ( text ) fol. 230 kalaMkanirmuktanamuktapUrNataM kutarkarAhuyasanaM sadodayaM / ko apUrvacaMdra jinacaMdrabhASitaM ___ dinAgame naumi budhainamaskRtaM // 3 // , -( com.) fol. 23 kutarkarAhu grasatIti kutrkraahugrsnH|| 3 // cha / shrii| etc. m001000| Reference.- The text is published. See No. 976. For description of a Ms. having Salavasyakasutra and avacuri. see B. B. R. A. S. vols. III-IV, p. 400. Here it is said that this avacuri "begins like the Vandaruvstti and is probably based on it. It does not contain the kathas". saNasatrAvacUNi samAtA' . ..

Page #395
358 SaDAvazyaka sUtra avacUrisahita No. 992 Jaina Literature and Philosophy Size. 10 in. by 48 in. Extent. (text) 10 folios; 8 to 10 lines to a page; 35 to a line. ,, - {com.),, to a line. Description. "" dr ; 14' Begins. ( text) fol. 1 // 50 // ahe // 39 "" 33 33 1997 Sadavasyakasutra with avacuri 195. 1873-74. namo arihaMtANaM 1 namo siddhANaM 2 etc. Ends.--(text) fol. 1ob Country paper thin, rough and white; Devanagari characters with occasional TS; this is a q Ms.; very small, clear and good hand-writing; borders of one! side ruled in four lines and those of the other side in two in black ink; red chalk used; yellow pigment, too; foll. numbered in the right-hand margin only, and that, too, just in a lower corner; both the text and its commentary complete; condition good, though some of the foll. have their edges slightly damaged. 5 to 40 letters Age.- Samvat 1491. Author of the avacuri.- Not mentioned. Subject. The text together with its explanation based upon Vandaruvrtti. 2 48 ; dr ( com. ) fol. rr * // 60 // iha tAvakenApi nityaM trIn sapta paMca vArAn darzanazuddhayai caityavaMdanA vidheyA etc. ** evamahaM Aloia niMdiya garihiya durgAchiu samaM tiviheNa paDikkato vaMdAmi jiNe cauvIsaM // 50 // 40 iti sUtraM ( com. ) fol. rob iti zrI deveMdra sUrikRtavRtteravacUriH / saM0 1491 varSe 'tapA zrI somasuMdara sUriziSyamunikIrtinA'lekhi || zubhaM // LONG A I-2 There are 25 lines with 20 letters in each line so far as the marginal por. tions at econcerned.

Page #396
993:] ill. 4 Malasutras 359 baDovazyakasUtra Sadavasyakasutra avacUrisahita... with avacuri No. 993. 132. 1873-74. Size.-- 108 in. by 45 in. Extent.- (text ) 12 folios ; 23 lines to a page ; 28 letters to a line. , - ( com.),, , , , , , , , . , ,,,,, Description.- Country paper thin, rough and greyish ; Devanagari characters; this is a pazcapATI Ms.; it contains the text as well as the commentary; the former written in a slightly -- 'bigger hand ; borders ruled in four lines in black ink; yellow pigment used; foll. numbered in the right-hand matgin; edges of some of the foll: worn out; condition 8 tolerably good; complete up to Sakrastava. Age.- Samvat 1684. Author of the avacuri-Not mentioned. Subject.-The Ms. starts with Navakarasutra and ends with Sakra .. stava which is preceded by pratyakhyanasatra. .. . , Begins.-- ( text ) fol. I 60 // namaH zrIpravacanAya / __ namo arihaMtANaM etc. , - (com.) fol. I" // 6 // .. Adau sUtralakSaNaM nirUpyate / etc. Ends.- (texty fol. 12" iti zakastavaH saMpUrNaH // 2 // kalyANaM bhavatu // shrii||shrii .. -( com.) fol. 12. tato(s)naMtaraM trikAlavartidravyAhavaMdanArthamimAM gAthA pUrvAcAryAH paThati / je ai sAdi sugamA dvitIyo(s)dhikAra | prathamo daMDakaH ||ch / saMvat 1684 varSe pAsamAse zuklapakSe caturdazyAM tithau vRhazapati / 'sItA'nayaramadhye liSiteyaM SaDAvazyakasya vRttiH kalyANaM bhavatu leSaka- pAThayoH zrI ||shrii / / 1-2 These numbers refer to a column.

Page #397
360 SaDAvazyaka sUtra (?) avacUrisahita "3 No. 994 Size.- 10++ in. by 4g in. Extent. -- ( text ) 3 folios; 14 lines to a page; 52 letters to a line. - ( com.),, ; 13 ;80(?) Description.-- Country paper very thin, rough and white; Deva nagari characters with pRSThamAtrAs; this is a paJcapAThI Ms.; the text and the commentary both written in a smaller hand ; the latter in a very very small hand; quite legible, uniform and good hand-writing; borders ruled in three lines in red ink; red chalk used; foll. numbered in the righthand margin; edges of each of the foll. slightly damaged ; condition tolerably good; both the text and the commentary complete so far as they go. "" Jaina Literature and Philosophy " Age.-- Old. Author of the avacuri - Kulamandana. Ends. -- ( text ) fol. 3 "" " cha // cha // [994. Sadavasyakasutra ( ? ) with avacuri 1 See p. 353. "" Subject. The text together with its explanation in Sanskrit. Begins (text) fol. 1 || 6 || namo arihaMtANaM etc. 123. 1873-74. "" com. ) fol. r // 60 // namo jinAgamAyeM // iha caityavaMdanAdarzanAzuddhyartha tathA vaMdanakaM gurUNAM guNavatpratipattaye tathA AvazyakaM sarvAticAravizuddhayartha dviravazya manuSThIyate / ' etc. aNimUhiabalavirio parapakar3a jo jahuttamAutto kui a jahAthAmaM / nAyavvo vIriAyAro // 8 ityatIcAragAthAH // cha // "" wr - ( com. ) fol. 3 iti zrIguruvaMdanakA'cUri zrIkulamaMDanasUrikRtA

Page #398
995.] III.4 Malasutras 361 SaDAvazyakasUtra - Salavasyakasutra bAlAvabodhasahita with balavabodha No. 995 254. 1871-72. Size.-10 in. by 4 in. Extent.-54 folios ; 14 lines to a page ; 42 letters to a line. Description.- Country paper tough and white; Devanagari cha racters; big, legible and good hand-writing, borders ruled in three lines and edges in one, in red ink ; foll. numbered in the right-hand margin only ; fol. 1 blank; this Ms. contains the text as well as its explanation in Gujarati; the text almost complete so far as it goes ; condi tion very good ; the text at times written in a bigger hand. Age.- Not quite modern. Author of the balavabodha.- Not mentioned. Subject.- This Ms. contains various sutras beginning with Nava kara and ending with Samsaradavanalastuti and Javanti ceiyaim. These sutras are explained in Gujarati. Begins.- (text ) fol. 1deg 5 60 // zrIpArzvanAtho vijayate / / __ namo arihaMtANaM etc. ,, - ( balan ) fol. // 6 // // zrIgaNezAya namaH zrIgurubhyo namaH // etc. Ends.- (text) fol. 540 jAvaMti ceiAI uDDe a ahe atirialoe a savvAiM tAI vaMde ia saMto tattha saMtAI1 , -( balan ) fol. 54deg Urdhva lokane viSe adho lokane viSe tiria lokaneM virSe puna arthe te sarva jinabiMba prataI bhAvasahita vAdauM huI ihAM rahyo thako tihAM je sthAnaka Agali kahIsya tihAM rahyA je caitya zAsvatAM azAzvatAM teha prateM vAMdara Reference.-- For a Ms. having the text containing some of the sutras above noted and a balavabodha in bhasa see Keith's Catalogue No. 7495. 46 [J.L. P.]

Page #399
362 Jaina Literature and Philosophy [996. SaDAvazyakasUtra Sadavasyakasutra TabbAsahita with tabba No. 996 1289 1886-92. Size.--98 in. by 4g in. Extent.-- (text) 18 folios ; 6 lines to a page ; 38 letters to a line. ..., -- (tabba) , , , , , , , , , 64 , ,,, Description.- Country paper thin, rough and white; Deyanagari characters; the text written in a bigger hand and the interlinear tabba in a smaller hand; legible and tolerably good hand-writing ; borders ruled in two lines and edges in one in red ink; foll. numbered in the right-hand margin only; fol. 1a blank; so is the fol. 186; condition very good; complete. Age.-Samvat 1824. Author of the tabba.-- Not mentioned. Subject.--Some of the sutras in Prakrit along with their explanation _in Gujarati.. Begins.- (text) fol. 1 // 6 // paMDita // cakricUDAmaNIzrIzrI108zrItilaka vijayajIprazAdAt // shrii|| namo arihaMtANa 1 namo siddhANaM / 2 etc. ,, - (tabba ) fol. 1 paMDittazrI108zrIjIvavijayajI tazikSazrI 105. zrIpremavijayajI tazikSazrIpatilakavijayajIprazAdAt // 6 // // namaskAra mAharo zrIarihaMta viharamANanaI hau namaskAra siddhi rahi huu mAharau namaskAra zrIAcAryagurunai huu etc. Ends.- (text) fol. 18 jaivi paDilehaNAe heU jIyarakkhaNANAya . taivi imaM maNamakaDa nijaMtaNachasuNIchitti 5.. . .... iti muhapatIpaDilehaNamAthA saMpatta 1824 miti posa suda 6 nIze zanIvAreNa liSataM puzrI108zrItilakavijayajI tazikSakapUravijayalapIkRtaM 'pIpADa'madhye // zrIzrI108zrIvijayazenAvattitatreNa zrImastu leSapAdvacanam

Page #400
997.] III. 4 Malasutras 363 - ( tabba ) fol. 184 vizrI 108 zrIzrIzrIzrIvijayazenarike iti muhapatipaDilehaNagAthA jAMNavI jatarphe // liMSatu zrI 108 zrIbija senasareNa tatzrI105 zrI vijaya tatzrI103 zrIama vijaya tatzrI saM. 1824 miti mAghavade 14101 zrI amRtavijaya tatbhI 101 lakSmIvIjaya tatzrI37zrIjivavijayajI tatzrI 35 zrIpremavijayajI tatzrI 35zrItilakAvajayajI taziSya liSatAM paM0 kapUra vijayena 'pIpADa madhye zubhavelAyaM kalaMNamastu zrI // mAhArAja zrI 108 vijayidhajIrAjeNaM lapIkRta zrIma " SaDAvazyakasUtra bAlAvabodhasahita Sadavasyakasutra with balava bodha No. 997 Size.-- 9++ in. by 42 in. Extent.-- 71 folios; 15 lines to a page ; 42 letters to a line. Description.- Country paper thin and white; Devanagari characters ; small, legible and good hand-writing; borders ruled in three lines in red ink; red chalk used; white pigment too; foll. ra and 7rb blank ; edges of the first and last foll. slightly worn out; a strip of paper pasted to fol. 1"; condition on the whole good; the text as well as its balavabodha complete; the latter seems to be composed in Samvat 1501. 872 1892-95. Age. -- Samvat 1766. Author of the balavabodha- Mahopadhyaya Hemahamsa Gani, A devotee of Jayacandra Suri, pupil of Munisundra Suri, pupil of Somasundra Suri of the Tapa gaccha.. Begins.~~~ ( text ) fol. 1 namo arihaMtANaM etc. Subject.-- Sutras pertainting to the six avasyakas along with the corresponding explanation in Gujarati. "" -- ( balao ) fol. rb OM namaH siddhaM // zrIjinAya namaH // pArzvanAthAya namaH / namaH zrI

Page #401
Jaina Literature and Philosophy [997. zrI(zre)yAMsi zrImahAvIraH sizrIsaMghasya yacchatAt yasyAjJA kalpavallIva manovAMchitadAyinI 1 zrIvarddhamAnajinazAsanarAjyanet (?) vizvatrayAdbhute caritrayugapradhAnaH zrIsomasuMdaragururmuru ca vattI(?) ___bhUyAdameyamahimA mama suprasannaH 2 tatpaTTanAyakA zrImunisuMdarayo jayatyadhunA / jayacaMdrasUri-jinakIrtisUriparikaritAH // 3 // svAnyayorupakArAya likhyate mayA / SaDAvazyakasUtrANAM vyAkhyA bAlA( va )bodhinI // 4 // pahilaM sakalya mAMgalikanu mUla zrIjinazAsananu sAra igyAra iMga caUda pUrvanu uddhAra sadeva zAzvatu zrIpaMcaparameSTi mahAmaMtra etc. Ends.- (text ) fol. 70 desAvagAsiyaM uvabhogaparibhoga paJcakkhAmi / annatthaNA. bhogeNaM sahasAgAreNaM mahattarAgAreNaM savvasamAhivattiAgAreNaM vosirAmi ,, -( balan ) fol. 71 jeha bhaNI sUdhA dharmanu udyama jIva hui mokSaphala dAIu kai // iti pratyAkhyAnabAlAvi(va)bodhaH cauthau adhikAra saMpUrNa hUu // zrISaDAvazyakabAlAvi(va)bodha saMpUrNa hUu / eha mAhi cyAri adhikAra pahilai adhikAri devavaMdanI 1 bIjai guruvaMdanI 2 bIjai paDikamaNuM 3 cauthai paJcakkhANa 4 iti zrI tapAgacchanAyakasakalasuvihitapuraMdarazrIsomasuMdarasUrizrImunisuMdarasUrizrIjayacaMdrasaripadakamalasevinA ziSyamahopAdhyAya zrIhemahaMsagaNinA zrAddhavarAbhyarthanayA kRto(s)yaM SaDAvazyakabAlAvi(va)bodha AcaMdrAkrka naMdyAt saM0 1501 va // // saMvata 1766 nA dharSe mAsottamamAghamAse zuklapakSe tRtIyAtithau ravivAsare / likhitaM 'moDha'jJAtIya // Reference.-- For description of a Ms. having Sadavasyakasutra and Merusundara's balavabodha see B. B. R. A. S. vols. III-IV, p. 400. Herein we find a description of another Ms. having Sadavasyakasutra and an anonynous balavabodha composed earlier than that of Merusundara. 1 See No. 942

Page #402
998.] 111. 4. Malasotras 365 SaDAvazyakasUtra Sadavasyakasutra TabbAsahita with tabba No. 998 158 1871-72. Size.- 104 in. by 44 in. Extent.-- 23 folios ; s lines to a page ; 36 letters to a line. Description.-Country paper thin, rough and white; Devanagari characters; this Ms. contains the text and its interlinear tabba; the former written in a very big hand whereas the latter in a very small one ; legible and good hand-writing; borders ruled in two lines and edges in one, in red ink ; foll. numbered in both the margins%3; fol. I blank ; red chalk used; both the text and the commentary complete; condition very good. Age.- Sarivat 1873. Author of the tabba-Not mentioned. Subject.-- This work starts with Navakara and ends with Samayiya. vasjutto followed by Samstaraka paurusisutra and several pratyakhyanas beginning with cauvihara uvavasa. All these sutras are explained in Gujarati. Begins.- (text) fol. I zrIAdinAthajI namaH / / Namo arihaMtANaM Namo siddhANaM // etc. , - (tabba) fol. I zrIarihaMtane mAro namaskAra ho| sarva siddhane mAro namaskAra ho / AcAryane mAharo namaskAra ho / etc. - (text ) fol. 19* sAmAiaMmi u kae samaNo iva sAvao havai jamhA eeNa kAraNeNa bahuso sAmAiaMkujjA 2 sAmAiaposahasaMThiassa jIvassa jAi jo kAlo so saphalo bodhavvo seso sNsaarphlheuu3|| chaumatyo mUDhamaNo kittiamittaM pi saMbhare jIvo jaM kiMcina saMbharAmi micchAmi dukkaDaM tassa 4 See p. 255.

Page #403
366 Jaina Literature and Philosophy [998. sAmAyaka vidhi lI, vidhi pAryu ji kAMI avidhi huu huI te savi huM maneM vacane kAyAiM karI tassa micchA mi dukkaDaM cha karomi bhaMte posahaM AhAraposahaM desao savvao sarIrasakkAraposahaM savvao baMbhaceraposahaM savvao anvAvAraposahaM savao caDAvihe posahe ThAmi etc. - (text) fol. 20% jai me hujja pamAo imassa dehassa imAi rayaNIe AhArasuvahidehaM savvaM tiviheNa vosiriaM4 cattAri maMgalaM arihaMtA maMgalaM siddhA maMgalaM sAhU maMgalaM kevalipaNNatto dhammo maMgalaM 5 cattAri loguttamA arihaMtA loguttamA siddhA loguttamA sAhU loguttamA kevalipaNNatto dhammo loguttamo 6 cattAri saraNaM pavajAmi ArihaMte saraNaM pavajAmi siddhe saraNaM pavajjAmi sAisara kevalipaNattaM dhamma saraNaM paSajjAmi 7 pANAivAya 1 maliaM2 corikkaM 3 mehuNaM 4 daviNamucchaM 5 kohaM6mANaM 7mAyA 8lobhaM 9 etc. - (text) fol. 21 ___ arihaMto maha devo jAvajIvaM susAhuNo guruNo jiNapaNNattaM tattaM ia sammattaM mae gahiaM 14 iti zrIsaMthArAporisIsUtraM Ends.- fol. 23* savvasamAhivattiAgAreNaM 8 pANassa leveNa vA 1 aleveNa vA 2 accheNa vA 3 bahuleNa vA 4 sasittheNa vA 5 asittheNa vA 6 vosirAmi iti AMvi(bi)lapaJcakkhANa saMpUrNa saMpUrNa SaDAvazyakaM saMvat 1873 varSe 'kRSNagaDhagnagarena lipi Sthandilapratilekhanasatral known as 24 mAMDalA are given as under in two columns on the last foll. which is not numbered :-- 1 This sutra is printed in " SaDAvazyakasUtrANi" (p. 5). It is pratically printed in 'paJcapratikramaNAdistrANi" (p. 538) published by Sri Jaina Sreyskara Mandala Mhesana in Samvat 1917. It is also printed in " zrIpratikamANasatra" (pp. 383-384) published by Srivaka Bhimasimha Manaka in A. D. 1888.

Page #404
367 999.] III.4Malasatras / vaDI niti saMthAranai samIpaI // // AgADhe majjhe pAsavaNa(Ne) aNa ahi laghu nItya saMthAranai samApaiM Ase 2 etc. // AgADhe(? De) Asanne uccAre // upAzrayadvAravihira pAsavaNe(0) aNaahiAse 1 aNAgAhe Asane uccAre AgADhe Asanne pAsavaNa(?Ne ) aNa aNAgADhe majjhe pAsavaNe ahiyAse 2 pAsavaNa(?Na.) aNaahi yAse 1 etc. ahiyAse 1 / / aNAgADhe majjhe uccAre pAsavaNe / / AgADhe majjhe uccAre pAsavaNe ahiyAse 3 aNaaNaahiyAse 2 etc. aNAgAhe dUre pAsavaNe ahiyAse 3 These are the the mandalas made for attending natural calls. These calls may be attended to ( 1 ) near the bed, (2) inside the upasraya near its entrance (3) outside the upasrya but near its entrance and (4) at a distance of about 100 hastas from the upasraya. SaDAvazyakasUtra (1) Sa davasyakasutra bAlAvabodhasahita with balavabodha No. 999 246(a). 1871-73 Extent. - (text) 39- 2 = 37 folios; 3 lines to a page ; 32 letters to a line. , -- ( baladeg ) 37 folios ; 7 lines to a page ; 42 letters to a line. Description.- Country paper tough and whitish ; Devanagan characters; this Ms. contains the text as well as its balavabodha; the former written in a very big hand ; legible and good hand-writing ; borders ruled in two lines and edges in one, in red ink ; foll. numbered in the right-hand margin only; white paste used ; edges of the last fol. slightly, worn out; condition on the whole good, both the text and the balavabodha incomplete since the first two foll. are missing ; this Ms. contains an additional work viz., saMthArAporisIsutta which begins on fol. 36deg and ends on fol. 396; it is explained in Gujarati; the pertinent lines on fol. 36deg and 39 are as under :

Page #405
Jaina Literature and Philosophy [999 ( balan ) fol. 360 zrIgautamAdi mahAmoTA ruSasviranaiM namaskAra hau ehavA gurusApaI pachaI triNi nomukAra kahaI (text ) fol. 39 arihaMto mahadevo / jAvajIvaM susAhuNo gurunno| jiNapannattaM tattaM / ia sammattaM mae mhiaN|| 14 // iti zrIsaMthArAporisisUtra saMpUrNaH // cha / zubhaM bhavatu // kalyANamastaH ||ch zrI Then follow some three verses. ( balan ) fol. 39 iti zrIsaMthArAvidhi saMpUrNaH Age.- Not modern. Author of the balavabodha.- Not mentioned. Subject.-- This work consists of a number of sutras together with their explanation in Gujarati. Begins.-- ( text ) fol. 3deg bIyakkamaNe / hariyakkamaNe / etc. , -- ( balan ) fol. 3deg bIyakA goryu pramuSa bIjanaiM cAMpavaI karInaI etc. Ends.- ( balan ) fol. 36deg posahavidhi lIdho / vidhi pAryo vidhi karatAM avidhi AzAtanA huI / te savi hu~ / mana vacana kAyAiM karI micchA mi dukkaDaM ||ch|| ' iti zrIkhaDAvazyakasUtraM saMpUrNa // cha / SaDAvazyakasUtravRtti (?) Sadavasyakasutra vrtti (?) 43. No. 1000 1880-81. Size.- 12 in. by 21 in. Extent.-32 leaves ; 4 to 7 lines to a page; 55 to 6o letters to a line. Description.-Palm leaf thin, durable and greyish ; Devanagari cha racters with pRSThamAtrAs; small, legible and good hand-writing; this Ms. presents an appearance of the work having

Page #406
1000.] 111. 4 Malasatras 365 been divided into two separate columns but really speaking lines of the first column are continued to the second ; borders of each of the columns ruled in two lines in black ink; red chalk used at times%3 the left-hand margins have been worn out in good many cases; this Ms. starts with the first leaf numbered as 146; leaves numbered in both the margins; in the right-hand margin as 146, 147 etc.; in the left-hand one by letters; e.g. 174th is numbered as mu pos several leaves more or less worm-eaten ; condition unsatisfactory; there is a hole in every leaf in the space between the two columns; there are two fragmentary blank leaves at the end ; they are extra ; leaf 146a blank; complete so far as it goes; this Ms. contains the states of the text ; for instance karomi bhaMte ityAdi on leaf 148. According to Buhler's Report for 1880-81, p. 25, this Ms. is a continuation of the preceding one i.e. that of 42 of 1880-81 dated Samvat 1179. Age.- Old. Author.- Not mentioned; that is what appears. Subject.- A Sanskrit commentary explaining certain sutras pro bably pertaining to the six avasyakas. Begins.-- leaf 1466 sarvajJAya // . deveMdravaMdyacaraNAn praNamya bhaktyA jaineMdranAma... ... kiMcinmAtraM vakSye praticaraNAyA gRhasthAnAM // gurubhaktyA yadavAptaM tAvanmAtramapi bhavati puSTikaraM / matto'pi jaDaMvi // yo(s)nyo ye teSAM sadpakAritvAt etc. Ends.-- leaf 1770 jayati jagati klezAvezaprapaMcahimAMzumAm / ......tihataviSamaikAMtadhvAMtapramANanayAMzumAn . yatipatirajo yasyA dvaSyAnmatAMvanivirnayAna dhamatamatayastIrthyAnAnApare samupAsa / / . ...nAMthakapateH zatAni bhASNagatagatAni viMzatyAvikAnye. 47 [J.L. P.]

Page #407
370 Jaina Literature and Philosophy [ 1001. SaDAvazyakasUtra SadavasyakasutrabAlAvabodha balavabodba 1309. No. 1001 1891-95, Size.- Iog in. by 43 in. Extent.- 60 - 6 = 54 folios; 14 lines to a page ; 62 letters to a line. Description.-Country paper rough, thin and white; Devanagari characters with occasional pRSThamAtrA; big, clear and good hand-writing ; borders mostly ruled in two lines in black ink; red chalk used; foll. numbered in the right-hand margin only; this Ms. contains the gates of the text ; fol. 60deg blank ; strips of paper pasted to fol. 60b3; corners of the first few foll. slightly worn out; condition tolerably good; foll. I-6 missing ; otherwise conmplete. Age.- Samvat 1611. Author.- Not mentioned. Subject.- Explanation of Sadavasyakasutra in Gujarati. Begins -- fol 7deg mokSa lahasi // 6 kathA // zrInukArabAlAvabodhaH // etc. Ends.-- fol. 60deg evhA paravANani viSai vavekIrayatnaghaSa karavA / jeha bhaNI sUdhA dharmanu udyama jIva huI mokSaphaladAIu thAi / prtyaakhyaanbaalaavibodhH| cauzu adhikAra saMpUrNa duu / zrISaDAvazakabAlAvibodha saMpUrNa huu / / eha mAhi cyAri adhikAra / pihali adhikAri devavaMdana / 1 bIjai guruvaMdana 3 / trIjai paDikamaNo 4 cuthai pacapAMNa / etalai cyAri adhikAra samAptaH // // saMvat 1611 varSe bhAdrapadAdi 9numi gurudine // 'unaMta'durgeH 'bhATa jnyaatii| ThAkurazrIzrIzrIzrIbalarAja / sutasasvIdAsa lipiti / / zubhaM bhavatu | cha / yAdRzaM......doSo na dIyate // 1 // cha / zrIzrI AcAryadharmaratnamAragurubhpo namaH // cha / zrIrastu // cha /

Page #408
to02.1 Avazyaka sUtra niyukti (Avassayasuttanijjutti ) III. 4 Malasatras Avasyakasutraniryukti (Avassayasuttanijjutti) 371 629. 1892-95. No. 1002 Size. 103 in. by 48 in. Extent. 35 folios; 24 lines to a page; 60 letters to a line. Description. Country paper very thin and greyish; Devanagari characters with as; very small, clear and fair handwriting; borders ruled in two pairs of lines in black nk; the space between these pairs coloured red; numbers for some of the foll. entered twice in one and the same margin; bits of paper pasted to fol. 1a; edges of the first two and those of the last two slightly worn out; unnumbered sides decorated with a small disc in the centre; the numbered, with two more, one in each of the two margins; complete ; red chalk used; condition fair. Age.-Samvat 1483 (?) Author. "C Bhadrabahusvamin. For his other works etc. see No.709. For a discussion in German see Ubersicht uber die Avasyaka-Literatur" (pp. 23-27). Subject.-- About 50 verses which occur in the begining of this Ms. and form the Sthaviravali are also found in the beginning of Nandisutra. But they are not found in the edition containing Avasyakasutra, its niryukti and Haribhadra Suri's commentary (D. L. J. P. F. Series). They do not occur even in the edition containing niryukti and Malayagiri Suri's tika (Agamodaya Samiti Series). Furthermore, they are not commented upon by Jinabhadra Ksamasramana, Haribhadra Suri, Malayagiri Suri or any other commentator of the Avasyakasutraniryukti; but they occur in various Mss. This may due be to the fact that some scribe wrote them perhaps as mangalacarana and others followed in his foot-steps. So if we were to neglect them for a moment, the Avasyakasutraniryukti, which is a metrical composi

Page #409
322 Jaina Literature and Philosophy [ 100%. tion in Prakrit can be said to be explaining the six adhyayanas of the Avasyakasutra. The niryukti of the ist ( Samayika) adhyayana can be divided into two groups: (1) Uvagghayanijjutti ( Upod . ghataniryukti ) and ( 2 ) Namokkaranijjutti ( Namaskaraniryukti). Out of them Upodghata-niryukti is sub-divided into several sections known as under : (1) Pedhiya (Pithika), (2) Padhamavaravariya (Prathamavaravarika ), ( 3 ) Bisyavaravariya ( Dvitiyavaravarika), (4) Uvasagga (Upasarga ), (s.) Samosarana ( Samavasarana ), (6) Ganaharavaya' (Ganadharavada ), (7) Samayari ( Samacari)?, (8) Nihoavavattavva (Nihnavavaktavya ) and (9) Sesauvagghayanijjutti (Sesopodghatariryukti). The niryukti of the second (Caturvimsatistava) adhyayana has no such sub-divisions. The same is the case with the niryukti of the third ( Vandana ) aydhyayana. Under the niryukti of the fourth (pratikramana). adhyayana, we find ( 1 )+ Jhanasaya ( Dhyanasataka ), (2), Paritthavaniyanijjutti (Paristhapanikaniryukti), ( 3 ) Padikkamasamgahani (Pratikramanasamgrahani)"; (4) Jogasamgahanijjutti (Yogasamgrahaniryukti ) and ( 5 ) Asajjhayanijjutti (Asvadhyayaniryukti). Neither the niryukti of the fitth ( Kayotsarga ) adhyayana nor that of the sixth ( Pratyakhyana ) adhyayana, has any subdivisions as we find in the case of the piryukti of the first adhyayana. In the the case of a few Ms. containing Avasyakasutra This is also styled as Ganahara. 2 This is of ten types. This division is at times neglected. 4 This is not the composition of Bhadrabahusvamin, though found here; but it is rather the work of Jinabhadra Gani Ksamsaramana. s This is also known as Sangrahani.

Page #410
1602.) III. 4 Malasatras 393 niryukti, its component parts have been treated by me separately as desired, and they have been accordingly given separate serial numbers. Ernst Leumann believes that there have been four redactions of the Avasyakasutraniryukti : (1) Bhadrabahu's redaction, (2) Siddhasena's redaction, (3) Jinbhata's reaction and ( 4 ) the Vulgata-redaction.' After entering into a learned discussion pertaining to these redactions he has recapitulated the results in a tabular form which I may here represent as under: -- Avasyaka Avasyaka-niryukti Ist Redac. 3rd 4th 2nd Redac. Redac. Redac. IX kh XII II-VIII ( Uvaggha- I (Pedhiya) Theravali yanijjutti ) Pancanamaskara I (Samayika ) II ( Caturvimsati stava) | XI III (Vandana ) IV (Pratikramana ) XIII XIV XV (Paritthavan- XVI ( Sam- Jhaniya-nijjutti) gahani) asaya XVII (JogasamXVIII ( Asajjhaya nijjutti ) V (Kayotsarga) XIX VI | Pratyakhyana) XX gaha) In this connection I may add that the seventh section of Mulayara 3 ( Mulacara ) of Vattakerasvamin is known by the name of Avassayanijjutti. This Digambara work resembles Avasyakasutraniryukti in several respects such as six divisions etc. See " Ubersicht uber die Avasyaka-Literatur " (p. 2.). lbid., p. 31. For a pertinent portion of this see the above-mentioned work pp. 16-19. 2 3

Page #411
374 Jaina Literature and Philosophy [ 1002 For a detailed information about "subject " in Sanskrit see pp. 135-139 of "nanyAdigAthAdyakArAdiyuto viSayAnukramaH" (Agamodaya Samiti Series No. 55). In the printed edition in verses 450, 457 and 458, there is a reference to garbhapaharana pertaining to Lord Mahavira. This is in agreement with the passage occurring in Bhavanadhyayana of Acarangasutra and the passage in Kalpasutra. Moreover, it is supported by a Jaina antiquity found at Mathura. Begins.-- fol. I0 jayai jagajIvajoNI / viANao jagagurU jgaannNdo| jaganAho jagabaMdho jayai jagapio mahAbhayavaM / / 1 // -fol. 11 AbhiNibohiyanANaM / muyanANaM ceva ohinANaM ca / taha maNapajjavanANaM / kevalanANaM ca paMcamayaM // 1 // Ends.-- fol. 350 sanvesi pi nayANaM bahuvihavattavayaM nisAmittA / taM savanayavisuddhA(ddhaM) jaM caraNaguNaTrio sAhU // 94 // paccakkhANanijjuttI saMmattA // cha // samAptaM zrImadAvazyakaM // cha / saM0 1483[8] varSe phA0 50 5 / so0 Reference.- Published along with Avasyakasutra and Haribhadra Suri's commentary Sisyahita in the Agamodaya Samiti Series, Nos. 1-4, and also in the same Series as Nos. 56 and 60 and in D. L. J. P. F. series as No. 85 where Malaya giri Suri's commentary is given in 3 parts so far as available. See Weber II, p. 379fn. and 742ff., as well as Indian Antiquary vol. XXI, p. 329 ff. For additional Mss. see B. B. R. A. S. vols. IIJ-IV. p. 400% and G.O. Series vol. XXI, pp. 13 and 23. ___ I This passage is quoted by Darsanavijaya in his article "mathurAno kaMkAlI TIlo ane bhagavAna mahAvIranA jIvananA ce viziSTa prasaMgo" published in Sri Jaina Satya Prakasa (vol. II, Nos. 4-5, p. 180.) 2 Here the work is styled as launagi of Bhadrabahu.

Page #412
1002.] III. 4 Malasatras 375 For the origin of the Botikas according to this Nit. yukti and Haribhadra's commentary see Z. D. M. G. vol. X L. p. 92ff, and for Avasyakasatraniryukti ( IX ) see W. Z. K. M. vol. V (PVI). For a learned discussion in German see " Ubersicht uber die Avasyaka-Literatur" (pp. 22-31). In Jaina Sahitya Samsodhaka (vol. II, No. 1, pp. 81-91), July 1923 we have an article in Gujarati entitled as pro. lyumana ane AvazyakasUtra. Herein it is said that Prof. Leumann had commenced publishing in Abhandlungen fur die Kunde des Morgenlandes, his work Die Avashyaka Erzahlungen ; but he let it go after about 50 pages were printed as he could not get the necessary Mss. of bhasya, curni, tika, etc. In 1894 he prepared a paper on Avasyaka and its literature to be read at the International Oriental Congress. This paper he has published in so pages. Herein he has first of all pointed out the place assigned to Avasyaka by the:Svetam baras and the Digambaras. This is followed by the summary of the nijjutti, some of the special features of the curni and those of Haribhadra Suri's tika on Avassayasutta, an exposition of Visesavassayabhasa, etc. In the end he has given photo-prints of some of the worn-out leaves of Silanka Suri's commentary on it. Some of the proofs of this publication seem to have been sent by the late Prof. Leumann to the late Dr. Bhandarkar. They are to be found in his collection at B. O. R. I. After these remarks, Jinavijaya and K. P. Modi, the writers of this article have given from the above-mentioned publication the names of the 11 Ganadharas and mentioned their doubts and have reproduced quotations from the non-Jaina sources like the Upanisad etc. with their original sources where possible'.-a very praiseworthy attempt on the part of the late Prof. Leumann. For certain important statements in Gujarati see Siddhacakra( vol. IV, No. 12, pp. 284-288 ). For this see Ubersicht uber die Avasyaka Literatur ( pp. 37-38).

Page #413
376 Jaina Literature and Philosophy ( 1002. They are as under :.. (1) Out of the 10 niryuktis, Avasyakasutraniryukti is composed first. (2) It is more exhaustive than the rest, and that its Upodghataniryukti is recommended not only for the study of the remaining five adhyayanas of Avasyakasutra but even while studying the nityukti of other works. (3) Some of its gathas occur in some of the agamas. For instance 112 gathas are in Anuyogadvarasutra, and some gathas in Sthananga and Nandisutra, too. (4) The discussion about avad hijnana given in the Nandisutra reminds one of a corresponding topic dealt with in the Avasyakasutraniryukti. (5) It is the Avasyakasutraniryukti on which we have a number of commentaries, such as mulabhasya, the Visesa vasyakabhasya, curni and various other com mentaries.' (6) Avasyakasutra and its Upodghataniryukti are unique in the sense that a separate treatise viz. Anuyoga dvara is composed for explaining them. (7) There is a discussion as to why there are two mangalas in the Avasyakasutraniryukti, one by way of the gatha beginning with rufaaligatoi and one by way of the gatha commencing with titthayare bhagavaMte ( Upodghataniryukti). . A.M. Ghatage has made certain observations regarding the Niryuktis. He places the Avasyakasutraniryukti along with the Dasavaikalikaniryukti in the second group out of the three 2 in which he divides the collection of Niryukti I Cf. what is given on p. 15 of "Ubersicht uber die Avasyaka-Literatur." % The first and the third groups are as under : The niryuktis on the first two angas come under the first group which contains "Niryuktis the text of which is preserved 10 us in a form which we can reasonably take to represent their original one free from later additions" (p. 270). "In the third group come the Niryuktis which are now called by the names of the Bhasyas and Bphad-Bhasyas like those on Nisitha and others where it is not now possible to separate the original Niryukti and the latter commentary ou it." (pp. 270-71).

Page #414
1003.1 1: 111. 4 Malasatras works. He defines the second group as under :--- "The second group consists of those Niryuktis where verses of the so-called Mula-Bhasya are added to the original Niryukti either to explain it or to supplement it." Vide his article "The Sutrakrtanga-niryukti" (p. 270) published in "The Indian Historical Quarterly" vol. XII, No. 2 (June 1936). 377 1 In the end, I may mention that it is rather difficult to say for certain as to which sutras constitute the original Avasyakasutra. This Avasyakasutraniryukti can throw at least some light in this connection. For, herein we have sutrasparsikaniryukti which explains every word of the sutra or good many words of it. As such sutras, mention may be made of the following sutras : (1) Navakara, (2) Karemi bhante, (3) Logassa, (4) Suguruvandanasutra, (5) Tassa uttari, (6) Annattha and (7) the various Pratyakhyanasutras. The meaning of some of the gathas of the Avasyakasutraniryukti seems to tally with the meaning of some of the sutras. These sutras may be a part and parcel of the Avasyakasutra. As a specimen mention may be made of Cattarimangalam. For further discussion, the reader may refer to pp. 135-137. _AvazyakasUtraniryukti No. 1003 Size.-- 10 in. by 4 in... [Extent. 44 folios; 15 lines to a page; 68 letters to a line. Description. Country paper thin, tough and whitish; Devanagari characters with us; small, legible and good hand-writing; borders ruled in four lines in black ink; red chalk used especially to mark the numbers for verses; 48 [J. L. P. J Avasyakasutraniryukti 83. 1872-73.

Page #415
378 Jaina Literature and Philosophy [1003. yellow pigment rarely used; edges of the first two foll. slightly damaged; condition on the whole very good; complete ; extent 2572 Slokas ; the contents may be roughly indicated as under: therAvaliyA + peDhiyA paDhamAvara bariyA fasuraraftar uvasagga samosaraNa gaN. hara sAmAyArI namokkAranijjutti Age.- Not modern. Begins. fol. r* foll. Ends.-- fol. 44b "" 14 - 32 34 - - 62 64 - 120 "" ,, 12b-142 99 23 144 - 150 15 - 166 9, 160 170 17-266 dr jaya jagajIval etc. cauvIsatthayanijjutti fol. 26-27b vaMdaNanijjutti 27b-31a "" | paDikkamaNanijjutti " 31"-32" jhANasaya " 32-342 pAriTTAvaNiya nijjutti (?),, 344 - 360 36b-38b 38b-41b 42-445 asajjhAyanijjatti kAussagganijjutti | cakkhANanijjutti " " " savvesi pi etc., up to saMmattA as in No. 1002, This is followed by the line as under :-- cha // iti bhI AvazyakazrutaskaMdhaH samAptaH // cha // graMthAgraM 2572 // cha // N. B. For additional information see No. 1002. Avazyaka sUtraniryukti No. 1004 Size.--- 123 in. by 4g in. Extent.-- 43 folios; 17 lines to a page ; 64 letters to a line. Description.-- Country paper thin, brittle and greyish ; Devanagari characters with occasional gears; small, legible and good hand-writing; borders ruled in four lines in black ink; red chalk used; white and yellow pigment, too; foll. more or less worm-eaten; strips of paper pasted to some of the foll. in the beginning ; some foll. torn almost in the middle ; Avasyakasutraniryukti 1180. 1886-92.

Page #416
985.1 rit. 4 Malasatras condition fair; marginal notes written at times; complete, extent 3550 slokas. Age.--- Old. Begins. fol. r* Ends.- fol. 43b 'jayai jaMgajIva etc. 379 sambesi pi etc., up to paccakkhANa nijjuttI sammattA // cha | This is followed by the lines as under :-- etthaM puNa caumaMgo amuddha u // 1 so guNa gahaNijo sIsapasissANa hou jaraNijjo sAhUNa ... re bhojjo niccaM ca AcAra harajijjA // 2 akkharamattA 0 lihiUNa pagaraNamiNaM jaM pattaM punna sAhaNa dhamma / teNa dhammeNa puNo sabbo vi jaNo lahau mokkhaM // 4 / iti AvasyaM sammattaM / cha / cha | graMthAgraM 3550 sarvasaMkhyA / zubhaM etc. N. B.-- For further particulars see No. 1002. Avazyaka sUtraniryukti No. 1005 Size--- 1o in. by 44 in. Extent. -- 173 folios; 9 lines to a page 25 letters to a line. Description.-- Country paper thin and greyish; Devanagari characters with pRSThamAtrAs; big, bold, legible and elegant handwriting; borders ruled in two pairs of lines in black ink; the space between the pairs coloured yellow; numbers for foll. entered only once ; a square-like design in the centre on unnumbered sides and two more in the margins in the case of the numbered ones; fol. 1 decorated with a design; otherwise blank; edges of the first fol. badly worn out; edges of the 2nd fol. slightly damaged; some of the foll. worm-eaten ; condition tolerably good; this Ms. contains therAvalI, peDhiyA etc. ; yellow pigment used; complete. Avasyakasutraniryukti 257. 1883-84.

Page #417
$80 Age. Samvat 1553. Begins.-- fol. 1b Ends.- fol. 173a Jaina Literature and Philosophy jayai jagajIva etc. Avazyaka sUtraniryukti No. 1006 savvesi pi etc. up to pazcakkhANanijjutI as in No. 1002. This is followed by the lines as under:-- Begins.- fol. r Ends. fol 34 manoo samAptA iti zrI AvazyakazrutaskaMdhaH samAptaH // cha // saMvat 1553 varSe vaizApazudi 9 some 'pattane' likhApitaM // cha // zrI' uruvaMza' jJAtIyabhaNasAlI // cha // devacaMdramArga ThakUpratrabhaNasA pa ( 2 ) maMDalikabhAryA - manAItA || cha || bakAIpaThanArtha // cha // zubhaM etc. N. B. For other details see No. 1002. Age. Seems to be old. 3 329 40 boo32 Size,-10 in. by 4 in. Extent. 34 folios; 20 lines to a page; 73 letters to a line. Description.--Country paper very thin, smooth and greyish ; Devanagari characters with ears; small, quite clear and beautiful hand-writing; borders ruled in three lines; out of them two are in blank ink and one in red ink; a corner of the first fol. slightly worn, out; condition very good; red chalk used; fol. 34b blank; complete. N. B.-- For other details see No. 1002. Avasyakasutraniryukti 240. A. 1882-83. GE Gufactuft etc. as in No. 1002. savvesi pi etc. up to saMmattA as in No. 1002. This is followed by cha || zubhaM bhavatu // miti bhadraM

Page #418
N..1007 . . . ... ... .. . .. . . 1008.1 III. 4 Malasairas AvazyakasUtraniyukti ... ... Avasyakasatrantryukti No. 1007 208. 1871-72. Size:- 101 in. by 4g in. Extent.--63 folios; 15 lines to a page ; so letters to a line. Description.- Country paper thin, rough and white; Devanagari characters with pRSThamAtrAs; small, legible, uniform and beautiful hand-writing; borders ruled in three lines in red . ink ; foll. numbered in the right-hand margin ; the last fol. wrongly numbered as 64; it is really 63rd; notes occasionally written in the margins; complete ; extent 3100 slokas; condition very good ; yellow pigment used; fol. 63deg blank. Age.-- Old. Begins. - fol. !" 5 60 // 2 jayai jagajIvajoNIviyo(?yA)Nau jagaguru jgaannNdo|' jaganAho jagabaMdhu / jayai jagApayAmaho bhayavaM / 2 Ends.- fol 63... savvesi pi nayANaM vahuvihavattavvayaM nisaamittaa| taM savvanayavisuddhaM jaM caraNaguNaTrio sAhU // 71 // ...........! iti paJcakkhANanijjuttI sammattA // 6 // smaaptaa||ssvidhaavshykniyukti ||ch / / iti graMthAgraM zloka 3100 // cha // - yAdRzaM etc. up to doSo na dIyate 1 N. B.- For other details see No. 1002. 771. AvazyakasUtra niyukti ... .....Avasyakasutraniryukti No. 1008. ... 1895-1902.! Size.-- 111 in. by 44 in? Extent.-44-2 = 42 folios ; 17 lines to a page; 75 letters to a line. . . . . . . . . . . ...........

Page #419
82 Jaina Literature and Philosophy [roo8. Description.--Country paper thin and white; Devanagari chara. _cters with pRSThamAtrAs; sufficiently big, bold, clear and good hand-writing ; borders ruled in four lines in black ink; red chalk used ; several foll. more or less worm-eaten ; foll. I and 2 lacking; otherwise complete; edges of the foll. 3 to 6 slightly worn out'; condition on the whole good : 2700 gathas; extent 3375 slokas. Age:- Sarmvat I488. : Begins -- fol 3 vA vAsudevA ya / / 71 / . solasa rAyasahassA / sababaleNaM tu saMkalaNibaddhaM / aMcchaMti vAsudevaM / agaDataDaMmI ThiyaM saMtaM // 72 // etc. Ends -- fol 44 savvesi pi etc ; up to sAhU as in No 1007. This is followed by the lines as under -- // 71 evaM 158 // cha iti paJcakkhANaM nAma chadraM ajjhaya sammattaM // iti paJcakkhANanijjuttI sammattA // AvassaganijjuttI sammattA | gAthA 2700 zlokasaMkhyA 3375 // cha // ||sNvt 1488 varSe mArgazIrSa vadi 11 ekAdazyAM gurau || zrI pIsala - nagare paM0 guNasamudragaNinA likhApitaM zrIAvazyaka saMpUrNa // cha / zubha bhavatu etc. N. B.- For further particulars see No. 1002. AvazyakasUtraniyukti Avasyakasutraniryukti No. 1009 157. 1871-72. Size.- Ing in. by 4g in. Extent.-46 - 1 -9 = 36 folios ; I7 lines to a page ; 6o letters to a line. Description.-Country paper thin, rough and greyish; Deva. nagari characters with TASTIS; small, legible and very fair hand-writing ; borders indifferently ruled in red ink: red 1 This portion occurs as a part of the 70th verse on p. 78a in the edition containing Malayagiri Suri's commentary on Avasyakasutra.

Page #420
roro.] III. 4 Malasutras 383 chalk and yellow pigment used; numbers for foll, entered once only; unnumbered sides have a small disc in red colour in the centre, whereas the numbered, in each of the two margins, too; marginal notes seem to be added at times; the first fol. as well foll. 37 to 45 lacking; otherwise pratically complete ; edges of several foll, slightly worn out; foll. 36 and 46 damaged probably on account of their having been exposed to fire ; condition fair; this Ms. commences practically with the 29th gatha of sthavirAvalI. Age. -- Samvat 1532. Begins -- fol za gunnaannN| vaMdAmi ajamaMguM sU( sa )yasAgarapAragaM dhIraM // 29 vaMdAmi ajjadhammaM vaMde tatto ya saddaguttaM ca / tatto ya ajjavairaM tavaniyamaguNehiM vairasamaM // 30 // etc. Ends. -- fol 46. sanvesi pi etc., up to saMmattA as in No. 1002. This is followed by the lines as under : __ cha // zrIAvazyakasUtraM samAptaM / / graMthAnaM 2550 anupa graMthAnumAnaM 3150 / zubhaM bhavatu // cha / saMvat 1532 varSe jyeSThamAse caturdazIdine guruvAsare zrAvikArUpAI zrAvikA vA zrAvikA pUrI zrIAvazyakasUtra liSApitA / pravartinIrAjalakSmIupadezena // N. B.-- For additional information see No. 1002. Avasyakasutraniryukti AvazyakasUtraniyukti No. 1010 Size.- 104 in. by 4g in. Extent.--71 - 1 = 70 folios ; 13 lines to a page ; 44 letters to a ... line. Description.-Country paper thin and white; Devanagari charact ers with pRSThamAtrAs; big, legible and elegant hand-writing; borders ruled in two pairs of lines in black ink; the space

Page #421
384 Jaina Literature and Philosophy { 1010. between the pairs coloured red; unnumbered sides hvae a square-like desgin in the the centre whereas the numbered, in each of the two margins, too, in yellow colour; a strip of paper pasted to fol. 2; foll. 6 and 65 to 71 slightly torn; condition on the whole good; white pigment used; red chalk at times only; the 1st fol. lacking; this Ms. contains] paDhiyA etc. up to jogasaMgaha and AsAyaNA complete plus some portion; thus it begins and ends abruptly. Age. Pretty old. Begins fol 2a Ends 11 ( paratitthiya ) gahapahanAsagassa tavateyadittalesassa / nAjjAyasa jae bhahaM damasaMghasUrassa // 10 // This is the roth gatha of for which is followed by aftur. -fol 71b sthavirAvalI (therAvalI ) AvAsayaM tu kAuM jiNovaiTuM guruvaeseNaM / tini thuI paDilehA kAlassa vihI imA tattha // 56 // duvist ya hoi kAlo vAghAyama eyaro ya nAyavvA / vAghAi ghaMghasAlAi ghaTTaNaM satakahaNaM vA // The Ms. ends thus abruptly. N. B. For further particulars see No. 1002. Stha viravali (TheravaliL) 273(a). A. 1882-83. No. 1011 Size. 10 in. by 4 in. Extent. 46 folios; 17 lines to a page; 58 letters to a line. Description. Country paper very thin and greyish; Devanagari characters; small, legible and good hand-writing; borders thickly ruled singly in red ink; red chalk used; unnumbered sides have a small disc in red colour in the 1 This is 1369th gatha of the Avasyakasutraniryukti according to the edition containing Haribhadra Suri's commentary.

Page #422
1011.] Ill. 4 Malasutras 385 centre; the numbered have two more, one in each of the two margins ; complete; some of the foll. somewhat wormeaten; condition unsatisfactory; this work is followed by the following constituents which practically make up Avasyakasutraniryukti. (1) pIThikA (peDhiyA ) foll. rb to 34. ( 2 ) prathamAvaravarikA ( paDhamAvaravariyA ) foll. 34 to 64. (3) dvitIyAvaravarikA ( biiyAvaravariyA ) foll. 64 to 124. (4) ' upasarga ( uvasagga ) foll. 12 to 134. (5) gaNadhara ( gaNahara) foll. 13 to 16. ( 6 ) sAmAcArI ( sAmAyArI ) foll. 164 to 17. (7) upodghAtaniryukti ( uvagghAyanijjutti ) foll. 17 to 21. ( 8 ) namaskAraniryukti ( namukkAranijjutti ) foll. 21b to 244. ( 9 ) sAmAyikaniryukti (sAmAiyanijjutti) foll. 244 to 264. ( 10 ) caturviMzatistavaniryukti ( cauvIsatthayAnejjutti ) foll. 26 to 274 ( 11 ) vandananiryukti ( baMdaNanijjutti ) foll. 27 to 300. (12) pratikramaNaniyukti (paDhikramaNanijjutti ) foll 30b to 31. (13) dhyAnazata ( jhANasaya ) foll 3rb to 33. (14) pAriSThApanikAniryukti ( pAriTTAvaNiyAnijjatti ) foll. 33b to 36'' (15) pratikramaNasaGgrahaNI ( paDikkamaNAsaMgahaNI ) foll. 36 to 37b. ( 16 ) yogasaMgraha ( jogasaMgaha ) foll. 37 to 38. ( 17 ) AzAtanA (AsAyaNA ) foll. 38b to 394. ( 18 ) asvAdhyAya niyukti (asajjhAyanijjutti ) foll. 392 to 41. (19) kAyotsarganiyukti ( kAussagganijjuti ) foll. 414 to 44. foll. 44* to 448. foll. 44b to 45* . ( ) pratyAkhyAna niyukti (pacakkhANAnijjutti ) foll. 45 to 46b. Age.- Pretty old. Author.- Perhaps Devavacaka. Subject. Some of the verses in Prakrit mentioning the names of several Sthaviras. 1 In the printed Catalogue we have Samavasrarana between Upasarga and Gapadhara. 49 [J. L. P.]

Page #423
386 Jaina Literature and Philosophy [iori. Begins.- fol. " OM namo zrIjinAgamAya / nayaha jagajIvajoNIviyANao jagagurU jmaannNdo| jaganAho jagabaMdha jayai jagappiyAmaho bhayavaM // 1 // etc. - fol. rb vaMdAmi ajjarakkhiyakhamaNe rakkhiyacarittasavasse / rayaNakaraMDagabhUo aNuogo rakkhio jehiM // 32 // nANaMmi daMsaNaMmi ya taba viNae niccakAlamujjuttaM / ajjArajja)naMdilakhamaNaM sirasA vaMde pasannamaNaM' // 33 // vaDara vAyaga'so etc. This verse is not numbered as 34 but it is numbered as Io and the succeeding ones are accordingly numbered as 11, 12 etc. Ends.- fol. 10 je aMne bhagavaMte etc. up to bucche AbhiNibohiyanANaM suyanANaM ceva ohinANaM ca / taha maNapajjavanANaM kevalanANaM ca pNcm|| 27 // therAvaliyA samattA Reference.- Published. See No. 1002. pIThikA Pithika (peDhiyA) ( Pedhiya) No. 1012 273 (b). A.1882-83. Extent.- fol. 1b to fol. 3o. Description.- Complete. For other details see Sthaviravali No.101. Subject.-- 81 verses in Prakrit. 1 This is the 29th verse of Sthaviravali given in the beginning of Nandisutra, 2 This forms the very ist verse of the Avasyakasutraniryukti commented upon by Malayagiri Suri,

Page #424
_387 Form.] Ill. 4 Malasatras Begins.- fol. 1b. - oggaha IhAvAo a dhAraNA eSa huMti cattAri / AbhiNibohiyanANassa bheyavatyU samAseNaM // 1 // ' etc. Ends.- fol. 3 itthaM puNa ihagAro suyanANeNaM jao sueNaM tu / sesANamappaNA vi ya aNuoga paIvadi,to // 81 // paDhiyA saMmattA / / Reference.- Published. See No. 1002. pIThikA Pithika No. 1013 1207. 1887-91. Size.-- Iol in. by 44 in. Extent.-- 3 folios; 14 lines to a page ; 44 letters to a line. Description.--Country paper thin, brittle and greyish; Devanagari characters; sufficiently big, clear and good hand-writing; borders ruled in four lines in black ink ; the space between the pairs coloured red; foll. numbered in both the margins; unnumbered sides have a small disc in red colour, in the centre only whereas the numbered in ihe margins, too; complete ; edges of all the foll. slightly worn out ; condi, tion tolerably good ; this Ms. contains 79 verses in all. Age.-- Pretty old. Begins.- fol. 14 OM namo vItarAgAya // AbhiNibohiyanANaM suyanANaM ceva ohinANaM ca / taha maNapajjayanANaM kevalanANaM ca paMcamayaM // uggaho Iha avAo etc. as in No. 1012. 1-2 These two verses form 2nd and 79th verses of the Avasyakasatraniryukti above referred to ( see p. 386).

Page #425
388 Jaina Literature and Philosophy [013. Ends.- fol. 30 etthaM puNa ahigAro etc. up to didaMto as in No. 1012. This is followed by || 79 pIDhiyA saMmmattA N. B.- For other details see No. 1012. pIThikAbAlAvabodha Pitbikabalavabodha 1347 (b). No. 1014 1895-98. Extent.-- fol. 4* to fol. 13. Description.--Complete%3 composed in Samvat I564. For other details see Sthaviravalivrtti with balavabodha No. 631, where this work is styled as AvazyakapIThikAvivaraNa.. - (bAlAvabodha). Author.-- Samvegadeva Gani, pupil of Somasundara Suri of Tapa gaccha. Subject.-- Sanskrit and Gujarati explanations of the Pithika of : Avasyakasutraniryukti. Begins.- fol. 4* zrIvarddhamAnajinanAyaka eSa satyaM / prAbhAtikaH kila sahazra(sa)karo vibhAti // yahezitIrthakiraNaprasaraiH prkaashH| saMjAyate sakalakavastuvikAzadakSaH // 1 // . . zrIsomasuMdarayarUna bhaktyA / zrIratnazekharaesaMzca // zrImat 'tapAgaNeMdrAn / natvA zrutadevatAMzcaiva // 2 // zrImattadAvazyakasyAdau / pIThikA vivRNomyahaM // bAlAvabodharUpeNa / bahvArthamalpasUtrikAM // 3 // zrIbhadrabAhusvAmi / Avazyakanai dhuri maMgalIka bhaNI / paMca jJAna vikhANA AbhANibohiyanANaM / suyanANaM ceva ohinANaM ca / taha maNapajjavanANaM kevalanANaM ca paMcamayaM // 1 // aa0|| prathama mAtajJAna / zrutajJAna 2 etc.

Page #426
ron.] III. 4 Malasalras 389 Ends.-- fol. 134 havai IhAM siddhAMtanai avasari / zrutajJAnanu adhikAra jANiSu / jeha bhaNI zrutajJAnai karI / anerA savi huM jJAnanA anuyoga artha jaNAi / jeha bhaNI zrutajJAna ApaNuI svarUpa prakAzai / anai anerA jJAnanuM svarUpa prakAzai / jima dIvau ApaNaM ( ? ) prakAzai | anai anerAi padArtha prakAza karai / iha pradIpanu dRSTAMta jANivaM / jeha bhaNI zrutajJAna ApazuMDa svarUpa prakAzai | amai anerA jJAnanuM svarUpa prakAzai / jima dIvau ApaprakAzai / anai anerAi padArtha prakAza karai / iha pradIpanu dRSTAMta jANivu / tima zrutajJAna jANivaM / cha / 1 zrIsomasuMdara yugottamasUriziSyaH / Avazyakasya dhuri saMsthitapIThikAyA / saMvegadeva gaNiriMdra tithi : ] 151 (6) 4 prame ( S)bde // bhavatu // zrI Avazyakasya prathamapIThikA bAlAvabodhaH samarthitaH / zubhaM pIThikA bAlAvabodha No. 1015 bAlabodhamatanona (t) svapadArthasiddhaye / 1 / Pithikabalavabodha 1232. 1891-95. Size. rogin. by sin Extent.-- 13 folios ; 11 to 24 lines to page; 30 to 58 letters to a line. Description.-- Country paper thick, rough and white; Devanagari characters; bold, small, clear and fair hand-writing ; borders ruled in two lines in red ink; red chalk used; foll 6(c) and 124 written in a very big hand ; fol. 64 numbered as I also; a yellow piece of paper of the same size as the fol. pasted to fol. 13b; similar is the case with fol. 1"; corners of the first two foll. slightly worn out; condition good; fol. ro+- contains tabulated results; complete, Age.-- Samvat1872.

Page #427
Jaina Literature and Philosophy [ HOI Begins.-- fol. 1 zrIzAMtinAthAya namaH // zrIvarddhamAnA(?na)jinanAyaka eSa satyaM / pra(prA)bhAtikaH kila sahasrakaro ti(? vibhAti yahevItA(?)kiraNaH prasAraiH prakAzaH sa jAyateM sakalavastuvI(vi)kAzadakSaH 1 zrIsomasuMdaragurUna bhaktyA zrIratnase(ze)Sa(kha)ragurUMzca zrImat tapA'gaNeMdrAn natvA zrutadevatAM caiva 2 zrImadAvazyakasyAdA(dau) pIThi(Thi)kA(kAM) vivRNomyahA( haM) bAlAvabodharUpeNa bahvArthAmalpasUtrikA 3 etc. zrIbhadrabAhusvAmI zrIAvazyakane dhure pahelaM maMgalIka bhaNI pAMca jJAMna vaSANe che. AbhiNI(Ni )bohI(hi)yanANaM AbhinIbodhIka jJAna kahIiM etc. -fol. 6deg zrIzAMtinAthAya namaH bhavyAnAmupadesA(zA)ya mArge vacanakA kathyate tatra prathama jIva anAdi kAlano mithyAtvI hato te have kAlalabdhi pAmIne traNya karNa kareM meM etc. Ends.- fol. 13* tIma zrutajJAMna ApaNuM e artha prakAse ane anerA e jJAnano'rtha ... . prakAseM IsyUM jANavU 80 __ iti zrIsomasuMdaraka (yu)gottamasUrISpIya saMvegadevagaNInA grathItA graMtha ceyaM zrIAvazyakapIThIkAbAlAvabodha saMpUrNa saMvat 1872 nA dharSe zrAvaNa zuda 7 garau dine lISItaM paM (0)nyAyasAgaragaNInA svAtmArthe 'mahIja'. grAme zrIsAMtinAthaprasAdAt bhadraM bhavatu zreNaM svAtmArthe(s)lekhi. N. B.- For other details see No. 1014. prathamAvaravarikA (paDhamAvaravariyA) Prathmavaravarika (Padhamavaravariya) 273 (0). A. 1882-83 No. 1016 Extent.- fol. 3degto fol. 6. Description.- Complete. For other details see No. 1011. 1 This is also styled as Laghuvaravarika See. p. 391.

Page #428
1017.1 III. 4 Malasatras 391 Subject.- 178 verses in Prakrit forming a part of the Avasyata: sutraniryukti. Begins.-- fol. za titthayare bhagavaMte aNuttaraparakkame amianANI / tinnesu gaigaigae siddhipahapaesae vaMde // 1 // etc.' Ends:- fol. 6 tinneva ya kohisayA aTTAsIyaM ca huMti koddiio| asiyaM ca sayasahassA evaM saMvacchare dinaM / / 178 // paDhamAvaravArayA sNmmttaa| Reference.- Published. See No. I002. prathamAvaravarikA Prathamavaravariko bAlAvabodha balavabodha 1347 (0). No. 1017 1891-95. Extent.- fol. 13deg to fol. 224. Description.-- Complete. For other details see No. 631. Subject.- Prathamavaravarika here styled as Laghuvaravarika is explained in Sanskrit and at times in Gujarati. Begins.- fol. 13 titthayare0 / ahaM tIrthakarAn sadA vNde| kiMviziSTAn tIrtha karAn / bhagavataH pUjyAn / punaH kiM tIrtha / anuttaraparAkramAm / punaH kiM. tii| amitajJAninaH / punaH kiM tii| tIrNAn / punaH kiM. tiithe| sugatigatigatAn / punaH kiM tIrtha / siddhipradezakAn / 1 etc. Ends.- fol. 22 tinneva ya0 / trINi koTizatAni / aSTAzItizatasahasrAH lakSAH / etatsaMvatsare dattaM / triNisaI koDi / aThiyAsI koDi / ahIsI lakSa / etalaDaM suvarNadAna / paramezvariI gharasadivasiI dIdhaDaM // 82 // iti laghuvaravarikA saMpUrNA // zrIbrahmavADizrImahAvIrAya namaH / zrIrastu ra(osmAkaM // I Malayagiri Suri before commenting upon this verse says : "ttropoddhaatsyaadimglmaah|" 2 This is 242th verse in the edition containing Malayagiri Suri's commentary.

Page #429
392 'dvitIyAvaravarikA (fageneraffen ) Begins. fol. 6a No. 1018 Extent. fol. 6a to fol. 12a. Description.-- Complete. For other details see No. 1011. Subject. This work also known as Vrddhavaravarika consists of 348 verses in Prakrit and forms a part of the Avasyakasutraniryukti. Jaina Literature and Philosophy Ends. fol. 12a [ 1018. Dvitiyavaravarika (Biiyavaravariya) 273 (d). A. 1882-83. vIraM Are pAsa malliM ca vAsupujjaM ca / ee muttUNa jiNe a' sesA Asi rAyANo // 1 // etc. bahiyAyanAyasaMDe ApucchittANa nAyae savvo / divase muhutta sese kumAraggA me samaNupatto // 348 // varavariyA biiyA saMmattA / Reference. Published. See No. 1002. facturarcaften No. 1019 Dviti yavaravarika 306 (a). A. 1882-83. Size.--10 in. by 4 in. Extent. 48-6=42 folios; 17 lines to a page; 60 letters to a line. Description. Country paper thin, rough and greyish; Devanagari characters with gears; small, legible, uniform and good hand-writing; borders indifferently ruled in red ink; red chalk used; foll. numbered in the right-hand margin; 1 This is also styled as Vrddhavaravarika. See p. 394. 2 The letter is gone as the corresponding portion is worn out.

Page #430
393 , 14-16. , 17-18 210 139 , 284-310 , 31-320 51 " . . tor9.] :: III. 4 Malasatras this Ms. starts with the 7th fol.; fol. 486 blank ; Dvitiyavaravarika ends on fol. 136; condition good; this Ms. contains the following 19 works in addition.-- (1) upasarga 70 verses foll. 136-145 (2) samavasaraNa 69 , (3) gaNadharAvalI 80(?), ,, 16-173 (4) sAmAcArI 64 , 5) upodghAtAnayukti 186-22 (6) namaskAraniyukti 220-25* (7) sAmAyikaniyukti .100 25-26deg (8) caturvizatistavaniyukti 26b-28 (1) vandananiyukti (10) pratikramaNaniyukti (II) ArtadhyAna 18 fol. 320 (12) dhyAnazataka 106 , foll. 32b-34 (13) pAriSThApanikAniyukti , 34-370 (14) pratikramaNaniyukti , 37-39 (15) yogasaGgraha ,, 39-40 ' (16) AzAtanA fol. 40 (17) asvAdhyAyaniyukti III , foll. 40-420 (18) kAyotsargAnakti ,, 424-456 (19) pratyAkhyAnaniyukti 21 verses plus a prose passage plus 90 verses , 45-48. Age.- Old Begins.- fol. I - vIraM aridanami pAsaM etc....... Ends.-- fol. 13a bahiyA ya nAyasaMDe etc., up to samApatto as in No. 1018. This is followed by // 48 biyA varavariyA saMmattA // cha / N. B.-- For additional information see No. 1018, I53 50 [J.L.P.]

Page #431
Jaina Literature and Philosophy [ 1999 dibIyAvaravArikAH . DvitiylvarevarikahIpikA dipika 1347(d). No. 1020 1891-95. Extent.- fol. 22deg to fol. 324. Description.- Complete. For other details see No. 631. Author.- Not mentioned. Subject. - A Sanskrit explanation of Dyitiyavaravarika. Begins.-- fol. 22 vIM apiTanemiH // vIra bhIvaImAnaM 1 ariSTanemi 2 pAce 3 mAliM 4 cAnyadvAsupUjyaM 5 / patA jinAn / muktvA / avizeSA jinAH rAjAnaH Asam // 1 / rAyakule muvijAyA0 ete paMcApi jinavarAH / rAjakuleSvapi jAtAH / paraM kumAravAse( 5)mi prabramitAH / kiMviziSTeSu rAja kuleSu / vizuddhavaMzeSu / etc. , - fol 3r" iti bhagavatokte / tvayA sAraNAMtikopasargo rakSaNIyaH / ityuktipUrva siddhArtha vyaMtaraM / bhagavatpAce muktvA / zako jagAma prAtaH kollAgasaMni dheze / SaSThapAraNake / bahulavipreNa / pAyasaM kSIrAnaM dataM / tatra devairvasadhArA kRtA suvarNadhArA | paMca divyAni jAtAni / 60 / iti zrIbRhataravarikAyAH dIpikA saMpUrNaH / zrIrastu / asyA varavarikAyAM kSepakagAthA 14 vRttyAdiSvapi na vyAkhyAtA | sA ca / Auha barasA / vyAkhyA | marAvakrI prAcyA mAmadhaM 1 etc. Ends.- fol. 32* trizalAkukSiH 25 zeSA aspaSTatayoktA bhavAH aMtargaNyA na / saMsArazabdena ekeMdriyaH vikaleMdriyatvAptireva jJeyAH / na ca vAcyaM / devAnaMdA. vakSisthitiH kathaM bhavanvena gaNyate / samavAyAMge uktatvAt / 74 / iti vRddhavaravarikAyAH sAroddhAro likhito'sti / cha /

Page #432
1844.] upasarga ( uvasagga ) Ends.-- fol. r3b No. 1021 Extent.-- fol. 12s to fol. 13b. Description.-- Complete. For other details see No. IoII. Subject.-- 7o verses in Prakrit forming a part of the Avasyakasutraniryakti throw light on terrible hardships undergone by Lord Mahavira. Begins. fol. 122 upasarga No : 1022 govanimittaM sakkssa AmenI vAgareha deviMdo kulamabahula chuTTasta pAraNe payasabahA' // 1 // etc. Extent. 111: 4 Mess Reference.-- Published. See No. 1002. jaMbhiya bahi ujjavAliyatIraviyAtha (? vatta sAmasAla ahe / chaTTeNukkaDuyasta oDappanaM kevalaM nANaM // 70 // 3 Begins. fol. 13b upasargA saMmattA // cha // Bads. fol. 14 395 Upasarga (Uvasagga) govanimitaM samasta etc. 273 (e). A. 1882-83. fol. 13b to fol. 144. Description.-- Complete. For other details see No. io19. N. B. For further particulars see No. 1021. Upasarga 306 (b). A. 1882-83. jaMmiya bahi etc. up kele nANaM // 70 as in No: to21. This is followed by upasargAH samAptAH // 1 One letter is gone, as the corresponding portion is worm-eaten. 2 This verse occurs as 525th on p. 298b in the edition containing Malayagiri Suri's commentary on avasyakasutra.

Page #433
396 Jaina Literature and Philosophy [ron. upasargavyAkhyA Upasargavyakhya No. 1023 _1347 (7). 1891-95. Extent.- fol. 324 to fol. 360. Description.--- Complete. For other details see No. 631. Subject.- Explanation in Sanskrit of Upasarga. Begins.-fol. 32* zrIvIreNa dIkSA gRhItA / yairupasargaH soheH| kevalajJAnamutpanna / sa vicAro likhyate / bahiyA ya0 / 1 / sa bhagavAn 'kSatriyakuMDa'grAmAd bahiH jJAtakhaMDavane | sarvAna jJAtakAna ApRcchya muktalApya / muhUrtazeSe / divase sati 'kumAragrAma'manuprAptaH / / etc. Ends.-tol. 36deg 'jUMbhikA grAmAt bahiH 'kajuvAlikA nadItIre / veyAvaccaM / caityatvAda vyAvRttaM ptitcaitymityrthH| tasyAsanne zyAmAkagRhapatikSetre / sAlataroraghaH SaSThatapasotkaTikAsthasyaH kevalamutpede / 69 iti zrIAvazyakadIpikAnusAreNa / zrIvIropasargavicAro'lekhi / cha / . gaNadharAvalI Ganadbaravali gaNaharAvalI) (Ganaharavali) 273(f). No. 1024 A.1882-83. Extent.- fol. 13 to fol. 164.. Description.- Complete. For other details see No. IOLI. Subject.-These 158 verses in Prakrit form a part of Avasyaka-. sutraniryukti and deal with episodes pertaining to the Ganadharas of Lord Mahavira." Begins.- fol. 13deg jo ya tavo aNucino vIravareNaM mahANubhAveNaM / chaumatthakAliyAe ahakkama kittaissAmi // 1 // ' etc. 1 Ibid., P. 298b, v. 529.

Page #434
39 . 1025. ] . . .III. 4. Malasatras . - fol. I0 chinami saMsayaMmI jiNeNa jaramaraNAvappamukkeNa / so samaNo pavvaio saha khaMDiyasaehiM / / 133 // 1 gaNadharA sNmttaa| Ends.- fol. 16 arihaMte vaMdittA caudasapuvvI taheva dasapuTavI / ikkArasaMgasuttatthadhArae savvasADU ya / 158 ittha pae o(gha)nijjuttI vattavvA // gaNadharavaktavyatA smaaptaa| Reference.- Published. See No. 1002. gaNadharAvalI Ganadharavali No. 1025 306 (d). A.1882-83. Extent.- fol. 169 to fol. 17'. Description.-Complete. For other details see No. 1019. .. Begins.- fol. 16 taM divvadevaghosaM etc. Ends.-- fol. 17a arahate vaMdittA caudasapuvvI taheva dasapubdhI / ikkArasaMgasuttatthadhArae savvasADhU ya // 79 // ___ itthaMtare oghanijjuttI bhaNiyavvA / / cha // 5 // N. B.-For further Details see No. 1024. gaNadharAvalyavacUri No. 1026 . ... Extent.- fol. 40% to fol. 420. 1 Ibid., P. 337b, v. 641. Ganadharavalyavacuri ... .. 1347 (8) : 1891-95.

Page #435
Jasht Literature and Philosophy (10763 Description. This Ms. contains mostly the gates of Ganadhara vali. For other details see No.631. Subject.--Ganadhara explained in Sanskrit in short. Begins- fol. 40 taM divvadevaghosa / souNaM mAhaNA tahiM taTTA / aho siraNa jhuuN| devA kira AgayA ihaya / 1 / / tatra madhyamApApAyAM / mAnuSA divyaM pradhAnaM / taM devAnAM vrajatAmAgacchatAM ca chopaM zabdaM zrusvA / tuSTA hRSTA / ekamavocat / aho iti aashvyeN| yAjJikena juSTaM yAgaH prArabdhaH etc. Ends.- fol. 42deg dazadhA sAmAcArI icchAmicchetyAdi kathayiSyate / padavibhAga sAmAcArI navamapUrve // 24 / gaNaharA samattA // arihaMte vaMditA / eSA oghaniyuktirAdimA / atraughaniyuktirvaktavyA / iti maNadhAva ..... lyA'vacUriH chH|| samavasaraNa .. . Samavasarana (samosaraNa) (Samosarana) 30616). No. 1027 A.1882-83. Extent.- fol. 14 to fol. 164. Description.-- Complete. For other details see No. 1019. Begins.-- fol. 146 jo u tavo aNucinI etc. Ends.-- fol. 162 saMkhAIe vi bhave sAhaija vA puro ya pucchijjA / ....... ma uNaM aNAisasI biyANaI esa chaumattho / 69 // samavasaraNaM saMmattaM // cha / Reference.- Published. See No. 1002. ...... samavasaraNa - Poid:, p. 3rb; v. 592. 2 Ibid., P. 31ma, V.590.

Page #436
1929+ ] samavasaraNa avacUrisahita No. 1028 Extent. fol. 36b to fol. 402, Description. Both the text and the commentary complete. For other details see No. 631. Subject. Begins. -- ( text ) fol. 36b " III. 4 Malasatras "" jo a tavo aNucino / varivareNaM mahANubhAveNaM / chaumatthakAliyAe / ahakkamaM kittaissAmi / 1 / Ends.-- ( text ) fol. 404 Samavasarana together with its explanation in Sanskrit, Samavasarama with avacuri 1347 (f). 1891-95, 399 (com) fol. 36b vIravareNa brahmasthalakAle / yattapo'nucIrNa AsevitaM / kiMlakSaNena vIravareNa / mahAnubhAvena / mahAprabhAvaTha (? yuktena / tattapo yathAkramaM kIrttayiSyAmi / 1 / etc. saMkhAIe vi bhave sAhai jaM vA paro u purichajjA / na yaNaM aNAisesI biyANai esa chaumattho / ( 69 ) // -- ( com. ) fol. 40deg kA athavA paro'nyo pada pRcchati / tatsarve kathayati / anatizayI avadhyAdyatizayarahitaH sAdhuH enaM gaNadhAriNaM eka chamastha iti vijAnAti / 69 / iti samavasaraNasyAvacUriH // sAmAcArI ( sAmAyArI ) No. 1029 Extent. fol. 16 to fol. 17. Description.-Complete. For other details see No. 1011. See p. 396. Samacari (Samayari ) 273 (g). A. 1882-83.

Page #437
400 Jaina Literature and Philosophy [ 1030. Subject.- These 64 verses in Prakrit form a part of Avasyakasatra niryukti. Begins.- fol. 16- icchA micchAta hakkAro AvassiyA ya nisIhiyA / __ApucchaNA ya paDipucchA chaMdaNA ya nimaMtaNA // 1 // Ends.- fol. 17 evaM sAmAyAriM jujaMtA crnnkrnnmaauttaa| sAhU khavaMti kammaM aNegabhavasaMciyamaNataM // 64 // sAmAyArI smttaa| Reference: - Published. See No. 1002. sAmAcArI Samacari .. 306 (e). No. 1030 A. 1882-83. Extent.- fol. 17* to fol. 18. Description. Complete. For other details see No. 1019. Begins.- fol. 17. .... icchA micchA tahakkAro etc. Ends.-fol. 18 evaM sAmAyAki etc. up to sAMciyamaNataM // 64 // sAmAyArI saMmattA // cha / N. B.-- For further particulars see No. 1029.

Page #438
IOJI.] 111. 4 Malasatras : 401 dIpikAsahita : with Dipika No. 1031 1347 (h). 1891-95. Extent.- fol. 42s to fol. 450. Description.- Both the text and the commentary complete. For . . other details see No. 631. . Subject. -- Samacari along with its explanation in Sanskrit. Begins.- (text ) fol. 420 inchA 1 micchA 2 tahakkAro 3 AvAssaA ya 4 nisIhiyA 5 / ApucchaNA ya paDipucchA 7 / chaMdaNA ya 8 / nimaMtra(ta)NA Ne / 1 / ' uvasaMpadA 10 ya kAle 10 sAmAyArI bhave dasabihA u / etc. , -(com.) fol. 42deg atha dazadhA saamaacaariimaah| ... ( com.) fol. 42deg icchAkAra(:) 1 mithyAkAraH 2 tathAkAraH etc. sAdhuSu evaM sAmAcArI / dazavidheSa syAt / eteSAM padAnAM pratyekaM prarUpaNAM vakSye / 2 etc. Ends.- (text) fol. 450 evaM sAmAyAriM / jujutA crnnkrnnmaauttaa| sAhU khavaMti kammaM / aNegabhavasAMcaamaNataM / " ,, - (com.) fol. 45deg sAdhavaH enAM sAmAcArI jujutAnAM samAcaraMto aneka bhavasaMcitaM karma kSipayaMti / kiMvi0 karma / anaMtaM anaMtabhavopArjitaM / kivi0 saadhvH| caraNakaraNoyuktAH / caraNasaptanyAM / karaNasaptatyAM udyuktA udyamavaMtaH / 64 / iti sAmAcArIdIpikA smaaptaaH|| . . 1 This is 667th gatha of the niryukti according to the edition containing Malayagiri Suri's commentary. 2 Ibid., gatha;723. u U.L.P..]

Page #439
400 Jaina Literature and Philosophy [ 1032. upodayAtaniyukti Upodghkhairyukti (uvagyAyanijjutti) ( Uvagghaythijjutti) 273 (h). No. 1032 A. 1882-83. Extent.- fol. 17deg to fol. 21. Description.-Complete; the verses 78 and 79 rumbered on fol. 192 as 48 and 89 through oversight. For other details see No. 101H. Subject.-- These 216 verses in Prakrit form a part of Avasyakasutra niryukti. Begins. -- fol. 176 ajjhavasANa nimitte AhAre beyaNA parAghAe / phAse ANApANu sattavihaM jhijjhae AuM // 1 // ' Ends.- fol. 210 paJcakkhe (iva) daTTaNaM jIvAjIdhe ya punapAvaM ca / paJcakkhAyA jomA sAvajjA tealisaeNaM // 16 (216) / upodghAtaniyuktiH samAptA / . Reference.- Published. See No. 1002. upodghAtaniyukti Upodghataniryukti 306 (f). No. 1033 A.1882-83. Extent.- fol. 18 to fol. 22'. Description.- Complete. For other details see No. 1019. Begins. -- fol. 18b ajjhavasANa nimitta etc. 1 This is 724th gatha of the niryukti according to the edition containing Malayagiri Suri's commentary. 2 Ibid., gatha 873.

Page #440
to34. 1 Ends. fol. 22b III. 4 Malasatras pakhakkhe (iva) daTTaNaM etc. up to sAbajjA teyalirUpaNaM // as in No. 1032. This is followed by the line as under210 upodghAtaniryuktiH // cha // N. B. For further particulars see No. 1032. upodghAtaniryukti No. 1034 Size. 10 in. by 32 in. Extent. 20 folios; 14 lines to a page; 48 letters to a line. Description. Country paper thin, rough and white; Devanagari characters with gears; small, uniform, quite legible and elegant hand-writing; borders ruled in four lines in black ink; red chalk used; foll 1 to 25 missing; foll. numbered twice in the right-hand margin only once as 26, 27 etc., and once as 74, 75 etc.; fol. 29th torn; edges of some of the foll. slightly worn out; condition tolerably good; arafag ends on fol. 29b; then we have the following works in addition: : (1) amenavy No. 1038 foll. 29 to 33b (2) sAmAiyanijjatti 33b 37a (3) cabbIsatthayanijjutti,, 1046 37b (4) baMdaNanijjatti 4021 (5) paDikkramaNanijjatti (6) jhANasayaga This last work ends abruptly. dr 1042 rw Upodghataniryukti 615 (a). 1884-86. 33 dw Age.- Pretty old. 1 Foll. 386 and 39 do not seem to be interconnected. "" ,, 1050,, 40a 44b ,, IOS4 ", 44b 456 ,, 1057 ", 45b. 403 "" dw

Page #441
404 Jaina Literature and Philosophy [io3s. Begins. -( abruptly) fol. 26deg lakappA nayarI mittasirI karapiuDAI // 29 // . cohA(basa) do vAsasayA taiyAM siddhiM gayassa vIrassa / .. . aya(vva)ttaga veyAe samuppannA // 30 // etc. Ends.-- fol. 290 paJcakkhe daNaM etc. up to teyalieNaM as in No. 1032. This is followed by 77 // cha // 277 upodghAtaniyuktiH samAptA / / ch| N. B.- For additional information see No. 1032. upodghAtaniyukti Upodgbataniryukti vyAkhyAsahita with vyakhya No. 1035 __1347(i). 1891-95. Extent.- fol. 4gb to fol. 61. Description.- Both the text and the commentary complete. For other details see No. 6;1. Author of the vyakhya.- Ksamaratna Suri. Subject.-- Upodghataniryukti with vyakhya in Sanskrit. Begins.- (text ) fol. 45b ajjhavasANa 1 nimitta 2 AhAre veyaNA parAghAe / phAse ANApANu(e) sattavihaM jhijjhae AuM // 1 // etc. , -(com.) fol. 45deg gaNadharAvalyAM / dave addha ahAUya / asyAM gAthAyAM dravyakAla 1 | addhAkAla 2 / yathAyuSkakAla 3 / etat dvAratrayaM vyAkhyAtaM / tathopakramakAladvAre / duvihovkkmkaalo| asyAM gAthAyAM / caturthopakrama kAladvAre / sAmAcAryupakramakAlatrividho(s)pi vyAkhyAtaH / etc. Ends.-- (text) fol. 606 paJcakkhe iva daTuM jIvAjIve ya puNNapAve ya / paccakkhAyA jogA sAvajA tetalisaeNaM // (213?) 1 See page 406a of the edition referred to on p. 401.

Page #442
1037.5 111. 4 Malasatras 405 Ends. - ( com.) fol. 61 iti tetaliputrakathA samAptAH // atha gAthArthaH / tetalisatena maMtriNA jIvAnajIvAn / puNyaM pApaM ce pramukhAni nava tasvAni / pUrvabhavazrutajJAnena etAn padArthAna pratyakSAna dRSTvA sAvayA yogAH sAvadyavyApArA pratyAkhyAtAH syktaaH||214| uddese nidese0 gAthAvayadvArANi vyAkhyAtAni / upodAtaniyuktiH samUtrA vyAkhyAnasahitA likhitA / / zrIrastu / zrIkSamAratnasArabhiH kRtA // namaskAraniyukti Namaskaraniryukti (namokkAranijjutti) (Namokkaranijjutti) 273(i). No. 1036 A. 1882-83. Extent.- fol. 210 to fol. 24. Description.-- Complete. For other details see No. 1011. Subject.-- These 144 verses in: Prakrit form a part of Avasyaka sutraniryukti. Begins.-- fol. 210 uppattI niklevo payaM payattho parUvaNA vatthU / akkheva pasiddhi kamo paoyaNa phalaM namukkAro // 1 // Ends.- fol. 242 ihalogaMmi tidaMDI sAdivvaM mAuliMgavaNameva / paraloicaMDapiMgala huMDI jakkho ya diTuMtA // 144 // Reference.- Published. See No. 1002. namaskAraniyukti Namaskaraniryukti No. 1037 306 (8). A. 1882-83. Extent.-- fol. 22b to fol. 25+. Description.- Complete. For other details see No. 1019. I This is 887th gatha according to the edition containing Malayagiri Suri's commentary. 2 Ibid.; gatha 1025.

Page #443
406 Jaina Literature and Philosophy [1037. Begins.- fol. 220 uppattI niklegho etc. Ends. - fol. 258 ESITA Pardesi etc. up to pagar as in No. 1036. This is followed by // 39 (139.) namaskAraniyuktiH // cha / / N. B.-- For further particulars see No. 1036. namaskAraniyukti Namaskaraniryukti 615 (b). No. 1038 1884-86. Extent.-- fol. 29b to fol. 336. Description.-- Complete. For other details see No. 1034. Begins.- fol. 290 uppattI nikkhevo etc. Ends.-- fol. 336 TESTIA etc. up to iegar II as in No. 1036. This is followed by 45 // cha / / namokAranijjuttI sammattA // cha / N. B.- For other details see No. 1036. namaskAraniyuktivyAkhyA Namaskaraniryuktivyakhya No. 1039 ___1347 (j). 1891-95. Extent.- fol. 6r' to fol. 70. Description.- This Ms. contains the tales of Namaskaraniryukti. Complete. For other details see No. 631. Subject.- Namaskaraniryukti explained in Sanskrit. Begins.- fol. 61 uppttii| namaskArasyotpattirvAcyA 1 / nikSepo nAmAdi vicAraH 2 padaM padArthaH 4 prarUpaNA 5 vastu 6 bhAkSepaH ziSyamazaH 7 prazi

Page #444
1040.] III. 4. Malasatras 407 (siddhiruttaraM 8 kramaH 9 prayojanaM 10 phalaM 11 / etairekAdazabhirainamaskAro vyaakhyeyH||1|| etc. Ends.- fol. 70 cauro mRtH| namaskAraprabhAvAt yakSo devavizeSo'jani / A rakSakaistvaM cauryakAraka iti caurikAya / zUlikAyA ukSipya / jinadAse kSipyamANe / devIbhUtahuMDakena / puropari zilAM vikuLa / rAjAnaM bhApayitvA / jinadAso mocitaH / gajamAropya rAjJA pure / prAvezito mahena / namaskAra prabhAvopari / ete paMca dRSTAMtAH 5 // iti dRSTAMtaH // zrIrastu || sAmAyikaniyukti Samayikaniryukti (sAmAiyanijjutti) ( Samaiya nijjutti) No. 1040 273 (5). A. 1882-83. Extent.- fol. 24* to fol. 26deg. Description.-- Complete. For other details see No. 1011. Subject. These III verses in Prakrit form a part of Avasyakasutra niryukti. Begins.- fol. 24 naMdia(?ma)NuogadAraM vihivaduvagyAiyaM ca nAUNaM / kAUNa paMcamaMgalamAraMbho hoi suttassa // 1 // Ends.- fol. 260 savvesi pi nayANaM bahuvihavattavvayaM nisaamittaa| taM samvanayavisuddha caraNaguNaTrio sAhU // 11(111) // sAmAiyanijjuttI samAptA / Reference.- Published. See No. 1002. I This is 1026 gatha according to the edition referred to on p. 405. 2. Ibid., gatha 1067.

Page #445
408 sAmAyika niyukti No. 1041 Extent.-- fol. 25* to fol. 260. Description. Complete. For further details see No. 1019. Begins. - fol. 250 naMdimaNuogadAraM etc. Ends.-fol. 26b Jaina Literature and Philosophy savesi pi nayANaM etc. up to sAhU || as in No. 1040. This is followed by 100 sAmAiyanijuttI // cha // N. B. For other particulars see No. 1040. sAmAyikaniyukti No. 1042 Extent. - fol. 33b to fol. 372. Description.- Complete. 146+3= 149 verses. see No. 1034. Begins. fol. 33b [ 104 10 Samayikaniryukti 306 (h).. A. 1882-83. naMdimaNuogadAraM etc. Ends. -- fol. 37 * cha / Samayikaniryukti 615 (c). 1884-86. For further details vijjAncaraNanaesa sesasamoyAraNaM tu kAyavvaM / sAmAiyanijjuttI subhAsiyatthA parisamattA // 146 // cha // nAyaMmi gihiave agihiyavvaMmi ceva atyaMmi / jaiyameva ii jo ubaeso so nao nAma // 1 // savvesi pi nayANaM etc. up to sAhU // 2 // Then we have : esA cattAlasaeNa samattA suttapphAsiyanijjuttI / gAhANa parisamattaM tava sAmAiyajjhayaNaM / N. B. -- For additional information see No. 1040.

Page #446
1044.] sAmAyikaniryuktyavacUri Subject. Begins. Ill. 4 Malasatras No. 1043 Extent. fol. 70a to fol. 75b. com - Description. This Ms. contains afs of Samayikaniryukti ; plete. For other details see No. 631. Samayikaniryukti explained in Sanskrit. fol. 70* naMdimaNuogadAraM0 / naMdi anuyogadvAraM / vidhivadupodaghAtikaM ca jJAtvA | paMcamaMgalaM ca kRtvA / sUtrasya AraMbho bhavati // 1 // athavA kayapaMca0 / kRtapaMcanamaskAraH sAmAyikaM karoti / etc. caturviMzatistavaniryukti (cauvIsatthayanijjutti ) 409 Samayikaniryuktyavacuri 1347 (k). 1891-95. Ends. fol. 75 nAyaMmi0 / gRhItavye arthe jJAte eva / agRhItavye arthe jJAte evaM / yatitavyaM bhavati / iti yaH upadezaH / nAma iti komalAmaMtraNe / sajJAnanayo bhavati / gRhItavye arthe jJAte sati / agRhItavye artha jJAte sati / yatitavyameva / iti yaH upadezaH nAma iti komalAmaMtraNe / sa cAritranayo bhavati / 100 savvesiM0 / sarveSAmapi nayAnAM / bahuvidhavaktavyatAM nizamya / tatsarvvanayavizuddhaM bhavati / tatkiM / yaccaraNayaNasthitaH sAdhuH / tatsarve nayabi - zuddhaM // 101 / iti sAmAyikaniryukteravacUriH // Caturvirsatistavaniryukti (Cauvisatthayanijjutti ) 273 (k). A.1882-83. No. 1044 Extent. fol. 264 to fol. 272. Description. - Complete. For other details see No. Torr Subject.-- These 61 verses in Prakrit form a part of the Avasyakasutraniryukti. Begins. fol. 262 camatthayassa u nikkhevo hoI nAmanipphaMno / caubasigassa chakko thayassa ( u ) caukkao hoi // 1 // etc. 1 This is 1068th gatha according to the edition containing Malayagiri Suri's comm.entary. 52 [J. L. P.}

Page #447
410 Jaina Literature and Philosophy [ 1044 Ends.- fol. 27 caMdAiJcagahANaM pabhA payAsei parimiyaM khillaM / kevaliya(nANa)laMbho logAlogaM payAsei // 61 / / . cuviistthynijjuttii| ; Reference.-Published. See No. 1002. caturviMzatistavaniyukti Caturvirnsatistavaniryukti No. 1045 306 (i). A. 1882-83. Extent.- fol. 26deg to fol. 284. Description.-- Complete. For other details see No. 1019. Begins.-- fol. 266 cauSIsagatyayassa etc. as in No. 1044. Ends.-- fol. 28 caMdAiJcagahANaM etc., up to payAsei |as in No. 1041. This is followed by the line as under : 62 cauvIsatthayanijjuttI // cha / N. B.- For further particulars see No. 1044. cazitistavaniyukti Caturvimsatista vaniryukti No. 1046 615 (d). 1884-86. Extent.- fol. 37deg to fol. 404. Description.- Complete. For further details see No. 1034. . Begins.-- fol. 376 caudhIsagatthayasta etc. as in No. 1044. 1 This is youth gatha according to the edition of Avasyakasutra containing Haribhadra Suri's commentary.

Page #448
1047.] Ends.- fol. 40a caMdAiccagahANaM etc., up to payAsei // as in No. 1044. This is followed by 8 and the lines as under :cavIsatthagayassa u vi ( bi ) tiyajjhayassa esa nijjattI / gAhaggeNa samattA puMnnAe paMcasIe // 70 cavI satthayajjhayaNaM sammattaM // cha // lIl. 4 Malasutras N. B. For additional details see No. 1044. caturviMzatistavaniryuktidIpikA No. 1047 411 Caturvimsatistavaniryukti dipika 1347 (1). 1891-95. Extent.-- fol. 75b to fol. 78b. Description. This Ms. contains as of Caturvimsatistavaniryukti. Complete. For other details see No. 631. Subject. Caturvimsatistavaniryukti explained in Sanskrit. Begins.-- fol. 75b cauvIsagatthaya0 / caturviMzateH ca anyat / stavasya dvayoH padayoH nAmaniSpanno nikSepo bhavati / dvAbhyA (bhyAM ) padAbhyAMzcaturviMzatistava iti nAmaniSpannaM syAdityarthaH / caturviMzateH SaTko SadaprakAro nikSepo bhavati / stavasya catuSkazvatuHprakAro nikSepaH syAt / 1 / etc. Ends.-- fol. 78b asminnanAnupUrvIpAThe caturviMzatistavena / samyakRtyazuddhirAbhihitA / sA ca samyaktvazuddhirguNavatAM sAdhUnAM pratipattyA labhyate / tato guNavatsAdhupratipattyartha vaMdanakaM kriyate / anena saMbaMdhenAyAtaM vaMdanakaM tRtIyAdhyayanaM / tasya niryuktiH kriyate / iti caturviMzatistavasya dIpikAH / samAptAH // chaH // zrIH

Page #449
412 vandananiyukti (vaMdaNanijjutti ) Jaina Literature and Philosophy Ends. fol. 30b No. 1048 Extent. fol. 27a to fol. 30b. Description. Complete though this work seems to start with the latter portion of the second verse. For other details see No. 1011. Subject. These verses in Prakrit form a part of Avasyakasutraniryukti. Cf. the last verse of Sa mayari. Begins. fol. 37a daNacihnikaMmaM pUAkaMmaMca vijaya kaMmaM ca // 2etc. eyaM ki kaMmavihiM jaMjaMtA caraNakaraNamAuttA / sAhU khavaMti kaMmaM agabhava saMciyamaNataM // 190 // +- vaMdanAnijjuntI / gA. 1659 3 Reference. Published. See No. 1002. [1048. Vandananiryukti (Vandananijjutti) 273 (1). A.1882-83. vaMdaNacikiikammaM etc. Ends.-- fol. 31b arqalagif No. 1049 Extent. fol. 28a to fol. 31. Description. Complete. For further details see No. 1019. Begins. fol. 28a Vandananiryukti 306 (j). A. 1882-83. eyaM kikammavihiM etc., up to saMciyamaNaMtaM // as in No. 1048. This is followed by the line as under : 89 (189) vaMdanijjuttI saMmattA // cha // N. B. For additional information see No. 1048. 1 Ibid., gatha 1103. 2 Ibid., gatha 1230. 3 This seems to be the extent up to this work and not that of this work only.

Page #450
1051.) 111. 4 Malasairas 413 vandananiyukti Vandananiryukti No. 1050 ____615 (e). - 1884-86. Extent.- fol. 40 to fol. 44. Description.- Complete. For further details see No. 1034. . . Begins.-- fol. 40a _vaMdaNaciikiikammaM etc. Ends.-- fol. 44 . evaM kaikammabihiM etc., up to saMciyamaNaMtaM / 96 / .. vaMdaNInajjuttI sammattA // cha / N. B.- For additional particulars see No. 1048. - 1891-95. vandananiyuktidIpikA Vandananiryuktidipika 1347 (in). No. 1051 Extent.- fol. 78deg to fol. 850. Description.- Herein we find pratIkas of Vandananiryukti. Com plete. For other details see No. 631. Subject.- Vandananiryukti explained in Sanskrit. Begins.- fol. 78deg atha vaMdanAdhyayanasya dIpikA likhyate / baMdaNagAthA / 1 / kaigAthA / 2 / vaMdanakarma 1 citikarma 2 kRtikarma 3 pUjAkarma 4 vinaya karma 5 / etAni paMca nAmAni vaMdanakasya bhavaMti | etc. Ends.-- fol. 85deg gururAha / jaha / he ziSya yathA dUto / rAjAnaM natvA / kArya nivedya | pazcAdvisarjito(3)pi vaMdate / sAdhurapi evameva / prthmvNdnke| kSAmaNaM nivedya / pazcAkSAmananivedanarUpaM / nigamanavacanaM bhANitvA gacchati 74 / eyaM gAthA | sAdhavaH enaM kRtikarmavidhi(dhiM) yuMjAnAH kurvataH caraNakaraNayogayuktAH sAvadhAnAH / anekabhavasaMcitamanaMtaM karma kSipayaMti / 75 / iti vaMdanakaniyuktiIpikA samAptAH // chaH // zrIH // Then we have a part of Pratikramananiryuktivyakhya but as the yellow pigment is applied, it cannot be properly deciphered.

Page #451
Jaina Literature and Philosophy [1052. pratikramaNaniyukti Pratikramananiryukti (paDikkamaNanijjutti) (Padikkamananijjutti) 273 (m). No.1052 A.1882-83 Extent.- fol. 30deg to fol. 31'. Description. Complete (?). For other details see No. 1011. Subject.- These verses in Prakrit form a part of Avasyaka sutraniryukti. Begins.- fol. 30deg paDikamaNaM paDikamao / paDikkamiyanvaM ca ANuputrIe / . tIe pazcuppo aNAgae ceva kAlaMmi // 1' etc. Ends.- fol. 31 gao nAmanikkhevo atrAMtare sUtraM vAcyaM / , paDisiddhANaM karaNe kiccANamakaraNe ya0 // 52 // pddikkmnnnijjuttii|| Reference.- Published. See No. 1002. pratikramaNaniyukti Pratikramananiryukti No. 1053 306 (k). A. 1882-83. Extent.- fol. 31deg to fol. 320. Description.-- Complete. For further details see No. 1019. Begins.- fol. 310 paDikkamaNaM paDikkamao etc. Ends- fol. 320 saha pANAivAyaM paJcakakhApa tti aliyavayaNaM ca / rAdhamadinAdANaM abbaMbha pariggaha svAhA / / 51 // paDikkamaNanijjuttI saMmattA / / ch| N. B.- For additional information see No. tos2. 1 This is gatha 1231 according to the edition of Avasyakasutra, containing its niryukti and Haribhadra Suri's commentary. 2 Ibid., gatha 1270.

Page #452
10851 111. 4. Malasatras 415 pratikramaNaniyukti Pratikramananiryukti No. 1054 _615 (f). 1884-86. Extent.- fol. 44s to fol. 450. Description.- Complete. For further details see No. 1034. Begins.-- fol. 440 paDikkamaNaM paDikkamao etc. Ends.- fol. 450 savvaM pANAraMbha paccakkhAi aliyabayaNaM ca / savvaM ca adattAdANaM abaMbha pariggahaM svAhA // 53 paDikkamaNanijjuttI sammattA // cha / cha / N. B.-- For other particulars see No. 1052. dhyAnazataka . Dhyanasataka (jhANasayaga) (Jhanasayaga) 273 (n). No. 1055 A.1882-83 Extent.- fol. 31b to fol. 330.. Description.-- Artadhyana goes up to the 18th verse ; thereafter the numbering of verses is continuous; complete; in all 106 verses. For other details see No. 1011. Subject.-- These verses in Prakrit are looked upon as forming a part of Avasyakasutraniryukti though its author is Jinabhadra Gani Ksamasramana. Begins.- fol. 316. vIraM sakajjhANaggidaTTakamiMdhaNaM paNamiUNaM / jogIsaraM saralaM jjhANajjhayaNaM pavakkhAmi // 1 ' etc. I Ibid., p. 5824.

Page #453
476 Jaina Literature and Philosophy ( 1055 ... - fol. 310 tadavirayadesavirayA pamAyaparasaMjayANugaM jhANaM / samvapamAyamUlaM baje(?)yavvaM jaijaNa // 18 // / - fol. 310 .: sattabaha [ceva] baMdhaNaDahaNakaNa bare(?mAra)NAipaNihANaM / / / aikohaggahaghatthaM nigghiNamaNaso'hamavivAgaM // 19 // Ends.- fol. 330 paMcuttareNa gAhAsaraNa jhANassa ye samakkhAyaM / jiNabhadakhamAsamaNehiM kamavisohIkaraM jaiNo // 106 // 3 jhANasayaM saMmattaM / Reference.-- Published. See No: 1002. dhyAnazataka Dhyanasataka 306 (1). No. 1056 A.1882-83. Extent.- fol. 320 to fol. 34'. Description.-- Complete. For further details see No. 1019. Here, through oversight Artadhyana is separately counted. Begins.- fol. 320 __ vIraM vajjhANasa etc. . fol. 326. .::.:..tavirayadesa etc. up to jaijaNeNa // 18 as in No. 1055. This is followed by ajhaM jhANaM saMmattaM // cha / . . . - fol. 32b . . . . sattavahavehabaMdhaNa etc.. . Ends.- fol. 340 paMcuttareNa gAhA etc. up to jayaNo // 106 jhANasayaM saMmattaM // cha / N. B.-- For additional information see No. IOSS. . 1-2 Ibid., P.5884. 3. This gatha is not given in the edition referred to on p. 410.

Page #454
1057.] dhyAnazataka No. 1057 III. 4 Malasatras Extent. fol. 45b. Description.-- Incomplete. For other details see No. 1034. Begins. fol. 45b vIraM vajjhANaggi etc. Ends.- fol. 45b pAriSThApanikAniryukti ( pAriTThAvaNiyAmijjunti ) Dhyanasataka 615 (g). 1884-86. amanANaM sahAibisayavatthUNa dosamailassa / dhaNiyaM viogaciMtaNamasaMpaogANusaraNaM ca // 6 // taha sUlasIsarogAdiveyaNAe viumapavihANaM / tayasaMpacitaNa tappa. This ends thus . N. B. -- For further particulars see No. 1055. 417 Paristhapanikaniryukti ( Paritthavaniyanijjutti) 273 (0) A. 1882-83. No. 1058 Extent. - fol. 33b to fol. 364. Description.-- Complete. For other details see No. rori. Subject. It is doubtful how far these verses in Prakrit form a part of Pratikramananiryukti, a section of Avasyakasutraniryukti, though so suggested on p. 372. Begins--. fol. 33 pArihANiyavihiM bu(bu)cchAmI dhIrapurisapanantaM / jaM nAUNa bihiyA pravavaNasAraM upalati // 14 etc. 1 In the edition noted on p. 410, we have 83 verses and they are commented upon by Haribhadra Suri. The editor of this edition has not included them as a part of Avasyakasutraniryukti but has numbered them separately. 2 This is the 1st gatha according to the edition of Avasyakasutra containing Haribhadra Suri's commentary. It occurs on p. 61ga. $3 [J. L. P. J

Page #455
418 [ 1058. Jaina Literature and Philosophy Ends.- fol. 360 ___ gurumUle vi vasaMtA aNukUlA je na huMti hu guruunnN| . eesiM tu payANaM dUraMdUraNa te huMti // 53 (153) // pArijja(?)vaNiyanijjuttI saMmattA / Reference.- Published. See No. 1002. pAritApanikAniyukti Paristhapanikaniryukti No. 1059 306 (m). A. 1882-83. Extent.- fol. 34 to fol. 370. .. . Description.- Complete. For further details see Nos. 1019 ____and ro56. Begins.- fol. 34 pAriTThAvaNiyavihiM etc. Ends.-- fol. 376 . Tope etc. up to a giat ll as in No. 1058. This is followed by 153 pAridvAvaNIyAnijjuttI saMmattA // cha / N. B.- For additional information see No. I058. pratikramaNasagrahaNI Pratikramanasamgrabani (paDikkamaNasaMgahaNI) ( Padikkamanasarmgahani) 273 (p). No. 1060 A. 1882-83. Extent.-- fol. 36to fol. 376. Description.- Complete. For other details see No. TOIL. Subject.-- These 80 verses in Prakrit appear to form a part of Pratikramananiryukti, a section of Avasyakasutraniryukti, but it is not so according to the edition noted on p. 410. 1 Ibid., gatha 83. Vide p. 6446.

Page #456
419 1062.] III. 4 Malasatras Begins.- fol. 360 jahaM jaMbupAyavego supkkphlbhaarnmiysaahggo| diTTo chahiM puresehiM te biMtI jaMbubhakkhemo // 1 ' etc. Ends.-- fol. aha me nava darisaNaMmi cattAri Aue paMca / Aime aMte sese do do bheyA khINabhilAveNa igatIsaM / / 80 // paDikkamaNAsaMgahaNI Reference.- Published. See No. 1002. pratikramaNasaGgrahaNI Pratikramanasarngrahani No. 1061 306 (2). A. 1882-83. Extent.-- fol. 37 to fol. 39. Description.-- Complete. For further details see Nos. 1019 and 1056. In No. 1019, through oversight, the title of this __work is wrongly stated as pratikramaNaniyukti. Begins.-- fol. 370 jaha jaMbupAyavego etc. Ends -- fol. 396 aha(vA) kaMme nava darisaNaMmi etc. up to igatIsaM // 8 // as in No. 106o. This is followed by paDikamaNasaMghayaNI saMmattA // N. B.- For additional particulars see No. 1060. . yogasagraha Yogasargraha (jogasaMgaha) (Jogasamgaha) - 273 (q). No. 1062 A. 1882-83. Extent. --fol. 37 to fol. 38. Description.- Complete. For other details see No. 1011. I 2 3 Cf. gatha 1. Vide p.6454. Letters vA and h are gone, since the corresponding portion is worm-eaten. This verse is numbered as 1 on p. 6630.

Page #457
420 Jaina Literature and Philosophy [1062. Subject.-- These 60 verses in Prakrit form a part of Pratikramana niryukti, a section of Avasyakasutraniryukti. See p. 372. Begins.- fol. 370 AloyaNa niravalA AvaIsa dddhdhmmyaa| aNissiobahANe ya sikkhA na(Ni)pa(ppa)DikaMmayA // 1 // etc. ' Ends.-- fol. 38deg pAyacchittaparUvaNa AharaNaM tastha huMti dhnnguttaa| ArAhaNAi marudevA osappiNie paDhama siddho // 60 // saMmattA jogsNghaa| Reference.- Published. See No. 1002. yogasaGgraha Yogasarngraha 306(0). No. 1063 A. 1882-83. Extent.- fol. 39* to fol. 40'. Description.- Complete. For further details see Nos. 1019 and 1056. Begins.-- fol. 392 AloyaNa etc. Fnds.- fol. 40" pAyacchittaparUvaNa etc. up to paDhama siddho // 60 as in No. 1062. This is followed by jogasaMgahA // N. B.- For additional information see No. 1062. 1 2 This is 1374th gatha (p.6630)according to the edition noted on p. 410. bid., 132othigatha (p.724deg ).

Page #458
1065.] III.4Malasatras . 421 AzAtanA Asatana (AsAyaNA) ( Asayana ) 273 (1). No. 1064 A. 1882-83. Extent.-- fol. 38deg to fol. 394. Description.-- Complete. For other details see No. 1011. Subject.-- These verses in Prakrit do not form a part of Prati- - kramananiryukti, a section of Avasyakasutraniryukti according to the edition noted on p. 410-the edition-wherein they are attributed to a samgrahanikara by Haribhadra Suri. Begins.-- fol. 386 parao pakkhAsane gaMtA ciTTaNa[Na nisiaNAyamaNA / AloyaNa paDisuNaNe pubAlavaNe a Aloe // 1' etc. Ends.-- fol. 39* ahavA arihaMtANaM AsAyaNAi sajjhAya kiMci nAhIyaM / "kaMThasamuddidA tittItAsAyaNA e(yaa)||5|| AsAyaNA smmttaa| Reference.- Published. See No. 1002. AzAtanA Asatana 306 (p). No. 1065 A. 1882-83. Extent.- fol. 40. Description.-Verses 6r to 64. For further details see Nos. 1019 and 1056. 1 Ibid., 1st gatha (p. 725a ). 2 There is a lacuna viz. jA in the Ms. itself. 3 In the edition noted on p. 410, this is the 1st gatha (p. 727b). this verse we have in the printed edition: "pratikramaNasaMgrahaNI samAptA". After

Page #459
422 Jaina Literature and Philosophy [1065. Begins.-- fol. 402 'purao pakkhAsane etc. Ends.-- fol. 40% ahavA arihaMtANaM etc. up to tittIsAsAyaNA as in No. 1064. This is followed by e u 64 AsAyaNA saMmattA N. B.- For additional information see No. 1064. asvAdhyAyaniyukti Asvadhyayaniryukti (asajjhAyanijjutti) (Asajjhayanijjutti) 273 (s) No. 1066 A. 1882-83. Extent.- fol. 390 to 41. Description.- Complete. For other deteils see No. 1011. Subject.- These III verses in Prakrit form a part of Pratikramana ___niryukti, a section of Avasyakasatraniryukti. See p. 372. Begins.- fol. 394 asajjhAiyanijjuttiM bukhu)cchAmI dhIrapurisapaMna / jaM nAUNa muvihiyA pavayaNasAraM uvalahaMti // 1 // ' Ends.- fol. 418 asajjhAiyanijjutti jujaMtA caraNakaraNamAuttA / sADU khavaMti kama aNegabhavasaMciyamaNataM // 111 / / 3 sjjhaaiynijjuttii| Reference.-- Published. See No. 1002. In the Ms. this is not numbered as I but is given in continuation with yogasaMgraha and hence numbered as 61. 2 This is gatha 1321 according to the edition (p. 7316 ) containing Avasyaka sutra, its niryukti and Haribhadra Suri's commentary. It may be compared with the 1st verse of No. 1058. 3 Ibid., gatha 1417 (p. 7596 ). Cf. the last verses of Nos, 1029 and 1048.

Page #460
1068.] III. 4. Malasatras 423 asvAdhyAyaniyukti Asvadbyayaniryukti No. 1067 306 (q). A. 1882-83. Extent.- fol. 40deg to fol. 42. Description.- Complete. For further details see Nos. 1019 ___and I056. Begins.- fol. 40* __ asajjhAiyAnajjuttiM etc. Ends.- fol. 420 asajjhAiyanijjutti etc. up to saMciyamaNataM as in No. 1066. This is followed by 11 asajjhAiyanijjuttI saMmattA cha / / N. B.- For additional information see No. 1066. kAyotsarganiyukti Kayotsarganiryukti (kAuslagganijjutti) ( Kaussagganijjutti ) No. 1068 273 (t). A. 1882-83. Extent.-fol. 41 to fol. 444 Description.- Complete. For other details see No. 1011.. Subject.- These 172 verses in Prakrit form a part of Avasyaka sutraniryukti. See p. 372. Begins.- fol. 418 AloyaNa paDikkamaNe mIsa vivege tahA viussgge| tavaccheya mUla aNavaTTayA ya pAraMcie ceva / / 1 // etc. Ends.- fol. 44a tamhA u nimameNaM muNimA uvaladdhasa(su)ttasAreNaM / kAussaggo uggo kaMmakkhayaTrAya kAyavyo / / 172 // ' kAussagganijjuttI gA0 2398 // cha / Reference.- Published. See No. 1002. | Ibid., gatha 1418 (p. 764a). 2 Ibid., gatha 15546p.8orb). .

Page #461
306(r). 424 Jaina Literature and Philosophy [1069. kAyotsarganiyukti Kayotsarganiryukti No. 1069 A. 1882-83. Extent.-- fol. 42deg to fol. 456. Description. - Complete. For further details see Nos. 1019 and 1056. Begins.-- fol. 42" restaurant etc. Ends.- fol. 456 tamhA u nimmameNaM etc: up to kAyanbo // 172 as in No. 1068. This is followed by T3 Fratray at dan II g 11 N. B.- For additional information see No. 1068. pratyAkhyAnaniyukti Pratyakhyananiryukti ( 497 Sena) ( Paccakkhananijjutti ) No. 1070 273 (u). A. 1882-83. Extent.- fol. 44* to fol. 466. Description. - Complete. For other details see No. 1on'. Subject. The first few verses are followed by a passage mostly in prose. This passage is a part of Avasyakasutra. Then the verses commence with 24th and go up to 94. They form a part of Avasyakasutraniryukti. Begins.-- fol. 44 e(pa)JcakkhANaM paJcakkhAo paccakkheaMca ANupubbIe / gitar gurat T F T IT TEHOT 112 etc. 1 Herein there is a misprint. Fiemaal begins from fol. 44a and goes up to fol. 466. The entries viz. foll. 44a to 446 and foll. 446 to 45a should face YFIEITHAI. Furthermore, there should be a number 20 inside the brackets facing this work. 2 This is gatha 155s (p. 803") of the edition referred to on p. 410.

Page #462
1070.1 HII. 4 Malasairas 425 - fol. 44deg tattha samaNovAsao puvAmeva micchattAo paDikkamaha / sammattaM uvasaMpajjai no se kappai ajjappamiiM / ' aMnautthie vA annautthaadevayANi vA / aMnautthiyapariggahiyANi vA / arihaMtacaiyANi vaMdittae vA | etc. pasamasaMvegAiliMge subhe AyapariNAme panatte / sammattassa samA(?maNoSAsaeNaM ime paMcaiyArA jANiyavvA etc. - fol.45 sAmAiyaMmi u kae samaNo [i kae samaNo] iva sAvao havai jmhaa| eeNa kAraNeNaM bahuso sAmAyiyaM kujjA // 12 // savvaM ti bhANiUNaM viraI khalu jassa sabviyA nAtthi / so s(b)virivaaii| cukkA desaM ca savvaM ca // 13 // " sAmAiyassa samaNovAma(sa)eNaM ime paMca. // maNaduppaNihANe / vayaduppaNihANe kAyaduppaNihANe / sAmAyiyassa saiakaraNayA / ' etc. - fol. 450 jaM(?) ta(ja?)hA ihaloAsaMsapaoge | jIviAsaMsappa oge | maraNAsaMsappaoge / kaambhogaasNsppoge|| cha // 7 (Pratya ) paccakkhANaM uttaraguNesu / khamaNAiyaM / aNegavihaM teNa ya ihayaM / pagayaM / taM pi ya iNamo dasavihaM tu // 24 // Ends.- fol. 46. samvesi pi nayANaM bahuvihavattavvayaM nisaamittaa| taM savvanayavisaddhaM jaM caraNaguNaTrio sAhU // 94 // paccakkhANanijjuttI sNmttaa| Reference. Published. See No. 1002. See Buhler's Report for 1872-73 where there is given a photo-print of a page of the Avasyakasutra. A facsimile of the last page of a Ms. of the Avasyakasutra dated Samvat 1189 is given in Rajendralal Mitra's "Notices of Sanskrit Mss. vol. III, facing p.67.10 - 1-2 Ibid., p. 811a. 3 Ibid., p. 811. There this portion along with those marked as I and 2 form a part of Avasyakasutra. 4-6 Ibid., p. 831b. There these portions form a part of Avasyakasutra. 7 See p. 839a where this passage occurs as a part of Avasyakasutra. 8 Gatha 1563 (p. 8400 ). 9 Gatha 1623 (p. 8640). 10 Similarly a facsimile of the last page of a Ms. of Kalpasutra supposed to be about 350 years old is given in the same volume on a page facing 66. 54 [J.LP.]

Page #463
426 Jaina Literature and Philosophy pratyAkhyAnaniyukti No. 1071 Extent. fol. 45b to fol. 48a. Description. Complete. For further details see Nos, 1019 and 1056. Begins. fol. 45b qeezeni qarate etc. as in No. 1070. have: [1071: Ends.- fol. 48" fa etc. up to as in No. 1070. Then we 90 paJcakakhANanijjuttI saMmattA // cha // zrImadAvazyakasUtraM // cha // zubhaM bhavatu // cha // etc. Pratyakhyananiryukti 306 (s). A. 1882-83. N. B. For additional information see No. 1070. pratyAkhyAnaniyukti No. 1072 Size.-9 in. by 37 in.. - Extent. 38 14 + 64 15 = 73 folios; 14 lines to a page; 46 to 54 letters to a line. Description. Pratyakhyananiryukti 1220 (1). 1884-87. Country paper thin, rough and white; Devanagari characters with occasional qurars; small, legible, uniform and good hand-writing; borders ruled in four lines in black ink; red chalk used; foll. numbered in the right hand margin; condition very good; this Ms. seems to be a combination of two different Mss.; the 1st of them goes from fol. 105 to 142b and has both the beginning and the end abrupt; the second runs from fol. 189a to fol. 252; the latter is written in a slightly thinner, smaller and better hand-writing; af incomplete as this Ms. begins abruptly; foll. 122 to 135, 143 to 188 and foll. 205 to 219 missing; this Ms. contains the following additional works:

Page #464
>> 790 796 ,, 800 814 " 746. ,,753 1072.] III.4 Malasatras 427 (1) laghukSetrasamAsa . foll. Ios to 108'. (2) piNDavizuddhi No. 413 , 1080 ,, IIT. (3) zrAvakavaktavyatA , III , II4. (4) paJcaliGgIprakaraNa ,, II , II7. (5) zIlopadezamAlA ,, 17 ,, 138. (6) vItarAgastotra ,, 138deg ,, 1420. (7) praNipAtasUtra ,884 fol. 189. (8) IryApathikIsUtra (9) uttarIkaraNasUtra (10) kAyotsargasUtra (II) nAmastava (12) caityastavapratIka ,, 826 (13) prabodhacaityavandana 5, 189] (14) 'darzanaM devAdi'stava (15) varakanakasUtra " " (16) tIrthavandanasUtra ,,749 (17) zakrastava (18) caityastava ,, 821 (19) kAyotsargasUtrapratIka (20) zrutastava ,,833 foll. 189,, I90 (21) zrutasya bhagavataH ,, 905 fol. 190*.. (22) siddhastava ,,835 (23) vaiyAvRttyakarasUtra (24) kAyotsargasUtrapratIka ,, 807 25) saMsAradAvAnalastuti ,, 849 (26) jAvaMti ceiyAI (27) jAvaMta ke vi sAhU ,, 763 (28) namo'hat ,, 897 (29) upasargaharastotra (30) prArthanAsUtra 786 (31) vandanakasUtra ,853. (32) devasikAlocanAsUtra ,859 (33) sambassa vi.. "9II . (34) gurukSAmaNAsUtra ,,867 (35)ekAzanAdipratyAkhyAna ,937 ___foll. 190deg ,, I9. (36) AcAmlapratyAkhyAna ,,950 _fol. I9I. (37) trividhAhAropavAsapratyAkhyAna, 934 " " . ,, 813 " 906 ,, 759 169

Page #465
428 " , Jaina Literature and Philosophy [1072. (38) divasacarimapatyAkhyAna No. 941 fol. 191 (39) sAmAyikasUtra , 871 , ". (40) sAmAyikapauSadhacAraNagAthA ,,883,, 1912 (41) jaya mahAyasa , 875 , , (42) zramaNopAsakapratikramaNasUtra ., 917 foll.,, to 192 (43) AyArIya uvajjhAe ,877 fol. 1920 (44) sirithaMbhaNayapAsanAhathui , 880 , 193" (45) aticAra ___" " (46) zrutadevatAstuti (47) bhuvanavAsinIdevIstuti (48) kSetradevatAstuti (49) jaya tihuyaNastotra foll. , , 1949. (50) ajitazAntistava ,, 194deg ,, 196. (51) ullAsikastotra (ajitazAntistotra)fol.1962 ,, 196deg. (52) namiUNa foll. 196deg ,, 197 (53) taM jayau ,, 1974 ,, 1981 (54) mayarahiyaM (smaraNa) fol. 198a ,, 178. (55) sigghamavaharau foll. 198b ,, 199*. (56) zrAvakavidhi fol. 1999 ,, 199". (57) dAnavidhi foll. 199deg ,, 2009. (58) namaskAraphala ,, 200* ,, 2014 (59) catuHzaraNa fol. 2016 ,, 201'. (60) saMyamamanarI foll. 2010 ,, 2020 (61) ajJAtanAmadheya ,, 204. (incomplete ) (62) catuHzaraNa ,, 220* ,, 221. (incomplete) (63) sUkSmArthavicAra ,, 221,, 2250. (64) karmavipAka ,, 2290. (65) AgamikavastuvicAra , 232. (66) karmastava ,, 233. (67) karmastavabhASya 2330 ,, 234. (68) zataka 234* ,, 236. (69) saptatikA , 236deg ,, 239*. (70) bandhasvAmitva , 239* ,, 240 (71) sagrahaNI ,, 240* ,,252. " 2024

Page #466
1073.] III. 4 Malasatras 429 On fol. 252b, a list of works mentioned here is given. Age.- Samvat I492. Begins.--abruptly fol. 1054 .......tteyaM piMDae navae // 46 do ceva namukkAro AgArA chaJca porisIe u / satteva ya purimar3e / egAsaNagaMmi aTreva / / 47 sattegadANassa u| aTevAyaMbilIma AgArA / paMceva abhattaTe / chappANe carimi cattAri // 48 etc. Ends.-fol. Iosb nAyaMmi ginhiyavve / agiNDiyanvamiceva atyami / jaiyatvameva iya jo / uvaeso so nao nAma // 70 savvesi pi nayANaM / bahuvihavattavayaM nisaamittaa| taM sanvanayavisuddhaM / jaM caraNaguNaTTio sAhu / / 71 paJcakkhANanijjuttI samattA / / yAdRzaM pustake dRSTaM tAdRzaM likhitaM myaa| yadi zuddhamazuddhaM vA / mama doSo na dIyate // cha // 2 // cha / zrI N. B.- For other particulars see No. 1070. AvazyakasUtraniyukti Avasyakasutraniryukti ziSyahitAsahita with Sisyabita 1091. No. 1073 1885-91. Size- 10g in by 41 in. Extent.- 351- I = 35o.folios ; 17 lines to a page ; 48 letters to a line. Description.- Country paper thin and greyish; Devanagari cha racters with pRSThamAtrAs; small, legible and elegant handwriting; borders ruled in four lines in red ink ; red chalk and yellow pigment used; numbers for foll. entered only once in a corner of the right-hand margin; nos

Page #467
430 Jaina Literature and Philosophy [1073. - "1, 2, etc. also written at times between the lines perhaps indicatirg the nos. of foll. copied out in a single day; fol. 35deg practically blank; fol. 168 lacking; several foll. slightly worm-eaten; edges of the last fol. slightly damaged3; fol. 250 somewhat smutty; condition on the whole satisfactory. Age.- Fairly old. Author of the commentary.- Haribhadra Suri. For his works see ___pt. II, p. 300 and this pt. III, pp. 105, 224 and 234. Subject. The text together with its explanation in Sanskrit. The latter is styled as Sisyahita. Begins.-- (text) fol. 2b . AbhinibohiyanANaM etc. as in No. 1081. ,, -(com.) tol. * namaH sarvajJAya / praNipatya jinavareMdraM etc. as in No. 1076. Ends.- (text) fol. 3514 ___ sambesi pi nayANaM etc. ,,' - (com.) ,, ,, sthitipakSamupadarzayannAha etc. up to gAthArthaH practically as in No. 1076. This is followed by the lines as under : ziSyahitAyAM pratyAkhyAnavivaraNaM samAptaM / ch| vyAkhyeyo'dhyayanamidaM yadavAptamiha zubhaM mayA puNyaM / zuddhaM pratyAkhyAnaM labhatAM bhajyo (vyo?) janamtena / samAptA ceyaM ziSyahitA nAma AvazyakaTIkA kRtiH sitAMbarAcArya jinabhadranigadANusAriNA / 'vidyAdhara kulatilakAcAryajinadattaziSyasya dharmyate( to) joiNImahattarAsUnoralpamAtarAcAryaharibhadrasya // cha / yadihotsUtramajJAnAdvayAkhyAtaM tad bhushrutaiH|| , kSAMtavyaM kasya saMmohAcchadmasthasya na jAyate yadA(da)rvi(rji)taM viracayatA subodhyAM puNyaM mayA''vazyakazAstraTIkAm / bhadhe bhave tena mamaiva mevaM bhUyAjjinoktau nu mate prayAsaH // anyacca saMtyajya samastasattvA - mAtsaryaduHkhaM bhavabIjabhUtaM

Page #468
1074.] 11. 4 Malasatras 43t sukhAtmakaM muktipadAvahaM ca sarvatra mAdhyasthamavApnuvaMtu // cha / samAptA ceyamAvazyakaTIkA / / cha dvAviMzatisahasrANi pratyekAkSaragaNanayA anuSTupchaMdasA mAnamasyA uddezataH kRtaM / / aMkato()pi 22000 zubhaM bhavatu zrI'tapAgacchasya / This is followed by the following line in a different hand:--- paMDitazrIvijayacaMdragaNiziSyapaM.vivekacaMdraga kalyANacaMdreNa prati bha(bhAM)DAgAre muktA // ..... Reference.- Published. See No. 1002.. . AvazyakasUtraniyukti Avasyakasutraniryukti ziSyahitAsahita with Sisyahita No. 1074 1181. 1886-92. Size. - 10 in. by 41 in. Extent.- (text) 380 - I - I = 378 folios; I to I lines to a page ; 45 letters to a line. >>-( com.) 378 folios ; 13 to 17 lines to a page ; 55 letters to a line. Description.- Country paper thin, rough and white; Devanagari characters with occasional pRSThamAtrAs; this Ms...contains the ... niryukti (text) and the commentary as well; it is a tripATI Ms; space for the text is reserved'; the text written in a bigger hand ; legible and good hand writing; borders . ... - ruled in four lines in black ink ; nos. for foll. entered twice * as usual ; fol. 12 blank ; fol. 222 also numbered as 223 ; the subsequent ones as 224 etc; similarly fol. 287 also numbered as 288 ; life-perods and heights of the 24 Tirthamkaras tabulated on foll. 72deg and 73%3 explanation by means of a digaram on fol. 323b; - tabulated results

Page #469
432 Begins. (text)fol. 3b Jaina Literature and Philosophy [1074. on fol. 330; yellow pigment used; red chalk, too, at times; margins of some of the foll. worm-eaten; edges of the first fol. slightly worn out; the last fol. some-what damaged; foll. 118 to 121 slightly damaged in the body; condition on the whole good; both the text and the commentary complete; extent 22500 slokas. dr dw fa etc. as in No. 1073. - (com) fol. 1 OM namo vItarAgAya namaH namaH sarvajJAya praNipatya jinavareMdra vIraM etc. as in No. 1073. Ends.(text) fol. 380b aft etc. - ( com. ) fol. 3800 sthitapakSa etc. up to uddezataH kRtaM as in No. 1073. This is followed by) 400. N. B. For other details see No. 1073. Sisyahita [ Avasyakasutra niryuktivivrti] fayfear [ Avazyaka sUtraAgiamagia] No. 1075 Size.-- 10 in. by 4 in. Extent. 545 folios; 15 lines to a page; 48 letters to a line. Description.- Country paper thin, rough and greyish ; Devanagari characters; sufficiently big, legible and good hand-writing; borders ruled in four lines in black ink; red chalk and yellow pigment used; a piece of paper of the size of a fol. pasted to fol. 1; same is the case with fol. 545b; foll. 1 and 545 blank; a strip of paper pasted to fol. 343b condition very good; complete. 131. 1873-74. Age.- Pretty old. Author. Haribhadra Suri. For his works see No. 1073..

Page #470
1076.] 111. 4 Malasatras 433 Subject. This work named as Sisyahita elucidates the Avasyaka sutraniryukti. There was a bigger commentary than this composed by Haribhadra Suri as suggested by himself (see p. 434; "Begins " v. 2). Begins. fol. rb namaH sarvajJAya / fati ai etc. as in No. 1076. sthitipakSa etc. practically up to uddezataH kRtaM as in This is followed by the line as below:graMthAgraM 22000 // cha // etc. See No. 1002. Ends. - fol. 5462 No. 1073. Reference. Published. ziSyahitA No. 1076 Size. 12 in. by 4 in. Extent. 213 folios; 15 lines to a page; 72 letters to a line. Description. Country paper very thin and greyish; Devanagari characters with gens; small, legible and good handwriting; borders ruled in four lines in black ink; the intermediate portion coloured red ; all the foll. have at least one disc in the centre; and each verso has two additional ones in the margins; only a few foll. are numbered twice; foll. 1 and 213b blank; red chalk and yellow pigment used; marginal notes added at times; a piece of paper of the same size as a fol. is pasted to fol. 1a and to fol. 213b as well; strips of paper are pasted to some foll. ; condition unsatisfactory; complete so far as IWTA is concerned; extent 12383 slokas. Age.- Old. Begins. fol. rb namaH zrIsarvajJAya | praNipatya jinavareMdraM vIraM zrutadevatAM gurUn sAdhUn / Avazyakasya vivRtiM gurUpadezAdahaM vakSye // 1 // 55 [J. L. P.] Sisyahita 366. 1880-81. .....

Page #471
434 Jaina Literature and Philosophy [1076. yadyapi mayA tathA(Da)nyaiH kRtA(s)sya vivRtistathApi saMkSepAt / . . tatrucisattvAnugrahahetoH kriyate prayAso'yaM // 2 // Ends.- fol. 213 sthitapakSamupadarzayannAha samvesi pi gAhA || vyA0 sarveSA etc. ubhayameva vA'napekSyamityAdirUpAM athavA nAmAdInAM nayAnAM kaH kaM sAdhumicchatItyAdirUpaM nizamya zrutvA tatsarvanayavizuddhaM sarvanayasaMmataM vacanaM yacaraNayaNasthitaH sAdhuryasmAtsarvanayA eva bhAvanikSepamicchaMtIti gAthArthaH // cha || AcAryaharibhadrakRtau ziSyahitAyAmAvazyakaTIkAyAM sAmAyikAdhyayanaM samAptaM // cha / sAmAyikasya vivRtiM kRtvA yadavAptamiha mayA kuzalaM / tena khalu sarvaloko labhatAM sAmAyikaM paramaM / yasmAjagAda bhagavAn sAmAyikameva nirupamopAyaM . zArIramAnasAnekaduHkhanAzasya mokSasya // 2 // graMthAyaM 12383 // ch|| etc. N. B.-For other particulars see No. 1075. ziSyahitA Sisyahita No. 1077 134. 1873-74, Size.-- 101 in. by 44 in. Extent.- 248 - 13 - 11 = 224 folios; IS lines to a page ; 56 letters to a line. Description.- Country paper thin and greyish; Devanagari cha racters with pRSThamAtrAs; small, legible and. good hand-writing; borders ruled in four lines in black ink; red chalk used; yellow pigment, too; nos. for foll. entered in a small hand between or near the lines in the right-hand margin: edges of the first and the last few foll. worn out; corners of several foll. damaged; foll. 139th and the following are more or less worm-eaten; condition fair ; marginal notes written here and there ; foll. so to 62 and 194 to 214 lacking; extent 12383 slokas. Age.- Samvat ISII. Begins.- fol. I' a|| sAMprata sAmAyikAdhyayanAnaMtaraM caturSizatisUtrAdhyayana mArabhyate / iha cAdhyayanodeze satrAraMbheSu etc.

Page #472
1078.] (niryukti) fol. 14 III. 4 Malasatras caDavIsagacchassa u nikkhevo hoi nAmanippanno / cavIsagassa chakkA thayassa ukkao hoi // ziSyahitA'ntargata kumAranandikathA 435 Ends. -- sthitapakSa etc. up to mokSasya // 2 // practically as in No. 1076. This is followed by the lines as under:-- graMthAgraM 12383 // cha // zrIH // maMpavAchAlikhitaM // cha // zrIH // saMvat 1511 varSe mAghamAse zuklapakSe 13 dine zrI' kharataragacche zrIsAgaracandramUrivAcanAcAryazrI mahimarAjagaNibhiH svaziSyapaM dayA sAgaragaNivAcanArthamalekhi 'zrIpattana 'pure / ' zrImAla 'jJAtIyasaM 'cAMdAbhAryayA saM0guNarAjaputrI saM0 DAlIsuzrAvikayA zrI maMDapa gaDha' sthitayA lekhitA vA0dayAsAgaragaNivarANAM // N. B. -- For further details see No. 1075. Sisyahitantargata-Kumaranandikatha 1130. 1884-87. No. 1078 Size.-- rog in. by 44 in. Extent. - 3 folios; 13 lines to a page ; 44 letters to a line. Description.-- Country paper thin, rough and yellowish ; Devanagari characters with occasional gears; small, legible, uniform and good hand-writing; borders ruled in four lines in black ink; red chalk used; foll. numbered in the right-hand margin only; some portions of each of the foll. worn-out; otherwise condition good ; lacunas on fol. 3+-; complete so far as it goes ; fol. 3b blank. Age.-- Old. Subject. This is a portion of Sisyahita where the life of Kumaranandi, a goldsmith is narrated with a view to explain the orgin of the city of Dasapura. It is also found almost ad verbatim in Avasyakavrtti by Malayagiri Suri. Cf. the Cunni (pt. I, pp. 397-398 ) .

Page #473
436 Jaina Literature and Philosophy [1078. Begins.-fol. I teNaM kAleNaM teNaM samaeNaM 'caMpA'e nayarIe kumAranaMdI muvaNNakAro ithilolo pariSasai so jattha surUvaM dAriyaM pAsai suNei vA / taccha(tya) paMca suvaNNasayANi dAUNa taM pariNei / evaM teNaM paMca sayA piMDiyA / tAhe so IsAluo egakkhaMbhapasAyaM karitA tAhiM samaM lalai / tassa ya mitto nAilo nAma samaNovAsa / aNayA 'paMcaselaga'dIvavatthAu vANamaMtarIu suravainiueNa 'gaMdIssara'dIvaM jattAe patthiyAu / tANaM ca vijjumAlI nAma 'paMcaselA'dhivaI so cao tAo ciMtitaM / kiMci buggIhemojo amhaM bhattA bhavijai / navaraM vaccaMtIhiM 'caMpA'e kumAranaMdI paMcamahilAsayaparivAro uvalalayaMto diTTo tAhe ciItayaM esa ithilolo etaM buggAhemo tAhe tAhiM ujANagayassa appA daMsiu tAhe sobhai / / etc. Ends-fol 3*jaM ca rAya jimei / taM ca pajjoassa vi dijai / navaraM pajjosavaNAe suraNa pucchio| kiM ajja jimesi so ciMtei / aju marijAmi tAhe pucchAmi so bhaNai ajja pajjosavaNA rA ubavAsiu so bhaNai / ahaM yi uvavAsiu / mama viM mAyApiyANi sAvayANi / Na yANiyaM / mayA jhaa| ajja pajjosavaNa tti ranno kahiyaM / rAyA bhaNai / jANami jahA sA dhutA kiM puNa mama eyaMmi baddhillae pajjosarveNo yeva na sajjhai tAhe mukko mikkhAmiu ya / paTTo ya sovaNo | tANakkharANatthAyaNanimittaM baddho / so vi sudinno / tappamiI paDabaddharAyANo jaayaa| putvaM mauDabaddhA Asi vanne vAsArallagatto raayaa| tattha jo vaNiyavaggo Agau so tahi --viu | tAhe 'dasapuraM' jAyaM cha Reference.- Published in Sisyahita (pp. 2966-300% ) and also in Malayagiri Suri's com. ( pp. 391 --394 ). . AvazyakasUtra AvasyakasutrabRhadvAttiTippaNakagata brhadvrttitippanakagatazayyAtarasvarUpa sayyatarasvarupa No. 1079 302 (b). A. 1882-83. Extent.-- fol. g* to fol. 96. Description.- Complete so far as it goes. For other details see Pindavifuddhi No. 119. 1 Lacunas in the Ms.

Page #474
1080.] 171. 4 Malasatras 437 Begins.-fol.9 zrIAvazyakasahavRttiTippanakagataM zayyAtarasvarUpaM likhyte| zavyayAH sAdhusamapritagRhalakSaNayA bhavArNavaM taratIti zayyAtarastasya piMDaH zayyAtarapiMDaH / atha ko(3)yaM zayyAtaraH 1 kadAca zayyAtaro bhavati 2 katividhastapiMDaH 3 kadA cA'zayyAtaraH syAt 4 keSAM ca saMbaMdhyasau varjanIya: 5 ke ca tatpiDagrahaNe doSAH 6 kadA ca tatpiDo gRhyate 7 va zayyAtaro bhavatI 8 tyaSTau dvArANi // Ends.-fol. 9 aSTamadvAre // svasthAne vasanazayyAtaro bhavati dezAMtare tu gato na bhava tyapi kevalaM bhadrakAMtadoSAt tatpiDastatrApi varjanIyaH / bhadrako himama tAvata svagRhAvasthitasyAmI na kiMcid gRhaMti / yadi tAvadiha gRhNati tathApi zomanamiti viciMtya'neSaNIyama'pi kRtvA dadyAt prAMtastu mama svagRhasthitasyAmI na kiMcid gRhRtya'tra tu gRhNati tatkimidAnImanyaH saMjAto(5)haM tasmAnmAyAbina egheti viciMtya vasatkaccho(?) kuryAt evaM zayyAtarasaMbaMdhinA bhrAtRmAtulakAdInAM sarve pAzra(2)yasyA prabhUNAmapi saMbaMdhI piMDo varjanIyo bhadrakAMtAdidoSAt / ityalaM vistareNa tadarthinA tu prklptRtiiyoddeshko'nvessyH||shyyaatrpiNddsvruupN ||ch||shrii|| AvazyakasUtra niyukti Avasyakasutraniryukti vivRtisahita with vivsti 1168. No. 1080 1884-87. Size.-- 104 in. by 4 in. Extent.- 270 + 368 = 638 folios ; 13 lines to a page ; 44 letters to a line. Description.- Country paper rough and greyish; Devanagari ____ characters with pRSThamAtrAs; sufficiently big, legible and good hand-writing ; borders ruled in three lines in red ink ; nos. for foll. entered only once ; fol. I blank ; white paste used; this Ms goes up to the end of the 2nd khanda ; the first khanda gets completed on fol. 2705 and the commercement of the second is not numbered in succession but it is marked afresh ; fol. 2719 i. e. to say the new folio r. is blank; a piece of paper of the size of a fol. pasted to fol. 1"; edges of the first two foll, and the last as well slightly damaged ; condition on the whole good.

Page #475
438. Jaina Literature and Philosophy [108: Age:- Prety old. Author of the commentary, Malayagiri Suri. For his other works _see Nos. I94, 201, 220, 235, 254 and 619. Subject.-- Avasyakasutraniryukti together with its explanation in Sanskrit. Begins.- (niyukti) fol. 14 . AbhiANabohiyanANaM etc. , - (com.) fol. Ib pAMtu naH pArzvanAthasya pAdapadmanakhAMzavaH azeSavighnasaMghAtatamobhedakahetavaH 1 jayati jagadekadIpaH prakaTitaniHzeSabhAvasadbhAvaH / kumatapataMgavinAzI zrIvIrajinezvaro bhagavAn (2) natvA gurupadakamalaM prabhAvatastasya maMdazaktirapi AvazyakaniyuktiM vivRNomi yathAgamaM spaSTaM (3) yadyapi ca vittayo'syAH saMti vicitrAstathApi viSamAstA saMprati ca jano jaDadhIyAniti vivRtisaMraMbhaH (4) etc. (com. ) fol. 2706 of the first part ___ kAni punarvizatikAraNAni yaistIrthakaranAmagotraM karma tenopabaddhamityata Aha arahaMtA gAhA saNagAha apuvagAhA niyamAgAhA etA RSabha. devAdhikAravyAkhyAtatvAnna viniyaMte mAhaNagAhA asyA vyAkhyA puSpottarA cacyuto 'brAhmaNakuMDagrAme nagare koDAlasagotrabrAhmaNa somilAbhidhAno'sti tasya gRhe utpannaH devAnaMdAyAH kukSAviti gAthArtha cha etc. - (com.) fol. 368b of the 2nd part graft syifat: TTIFA rata - zAMtiH tatra sarva eva tIrthakRta evaMrUpA ato vizeSamAha cha jAto asivo. basamo gabhagate teNaM saMtijiNo pUrva mahadasivamAsIt bhagavati tu garbhagate ... jAto asivopazamastena kAraNena zAMtijinaH saMprati kuMthuH kuH pRthivI tasyAM sthitavAn kuMthuH pRSodarAditvAdiSTarUpaniSpattiH tatra sarve(5)pi bhagavaMta evaMvidhAstato vizeSamAha cha zUbhaM rayaNavicittaM kuMthu sumiNami teNa kuMthujananIsvapne kuM sthaM manohare atyunate jiNo mahApradeze stUpaM ratnavicitraM dRSTvA pratibuddhavatI tena kAraNena bhagavAn nAmataH kuMthujinaH sAMpratamaraH cha / iti zrImalayagirisariviracitAyAmAvazyakaTIkAyAM dvitIyakhaMDaM .. samAptamiti cha etc. Reference.-- Published. See No. I002, p. 374.. .

Page #476
1081.] III. 4 Mulasutras AvazyakasUtraniyukti Avasyakasutraniryukti laghuvRttisahita with laghuvrtti No. 1081 1089. 1887-91. Size.-- Iog in. by 4g in. Extent.- 210-2 - 15 - 2 - 10 - 34 - 1-4-9- 16 = IIT folios; 17 lines to a page ; 60 letters to a line. Description.- Country paper tough and greyish; Devanagari characters with pRSThamAtrAs; small, clear and good hand-wri. ting; borders ruled in four lines in black ink; fol. !" blank ; red chalk and yellow pigment used; foll. 4, 5, 9 to 23,61, 66,69 to 78,86 to 119, 126, 130 to 133, 136 to 144, and 165 to 180 lacking; this Ms. contains the niryukti and its commentary as well ; both complete; ......edges of the first fol. partly worn out%3; condition good. ... fol. 2100 gives a sort of a long list of the contents... -Age.-Old. Author of the text.-Bhadrabahusvamin. , ,, ,, com.- Sritilaka Suri. Subject. -- The text along with a commentary in Sanskrit. Begins.- (text) fol. 10 AbhiNibohiyanANaM suyanANaM ceva uhinANaM ca / .. taha maNapajjavanANaM kevalanANaM ca paMcamayaM / 1 // etc.. ,, - (com.) fol. r" e 6 // OM namaH zrIpaMcaparameSTibhyaH // .. devaH zrInAbhisUnurjanayatu sa zivAnyaMzadeze yadIye: khelaMtI kuMtalAlI vilasadAlikuzaprojjvalA zAlate sm| ... saMjAte saMyamazrIpariNayanavidhau mAMgAlikye trilokIlakSmyA dUrvokurANAM tatiriSa patito dastahastadvayAgrAt / 1 // etc. tathApyatyalpadhIhetoralpadhIrapyahaM punH| racayiSyAmya vRttimuttAnArtha laghIyasIM // 12 // etc.

Page #477
440 Jaina Literature and Philosophy Lio8i. Ends.- (text) fol. 210* savvesi pi nayANaM bahuvihavattavvayaM nisaamittaa| taM sanvanayavisuddhaM jaM caraNaguNaDhio sAhU // 74 // ,, -(com.) fol. 210deg pUrvAddha spaSTaM // tatsarvanayavizuddhaM yaccaraNaguNasthitaH sAdhuH yato yathAkhyAtacAritriNa eva mahodayapadAvAptiriti / / 74 // iti zrIzrItilakAcAryaviracitAyAmAvazyakalaghuvRttau pratyAkhyAnAdhyayanaM samAptaM / / cha / atra graM. 698 // tatsamAptI samAptA(te)yamAvazyaka laghuvRttiH // graM. 12355 // yAdRzaM pustakaM etc. // zrIrastu / Reference.- For additional Mss. etc. see G. O. Series vol. XXI pp. 20, 9 and 40. See also Peterson's Report for 1882-83, p. 58 (2) AvazyakasUtraniyukti Avasyakasutraniryukti laghuvRttisahita . . .. with laghuvrtti No. 10822 - 1169.. 1884-87. Size.-10g in. by 48 in. Extent - 297 - I - I - 78 = 217 folios ; 13 lines to a page; 56 letters to a line. Description.- Country paper very thin and greyish; Devanagari characters with pRSThamAtrAs; bold, big, beautiful and legible hand-writing ; borders ruled in four lines in black ink; red chalk and yellow pigment used ; foll. 2, 97 and 181 to 258 lacking; edges of the 3rd fol. slightly gone; the first fol. very badly damaged ; about a quarter of it worn out; condition tolerably good. Age.- Samvat 1535. Begins.- (com.) fol. 1deg 560 // namaH zrIpaMcaparameSTibhyaH / / devaH zrInAbhiAnuH etc. as in No. 1081. Ends.- (text) fol. 2960 samvesi pi nayANaM etc. as in No. 1081.

Page #478
1082.] ...III. 4 Malasatras. .... 44t: Ends.-(com.) fol. 297- pUrvAddhaM spaSTaM | etc. up to I. as in No. 1081. Then we have : 12325. This is followed by the verses as under : tIthe vIravibhoH sudharmagaNabhRtsaMtAnalabdhonnati shcaaritrojjvl'cNdr'gcchjldhiprollaassiityutiH| . sAhityAgamatarkalakSaNamahAvidyApagAsAgaraH / zrIcaMdraprabhasUriradbhutamatirvAdIbhasiMho(s)bhavat // 1. tatpaTTalakSmIzravaNAvataMsAH ___ zrIdharmaghoSaprabhavo bbhuuvuH|| yatpAdapadma kalahaMsalIlA dadhau nRpaH zrIjayasiMhadevaH // 2 // ttpttttodyshailshRNgmbhjttejshvi(stri)cuuddaamnniH| zrIcakrezvarasUrirityabhidhayA ko(s)pyatra bhAnurnavaH saMprAptAbhyudayaH sadaiva tamasA no jAtu bicchaayitH| naivoccaMDaruciH kadAcidapi na prApnA(ptA)parAgastataH / vilalAma svaraM tatpaTTaprAsAdacaMdrazAlAyAM / zrImAn zivapra(ma)guruH sNymkmlaakRtaasktiH| 4 // . zrIza(zivaprabhasUrINAM teSAM ziSyo(s)smi mNddhiiH| -- nAnA zrItilakAcAryaH zrutArAdhanagRddhibhAk // 5 // etAM vRttiM laghumaviSamAM so(5)hmaavshykiiyaaN| ___tatpAdAbjasmaraNamahasA mugdhdhiirpykaa| . tadyatkiMcidrabhasavazato dRSTamasyAmazuddhaM / .. . tatsaMzodhyaM mayi kRtarUpaiH sUribhistattvavidbhiH // 6 // vRttiM racayatA caitAM sukRtaM yanmayA()rjitaM / bhave bhave(5)haM tena syAM zrutArAdhanatatparaH // 7 // . !! zava?ta)dvAdazake(s)bdAnAM gati(te!) vikramabhUbhujaH / / saMvatsare SaNNavate vRttireSA vinirmame / / 8 // ziSyA naH zasyacAritrAH srvshaastraabdhipaargaaH|::. asyAM sAhAyakaM cakruH zrIpadmaprabhasUrayaH // 9 // ... ) ziSyo(s)smAkamimAM vRttimahivannaH zAstratattvavit / / akhi(li)la(kha)prathamAdarza yazastilakapaMDitaH / / 10 // sasapAdatrizatyasyAM shlokdvissttshsrikaa| pratyakSareNa saMkhyAnAditi nizcitavAnaha // 11 // .... 56 []. L. P.)

Page #479
Jaina Lilerajure and Philosophy [1082. yAvahijayate tIrthaH zrImadvIrajinezituH / nAmadeSA marADhIva khelatAtkRtimAnase // 12 // ___ saM. 1535 varSe caitrazudi 15 bhaume / ayeha zrI pattana'madhye / zrI'parataraM gacche gacchAdhipe paTTe zrIjinaharSasarirAjye / puvtnniispunnylkssmiishrii| tasya ziSyaANaMTazrIgaji svayaM paThanArtha zrIAvazyakalaghaTIkA likhApitaM / zrI pattana'vAstavye 'udIcya jJAtIyapatizrIzaMghAsatabaDUAkena liSitaM zubhaM etc N. B.- For further particulars see No. 1081. AvazyakasUtraniyukti Avasyakasutraniryukti laghuvRttisahita with laghuvrtti No. 1083 1182. 1886-92. Size.--101 in. by 41 in. Extent.- 297 - 1 - 15 = 281 folios; 17 lines to a page ; 40 ___letters to a line. Description.-- Country paper thin and greyish, Devanagari cha racters with occasional rats; legible and good handwriting ; borders ruled in four lines in black ink ; space between the pairs coloured red; three discs : two in the margins and one in the centre ; nos. for foll. entered twice as usual ; yellow pigment and red chalk used ; marginal notes written at times%3; fol. I and foll. 56 to70 lacking; corners of foll. I to Is and 273 to 282 slightly worn out : foll. 72 10 77 more or less smutty; but, all the same they are readable ; edges of foll. 177 to 200 somewhat gone; condition tolerably good ; fol. 297deg practically blank. Age.- Pretty old. Begins.- (text) fol. 2* AbhiNibohiyanANaM muyanANaM ceva ohinANaM ca etc. as in No. 1081,

Page #480
1084.) Ifj. 4 Malasatras 443 Begins.- ( com. ) fol. 24 ppa-pa(tyalpapIhetoralpadhIrapyahaM punaH / racayiSyAmya vRttimuttAnArthI laghIyasIM // 12 // Ends.--( text ) fol. 297* Haari for ferui etc. as in No. 1081. >> -(com. ) fol. 2978 gale fog etc. up to hear Sarah as in No. 1082. This is followed by iTTAT : Il 8: 4 etc. N. B. -For other details see No. 1081. AvazyakasUtra niyukti Avasyakasutraniryukti laghuvRttisahita with laghuvitti No. 1084 630. 1892-95. Size.-- 144 in. by 11 in. Extent.-- 189 folios ; 28 lines to a page ; 40 letters to a line. Description.- Country paper thick, tough and white ; Devanagari characters; big, legible, uniform and good hand-writing; borders unruled ; foll. cloth-bound; red chalk and yellow pigment used; nos. for foll. i to 126 and those for 169 to 189 entered twice as usual ; but foll. 127 to 168 not numbered even once ; a very thick and black paper preceding fol. 1'; two such papers following fol. 189; fol. 1894 half blank and fol. 1896 completely blank; this Ms. contains the text and the commentary as well; both complete; extent 12325 slokas; condition excellent. Age.- Modern. Begins.-(text) fol. 1 paraligatoi etc. as in No. 1081. >> - (com.) fol. 1 : GTA : 1 da: sfruttare etc. as in No. 1081. Ends.- (text ) fol. 1892 Fafe fa ao etc. up to nie as in No. 1081.

Page #481
444 Jaina Literature and Philosophy [ 1084. Ends. (com.) fol. 189 gaf etc. up to af: as in No. 1081. This is followed by graMthAgraM 12325 / karakRtamaparAdhaM kSaMtumarhanti santaH / ft: etc. N. B. For further particnlars see No. 1081. res Avazyaka sUtraniryukti sygfaaiba No. 1085 Engin Size 10 in. by 4 in. Extent. 352 + 3 = 355 folios; 13 lines to a page; 47 letters to a line. 29 Description. Country paper thin and white; Devanagari characters with as; bold, big, legible and good handwriting; borders ruled in three lines in red ink; red chalk and yellow pigment used; numbers for foll. entered patit twice as usual; out of the 81 foll., the unnumbered sides vely decorated in the centre with a circular disc whereas the numbered, in the margins, too; fol. 1a blank; foll. 83, 110 and III repeated; the 295th fol. wrongly numbered as 296 gribee in the right-hand margin; condition very good except that Had fe31 the last fol. slightly damaged; extent 14000 slokas; complete. enian T Age Appears to be somewhat old. Begins. (text) fol. 2a. enfria Avasyakasutraniryukti with laghuvrtti Ends. (text) fol. 351b fer fra 99 219. 1902-1907. -- etc. as in No. 1081. (com) fol.1b 60 // OM namaH zrIparameSTibhyaH / | devaH zrInAbhisUnurjanayatu etc as in No. 1081. etc. as in No. 1081. (com.) fol. 351bgar etc. up to samApteyamAvazyakalaghuvRtI ( ttiH) / as in .18 No. 1081. This is followed by the lines as under: ---

Page #482
1686. ] *11). 4 Malasatros 445 (tI)rthe vIravibhoH sudharmagaNabhRtsaMtAnalabdhonnati // sp || 5.38000 Freteet)! For further particulars see No. 1081. N. B. AvazyakasUtra niyukti Avasyakasutraniryukti laghuvRttisahita with laghuvrtti No. 1086 241. A.1882-83. Extent.--282 folios; 17 lines to a page ; 40 letters to a line. Description.- Country paper tough and greyish ; Devanagari cha racters with TAFS; small, clear and tolerably good handwriting ; borders ruled in four lines in black ink; red chalk used ; nos, for foll. entered once in a corner of the right-hand margin; remarks illustrated at times with figures (vide fol. 103b); foll. 281 and 282 repeat what is already written on the preceding foll; they seem to be added later on, though they bear an earlier date'; the work becomes complete on fol. 2800; edges of the first fol. slightly damaged; some of the foll. slightly wormeaten; condition good; fol. ra blank except that a few lines about the contents are written on it. Age.- Samvat 1488 (?). Begins.- (text ) fol. 2a Thoratiguaro etc. as in No. 1081. >> - (com.) fol. 10 A# sfaTTART: 1 ca: sarhagua etc. as in No. 1081. Ends.-( text ) fol. 280* Far fa feto etc. as in No. 1081. ,, -- (com.) fol. 280* gaise pare etc. up to F arah 118211 as in No. 1082. This is followed by the lines as under:

Page #483
446 AzApallI etc. up to the end seem to be written in a different hand. Begins.-- ( com. ) fol. 281 4 turjagyA prathamo bhaMgaH // zuddhaH / dvayorapyajAnato tyo'zuddhaH / madhyamayorvibhASA etc. Jaina Literature and Philosophy [ 1087. cha etc. 'AzApallI 'vAstavya 'prAgvATa' jJAtIya gI. AkAbhAryAmANikadeputryA 'pattana' vAstavyacAMpA bhAryA camakUputra zivarAjapatnyA zrI0 dhArU nAmmyA zrI somasuMdarasUrINAmupadezena saMvat 1488 varSe zrI AvazyakalaghuvRttirlekhitA // cha etc. -- - (niryukti ) fol. 2822 m savvesi pi nayANaM etc. ( com.) fol. 282 deg as in No. 1082. pUrvArdha spaSTaM etc. up to khelatAt kRtimAna se This is followed by the lines as under:etc. saMvat 1458 varSe phA (la) guNa zudi 6 budhe 'staMbhatIrthe' likhitaM / chaH / / N. B. -- For further details see No. 081. Avazyaka sUtraniryukti TIkA sahita Avasyakasutraniryukti with tika No. 1087 Size-- ro++ in by 44 in. Extent.- (text) 124 folios; 7 to 15 lines to a page; 35 letters to a line 133. 1873-74. ; 27,, 29 " ~~ (com.),, " """; 56 Description.- Country paper thin and greyish; Devanagari characters with pRSThamAtrAs : this is a paJcapATI Ms.; the hand - writing for the text bigger than that for the commentary ; both legible and good; each of the columns has its borders ruled in tour lines in black ink, with the intermediate portion coloured red; unnumbered sides have a disc in the centre in red colour whereas the numbered ones, in the margins, too; a blank fol. is affixed to fol. 1; same is the case with fol. 1246; fol. ra blank ; red chalk used; some of the foll. present a very nice appearance. e. g. foll. 196, 248 etc.; illustrative tables pertaining to the Jinas and dr " " "

Page #484
1087.] III. 4 Malasairas 447 Cakravations given on fol. 43b; corners of some of the foll. slightly damaged; condition good; this Ms. contains niryukti as well as its commentary ; both complete. Age.- Old. Author of the commentary.-- Not mentioned. Subject-- The niryukti along with its explanation in Sanskrit. Begins.- fol. 1 e namaH zrIvItarAgAya namaH // OM namaH zrIsarasvatyai namaH | etc. OM namaH zrIgaNezAya namaH // cha etc. - fol. 20 zrIvItarAgAya nmH| namo arihaMtANaM etc. -- (text) fol. 2' jayai jagajIvajoNI etc. ,, --(com.) fol. Ib eOM namaH vItarAgAya / __prekSAvatAM pravRttyarthamAdau prayojanAdikamupanyasyanIyaM etc. . Ends.-- (text) fol. 1240 savvesi pi nayANaM etc. up to sAhU 90 // iti paJcakkhANanijjuttI saMmattA | samAptedaM shriiaavshykN| ,, - ( com.) fol. 124deg sarvaviratisAmAyikadvayamevecchati nanu kimatra tamU (1) ucyate // 74|| save tat sarvanayavi..sarvanayasaMmataM vacanaM yaccaraNaguNasthitaH sAdhuH / yasmAt sarvanayA bhAvanoktA pa...cchati 75 (?) 631. AvazyakasUtraniyukti Avaoyakasutraniryukti avacUrisahita with avacuri No. 1088 1892-95. Size.- Iot in. by 41 in. Extent.- (text) 96-1+1=96 folios ; 20 lines to a page ; 45 letters to a line. , - (com.) 96 folios ; 20 lines to a page ; 66 letters to a line,

Page #485
448 Jaina Literature and Philosophy [ 1088. Description.- Country paper rough and white; Devanagari cha racters with occasional pRSThamAtrAs; it is a tripATI Ms.; the text written in the middle in a bigger hand ; legible and good hand-writing ; borders ruled in four lines in black ink ; red chalk and yellow pigment used ; the first fol. lacking; the second repeated; fol. 24 commencing with the 4th gatha of sthavirAvalI ; about a half of the second fol. worn out; strips of paper pasted to several foll. ; some of the foll. more or less worm-eaten ; condition very fair; heights and life-periods of the 24 Tirthamkaras and 12 Cakravartins tabulated on fol. 58b; diagrams on fol. 826; both the text and the commentary ending abruptly; complete up to the namukkAranijjutti and its commentary. Age.- Pretty old. Author of the avacuri.-Not known. Subject.--.The Niryukti along with its explanation in Sanskrit. Begins.-- (text ) fol. 2a guNabhavaNagahaNa suarayaNabhariya daMsaNavisuddharatthAgA / saMghanagara bhaI te akvaMTacarittapAgArA // 4 // etc. ,, -- ( com. ) fol. 2a paDibhA abhiggahA vi a uttaraguNA me viaannaahe(hi)||1|| guNA eva bhAvanA......darzanaM samyakatvaM tadevAsAri mithyAtvAdikacavarahitA vizuddhATavyA mArgAya....nusAreNa dIrghatvasUcanA dIrdha nirdezo yathA goyamA / he saMghanagara bhadraM te etc. Ends.--fol. 966 ( text) jaM vattaNAirUvo kAlo davyANa ceva pjjaao| teNa tassa tami niviruddhaM savvahA karaNaM // 32 // ahaceha kAlakaraNaM bacAi joisiakAlakaraNeNaM / sattavihaM tattha cira cao vi. This ends thus abruptly.... ,, - (com.) fol. 96deg bahu0 uktaM kAlakaraNaM / bhAvakaraNamucyate etc. ucyate iha bhAvAdhikArAt paryAyaprAdhAnyaM zrutasya jIvabhAvAt / zrutabhAvakaraNaM nozrutakaraNaM. This ends thus abruptly.

Page #486
111. 4 Malasatras 1089.] AvazyakasUtraniyukticUrNi No. 1089 449 Avasyakasutraniryukticurni 1167. 1884-87. Size.- 104 in. by 41 in. Extent.- SII + I = 512 folios; I lines to a page; 46 letters ___to a line. Description.- Country paper thin and greyish; Devanagari cha racters with occasional KATETTS; sufficiently big, legible and good hand-writing ; borders neatly ruled in three lines in red ink; foll. numbered in the right-hand margin; fol. 1* blank; edges of the first and the last foll. slightly worn out ; foll. 100 to 178, 247 to 261 and 389 to 395 have their margins more or less worm-eaten';, a small hole on the last fol.; so two letters are gone; condition tolerably good ; lacunae on fol. 166; red chalk used ; information about the 24 Tirthamkaras tabulated on foll. 1196 and 120* ; fol. 353 repeated; white paste used; of course, rarely ; complete. Age.- Samvat 1620. Subject. A commentary in mixed languages viz., Sanskrit and Prakrit elucidating the niryukii on Avasyakasutra. Begins.- fol. r'namo arihaMtANaM etc. up to savvasAhUNaM as in No. 731. This is followed by the lines as under : kAUNa NamokAraM titthakarANaM tilokmhitaannN| AyariyauSajjhApANaM gamiUNa ya sambasAhUNaM // 1 // . koti sIso Ayariyakuva(lolA(vA.)sI / jAtikulasvara(su)yAyArasatta viNayasaMpaNNA(?NNo) ma duaiDao etc. Ends.- fol. Sub evamAdi paralopa / aNugamo sNmtto| iyANi nayA te ya jhaapurv| tattha duve nyaa| te ya jahApuvvaM / tattha "tayA / ajjhayaNaNato ya (krnnnntoy)| ajjhynnnnto| NAyammi gihiyavve gaathaa| karaNaNatoya / sambesi pi i [...]

Page #487
450 faina Literature and Philosophy [rogo. NayANaM / gAhA / AvassaganijjutticuNNI saMmattA / cha / saMvat 1620varSe Aso vadi 8 budhe 'zrImAlI'jJAte sAhAzaMghadattatatsatasAhAkAhAnA Personligai II sptar (5)TECTIFTETTYSaraf etc. Reference. This work is published in two parts by Rsabhdevaji Kesarimalji Svetambara samstha, Rutlam, in A. D. 1928 . and 1929 respectively. AvazyakasUtra AvasyakasutraniyukticUArNa niryukticurni No. 1090 129. 1873-74. Size.-- 104 in. by 44 in. Extent.- 351 - 1 = 350 folios ;, 15 lines to a page ; 60 letters to a line. Description.- Country paper thin and greyish; Devanagari cha racters with occasional IT ETS ; sufficiently big, legible and very good hand-writing ; borders ruled in three lines in red ink; nos. of most of the foll. written twice as usual; red chalk used; foll. j. and 3510 blank; the heights and the life-periods of the 24 Tirthamkaras tabulated on foll. 81 and 828 ; fol. 197 wrongly numbered as 198; for, there is a continuity of matter so far as foll. 1966 and 198* are concerned ; fol. 279 wrongly numbered in both the margins as 179; some lacunae on foll. 2375 and 2826; foll. 341 etc. numbered only once and that too, as it seems in a different hand; complete; a piece of paper of the same size as the fol. pasted to fol. 1 ; same is the case with fol. 3515; condition excellent. Age.- Not later than Samvat 1774. Begins.-- fol. B FAT aftaritet: 1 HA: 11 FAT Steatoi etc. up to FTFIEu as in No.1089. This is followed by $15501 FAIST fate rastut etc. as in No. 1089.

Page #488
1091, ] 111. 4. Malasairas 457 Ends.--fol. 351' GEHT autc etc, practically up to TT as in No. 1089. This is followed by the line as under : Il Tu Had etc. j. 33(?) : (?) 11 etc. Then in a different hand we have :-- ___saMvata 1774 va. paM.dIpavijayagaNinA ApakacauNa patra 351 paM. stratJETITTATUat gant etc. N. B.- For further particulars see No. 1089. AvazyakasUtra AvasyakasutraniyukticUrNi niryukticurni No. 1091 367. . 1880-81. Size.-- 118 in. by s.in. Extent.- 372 - 6-7-1-3-6 + 1 = 350 folios; 17 lines to . a page ; 46 letters to a line. Description.-- Country paper rough and white; Devanagari cha racters with east ; sufficiently big, legible and very good hand-writing ; borders tuled in four lines in black ink; nos. for foll. entered twice as usual ; foll. I and 3726 blank ; edges and corners of the first few foll, slightly worn out; some of the foll, more or less damaged owing to their being worm-eaten ; fol. 112 partly torn, several foll. have their upper portion somewhat gone ; condition fair ; names of the Tirtharkaras and the Cakravartins along with their heights etc. tabulated on fol. 870; fol. 258 repeated ; foll. 5, 6, 25, 51, 97, 118, 144-150, 168, 205-207 and 341-346 lacking ; hence incomplete. Age.-- Samvat 1661. Begins.--fol. 1b. FA: FEITT ! FATISTETTUI ETC. as in No. 1089.

Page #489
452 Jaina Literature and Philosophy [109. Ends.--fol. 372* evamAdi paraloe etc. up to saMmattA as in No. 1090. This is followed by the lines as under :-- cha / zubhaM bhavatu / saMghat 1661 phAlguNazudi 5 budhavAsare ojhArudralikhitaM // graMthAnaM 18000 pramANA vAcyamAnA ciraM na(na)yAdAcaMdrArka / zreyo'stu zrIcAturvarNabhamaNasaMghasya // cha / N. B.-- For other details see No. 1089. AvazyakasUtra AvasyakasutraniyuktaravacUri niryuktyavacuri No. 1092 1092. 1887-91. Size.-- Io in. by 4g in. Extent.-- 116 folios ; 17 lines to a page ; 54 letters to a line. Description.-Country paper thin and greyish; Devanagari cha racters with occasional FASTS ; small, clear and good hand-writing; borders ruled in four lines in black ink; the space between the pairs coloured red; nos. for foll. entered only once; unnumbered sides have mostly a small disc in red colour in the centre whereas the numbered, in the margins, too; red chalk and yellow pigment used; edges of the first fol. slightly worn out ; condition very good; complete ; composed in Samvat 1440. Age.-- Not modern. Author.--- Jnanasagara, pupil of Devasundara of the Tapa gaccha. Subject.-A small commentary to the niryukti having for its basis ____ a bigger commentary (No. 1075) by Haribhadra Suri. Begins.- fol. I' jayati iMdriyaviSayakaSAyaghAtikarmaparISahopasargAdizatrugaNa parAjayAt sa vanipyatizete yazca sarvAtizAyI sa cAvazyaM praNAmAha(?) iti taM prati praNato(s)smIti gamyate / etc.

Page #490
To93.] 111. 4 Malasatras 453 Ends.-fol. 116 sve0|| tatsarva etc. up to nikSepamicchati practically as in No. 1093. This is followed by the lines at ander :-- // 71 AcAryazrIharimadrakRtavRttyanusAreNa zrIAvazyakAvacUAra: samAptA / / cha / kUTalikhane duHkRtaM mithyA'stu // cha / zrImat tapA gaNanoMgaNabhAsvarAbha zrIdevasuMdarayugottamapAdukAnAM / ziSyaiji(ji)nAgamasudhAMbudhilInacittaiH zrIjJAnasAgaraguru(rU)ttamanAmadheyaH // 1 // khA'bdhiyugedumite()bde 1440'vacUrirAvazyakasya jayanIyaM / vidadhe bRhAdvivaraNAt zrutabhaktayA svpraahtheto(:)||2|| cha | etc. graMthAnaM 9005. Then we have in a different hand : zrIjIvarAjazivarAjakovidAbhyAsamasau pratirsarsace citkoze puNyArtha paMDitanIkArSaziSyAbhyAM - AvazyakasUtra Avasyakasutra: niyuktatyavacUrNi niryuktyavacurni 577. No. 1093 1884-86. Size.-- 104 in. by 4.in. Extent.- 83 folios ; 20 lines to a page ; 64 letters to a line. Description.- Country paper thin, rough and grey; Devanagari characters with pRSThamAtrA; small, clear and good hand-writing; borders mostly ruled in three lines in red ink ; red chalk used ; foll. numbered in the right-hand margin; edges of the first fol. and those of the last too, slightly worn out; the first three foll. worm-eaten ; condition on the whole very good ; complete. Age.- Pretty old. Begins.- fol. 1 namaH srvjnyaay| .....

Page #491
454 Jaina Literature and Philosophy [1093 prANapatya jinavareMdra vIraM zrutadevatAM gurUna sAdhUn / Avazyakasya vRttiM gurUpadezAdahaM vakSye // 1 yadyapi mayA tathA(s)nyaiH kRtA(s)sya (asti) vivRtistathApi saMkSepAta tadrucisattvAnugrahahetoH kriyate prayAso(s)yaM // 2 ihAvazyakaprAraMbhaprayAso'yuktaH prayojanAdirahitatvAt kaMTakazAkhAmaIna badityevamAdyAzaMkApanodAya prayojanAdipUrva pradarzita ityuktaM ca etc. Ends.- fol. 83deg savve0 / tat sarvanayAvizuddha sarvanayasaMmataM vacanaM yaccaraNaguNa sthitaH sAdhuH / yasmAtsarvanayA bhAvanikSepamicchati / / 76 // // .. iti prtyaakhyaanniyukty'vrnniH|| // zrIAvazyakaniyuktayavacUrNi: AcAryazrIharibhadramarikatavRttyanusAreNa / bhaTTArakaprabhuzrIjJAnasAgara sUriviracitA samAptA // cha // // cha / bhadraM // N. B.--For other details see No. 1092. AvazyakasUtra AvasyakasutraniryuktatyavacUrNi niryuktyavacurni 1183. No. 1094 1886-92. Size.- Iog in: by 4t in. Extent.- 118-1 + 4 = 121 folios; 18 lines to a page ; 66 ___ letters to a line. Description.-Country paper thin and grey; Devanagari characters with pRSThamAtrAs; small but clear and good hand-writing; borders ruled in four lines in red ink; edges of the first and the last foll. slightly worn out; foll. 5, 15, 64 and 116 repeated; the 64th fol. has an illustrative diagram ; lacunae on fol. 108b; the fol. following the repeated fol. 116 is numbered as 118; complete ; condition very good. Age.- Samvat IS16. Author.--- Anonymous. Subject:-A small commentary to Avasyakasutraniryukti. ....

Page #492
1095.] ...III. 4 Malasutras 455 Begins.- fol. I* OM namaH zrIpravacanAya || prekSAvatAM pravRttyartha // Adau prayojanAdikamupanyasanIyamanyathA na yukto'yamAvazyakaprAraMbhaprayAso niHprayojanatvAt etc. Ends.- fol. II7smve0|| tat sarvanayavizuddhaM sarvanayasaMmataM vacanaM // yaccaraNa guNasthitaH sAdhuH / yasmAtsarvanayA bhAvanikSepamicchati / / 75 // iti pratyAkhyAnani(niyuktayavANaH sA(sa)mAptA ceyaM zrIAva.zyakazrutaskandhaniryuktayavacUrNiH ||ch // // ch|| saM0 1516varSe caitrasadi 7 // // zubhaM bhavatu // cha / maMgalamastu / / cha // 1 // 1 // AvazyakasUtraniyukti AvasyakasutraniryuktibAlAvabodha balavabodha 1090. No. 1095 1887-91. Size.--114 in. by 44 in. Extent.- 311 + 1 = 312 folios ; Ir lines to a page ; 48 letters to a line. Description.-Country paper thin and greyish; Devanagari cha racters; big, legible and good hand-writing; borders ruled in four lines in black ink; the portions between the pairs of lines coloured red; nos. for foll. entered twice as usual; complete ; there is at least a disc in the centre of each fol. in red colour ; red chalk and yellow pigment; used ; fol. 19 blank ; fol. I02 repeated; the gathas of the niryukti are written in the margins; edges and corners of the first and last few foll. worn out; condition fair. Age.- Samvat I6100 (1610?). Subject. - A commentary on Avasyakasutraniryukti partly in Sanskrit and partly in Gujarati, the latter being practically the translation of the former. ............ Begins.- fol. 1 OM namo zrIgaNezAya / jayai jaga0 / bha(ga)vAn japati / bhagavaMta paramezvara jayavaMta vrti| kiMviziSTo bhagavAn jagajjIvayonivijJAyakaH / jaga vizva taNA jIva tehanI yoni utpattisthAnakAH [vi] vizeSiha kA jANaiM chaha etc.

Page #493
Jaina Literature and Philosophy [ 1095. yat caraNaguNasthitasAdhurbhavatIti kathyate / yat je bacana caraNa cAritra taNA guNanahaM viSai sthitaH bhaNIi rahiu sAvadhAna sAdhubhavati mahAtmA hui / iti rasiuM kathyate kahIi / etalaI gure ima kahitaM / saghalAi nyAya jUjUDaM bolai / jJAnavAdI jJAna thApai / kriyAvAdI kriyA thApai / paNi saghalAM nyAya taNu tattva e / jaM zuddhacaritravaMta mahAtmA vakhANIi / jeha kAraNa sUdhauM cAritra tehaha jinahaM hui / je jJAnavaMta hui / eha kAraNa jJAnavaMta zuddhacAritrI sarvotkRSTa jANivu / e sarva nyAya taNuM tattva jANivaM / iti zrIAvazyaka sUtrasya bAlAvi (va) bodha samAptaM / zrIrastu etc. saMvat 1610[0] varSe vaizApavadi 3 zukre ma0 govAla likhitaM zrI' sAdhupUrNimA' pakSe sukSa (khya ) bhaTTAraka zrI udaya caMdrasUri tatpaTTe pu (pU) jyArAjya(dhya ) zrImunicaMdrasUri tatpaTTe gacchAdhirAjagaccha bhAradhuriMdhara zrIzrIzrIvidyAcaMdra (?) riMdre eSA pustikA likhApitA // sarveSAM zazyAnAM vAca etc. 456 Ends. fol. 311 * Avazyaka sUtra niyuktidIpikA No. 1096 Avasyakasutraniryuktidipika 373. 1879-80. Size.--ro in. by 4g in. Extent.-- 423 folios; 11 lines to a page ; 42 letters to a line. Description. Country paper thin and greyish; Devanagari characters with pRSThamAtrAs; big, legible and good handwriting; borders ruled in four lines in black ink ; nos. for foll. entered only once ; foll. r and 423b blank ; diagrams. on fol. 13b; foll. 65 and 66 damaged in the margin; condition very good; complete. Age. Sarvat 1633. Author.- Manikyasekhara Suri, pupil of Merutunga Suri of the Vidhipaksa. For his other works see " Ends " ( p. 457 ). Subject. Avasyakasutraniryukti explained in Sanskrit.

Page #494
1096.] Begins. Ill. 4 Malasutras 457 fol. rb namaH zrIvardhamAnAya / zrImadgaccheza merutuMga sUrigurubhyo namaH // zrI Avazyaka sUtraniryuktiviSayaH prAyo durgapadArthaH / kathAmAtraM niryuktayudAhRtaM ca likhyate / iha zrIdevavAcaketyaparanAmA devarddhigaNirjJAnapaMcakrarUpaM niM(naM)digraMthaM vaktukAmo maMgalArtha pUrvamAvalikA abhidhitsuH sAmAnyato'stutimAha / jayai / stutirdvidhA etc. syAta Ends. fol. 4222 atha pramANamAha / sabbe sarveSAmapi nayAnAM naigamasaMgrahAdInAM jJAnadvaya saMgRhItAnAM bahuvidhAM vaktavyatAM nizamya tatsarvanayavizuddhaM sarvanaya saMmataM jJeyaM / yatsAdhuzva raNaguNavyavasthitazvAritrakriyAjJAnasthitaH yatpUrva jJAte gRhItavye cArthe yatitavyameva / pazvAtkriyAyatnaH kArya eva tatazvAritraM yataH sarvanayA bhAvanikSepamicchati / bhAvazva ratnatrayArAdhanaparaH sAdhuH / 70 / iti pratyAkhyAnaniryuktiH samAptaH // cha te zrI 'aMcala' gacchamaMDanamaNizrImanmahadraprabha zrImUrIzvarapaTTapaMkaja samullAsollasadbhAnavaH / tarkavyAkaraNAdizAstraghaTanAbrahmAyamANAzvi (zvi) raM zrIpUjyaprabhumerutuMgaguravo jIyAsurAnaMdadAH // 1 // tatziSya eSa khalu sUriracIkarata zrI mANikyazekhara iti prathitAbhidhAnaH / caMcadvicAracaya cetanacArumenAM saddIpikA suvihitavratinAM hitAya // 2 eSa zrI Avazyaka niryuktedI (dIM) pikA ciraM jayatAt / muninicayavAcyamAnA tamoharA dIpikA piMDaniryukterodhaniryuktidIpikA / dazavaikAlikasyApyuttarAdhyayanadApike // 3 // AcAradIpikA navatattvavicAraNaM tathA [ya] ekakartRkatayA graMthA amI asyAH sahodarAH // 4 // iti 'vidhipakSya'mukhyAbhidhAnaM zrIma 'daMcala' gacchAdhirAjalugurusruvihita cakravartizrImanmerutuMgamUrIM drakrama kamala marAlaziSyazrI mANikyazekharasUrivira citA zrI Avazyaka niryuktidIpikA samAptA[:] // zubhaM bhavatu etc. saMvat 1633 varSe mAdravA yadi 13 dine laSitaM // yAdRzaM pustakaM etc. 58 [J. L. P.]

Page #495
458 Jaina Literature and Philosophy . [1097: AvazyakasUtraniyukti AvasyakasutraniryuktilaghuvRtti laghuvitti No. 1097 167. 1866-68. Size.-- 104 in. by 4} in. Extent.-- 152 folios; 17 lines to a page ; 54 letters to a line. Description. -Country paper tough and grey; Devanagari cha racters with occasional gears; small, legible and good hand-writing; borders ruled in four lines in black ink; red chalk and yellow pigment used; nos. for foll. entered only once, and that, too, just in the right-hand corner, at the end of the fol. ; almost all foll. more or less worm-eaten ; condition poor ; cloth-bound; two foll. preceding the Ist and two following the last blank ; they bear the stamp of the Elphinstone College Library ; fol. 1526 blank ; com plete'; extent 13000 slokas. Age.-- Fairly old. Author.-- Not known. Subject.-- A commentary in Sanskrit to the niryukti on Avasyaka sutra. Begins.'- fol. I' prekSAvatAM pravRttyartha Adau prayojanAdikamapanyasanIyamanyathA na yukto'mAvazyakabhAraMbhaprayAso niHprayojanatvAta kaMTakazAkhAmaInavat nirabhidheyatvAt kAkadaMtaparIkSAvat asaMbaddhatvAt vaza dADimAni ityAdi vAkyavat etc. Ends.-fol. 152* savve 0 / tatsarvanayavizuddha sarvanayasaMmataM vacanaM yaccaraNaguNasthitaH sAdhuH yasmAt sarvanayA bhAvanikSepamicchati // 75 __iti zrIAvazyake nA laghuvrattaiH / chaH / etc. graMthAnaM 13000 cha etc. __ 1 The opening lines may be compared with those of No. 1094.

Page #496
459 1098. ] 111. 4 Malasatras AvazyakasUtraniryuktayavacUrNi Avasyakasutraniryuktyavacurni 256. No. 1098 1883-84. Size.- Io in. by 4g in. Extent.-- 83-2=81 folios ; 21 lines to a page ; 70 letters to a line. Description.- Country paper rough and greyish ; Devanagari cha racters; small, legible and very good hand-writing; borders ruled in four lines in black ink; red chalk used; numbers for foll. entered only once; foll. I and 2 lacking; this Ms. ends abruptly; it is however complete up to the commentary of the 65th gatha of pratyAkhyAnaniyukti; foll. 25 to 34 and 38 to 82 more or less worm-eaten; edges of the 2nd and 83rd foll. worn out; condition fair. Age.- Old. Author.-- Not known. Subject.-- A small commentary in Sanskrit elucidating the niryukti of Avasyakasutra. Begins.-fol. 3deg tAn / oghaznutaM tava samAcaraMtIti zrutasamAcArakAn // 40 // goviM0 tatto0 etadvAthAyaM vRttau nAsti / tato goviMdAcAryebhyo namo'stu / anuyoge'rthakathane etc. devavAcako vakSye // 50 // iti sthavirAvalyava cUrNiH Ends.- fol. 83deg tRSNA viSayacchA // 64 ||...vccheden atulopazamo madhyasthabhAvaH / manuSyANAM ... // 65 // tato tataH pratyAkhyAnAta zuddha ... sphurite / tataH karmavivekaH karmanirjarA / tataH krameNa pUrvakaraNamapUrvazrutAdhyavasAya | tataH This ends thus abruptly. Reference.- See R. G. Bhandarkar's Report for 1883-84.

Page #497
460 Jaina Literature and Philosophy ( 1099. stapahtumia AvasyakasutravrttipradezavyAkhyATippanaka pradesavyakhyatippanaka No. 10991 130. 1873-74, Size.-- in. by 41 in. Extent. -- 62 folios ; 17 lines to a page ; 75 letters to a line. Description.-- Country paper thin and brittle ; Devanagari cha racters with TAE ; small, legible and good handwriting ; borders ruled in four lines in black ink ; yellow pigment and red chalk, too, used; nos. for foll. entered twice as usual; edges of several foll. worn out; small bits of paper pasted to fol. 286; last few foll. much damaged ; strips of paper pasted to foll. 59 and 60; condition on the whole poor ; complete ; extent 4600(?) slokas. Age.-- Not later than the 17th century. Author.-- Hemacandra Suri, disciple of Abhayadeva Suri. For his life and works see Anandasagara Suri's introduction (pp. 9-10 ) of Jivasamasa. There this Suri has quoted a few lines from the Visesavasyakavftti. From this we can see that this Hemacandra has composed the following works : (1) trazuaretqlar, (2) napravapur, ( 3 ) aguileraia, (8) SICITAIS, (5) 34RTATGIETE, (6) FIATAfaacut, (7) HTAT, ( 8 ) waaranufaarur, ( 9 ) aparatas * and ( 10 ) fastarauaacut ( Samvat 1175 ). 1 Really speaking, this and the following work No. 11oo ought to have been assigned a place after No. 1078. 2 This is the same work as described here. 3 See Nos. 635-641. 4 This work seems to be lost. It is alluded to in Anuyogadvdravyttt (p. 2b). The pertinent line is as under: "Tang farturang "

Page #498
1099.1 III. 4 Malasatras 461 Subject.- A gloss on the commentary to Avasykasutravstti com posed by Haribhadra Suri. Begins.- fol. I'OM namo vItarAgAya // jagattrayamatikramya sthitA yasya pdtryii| viSNoriva tamAnamya zrImadAdyajinezvaraM // 1 // zeSAnApa namaskRtya jinAnajitapUrvakAn / zrImato vardhamAnAMtAna muktizarmavidhAyinaH // 2 // sampAsitagurujanataH samadhigataM kiMcidAtmasaMsmRtaye / saMkSepAdAvazyakaviSayaM TippanamahaM vacmi // 3 // etc. Ends.- fol. 62deg sAMprataM kulmASAnAbhityAcAmlaM prAyogyaM ca didarzayiSurAha / / kummAsA puNa putvamityAdi / saktUnAzrityAha / sattugA javANamityAdi subodhaM navaraM godhUmayavabhA(15)jikA dhANikAH zeSaM prAyaH sugamaM / yAvatpratyAkhyAnaniyuktiH samApteti // cha / tatsamAptau ca zrImadabhayadevamaricaraNAMbujacaMcarIkadhIhemacaMdrasUriviracita AvazyakavRttipradezavyAkhyATippanaka samAptamiti // cha / iti gurujanamUlAdarthajAtaM svabuddhyA yadavagatamihAtmasmRtyupAdAnahetoH / tadupacaritametadyatra kiMcitsadoSaM mayi kRtagurutoSaistattu zodhyaM muniiNdreH|| chanAsthasya hi mohaH kasya na bhavatIhi mohavazagasya / sadbuddhivirahitAnAM vizeSato madvidhAsamatAM / iti / cha / graM. 46...? This is followed by the lines in a different hand as under: saMvignenAlipadA 'tagaNapativijayasenasUrINAM / zrIrAmavijayakRtinA citkoze pratiriyaM muktA // 1 // Reference.- Published in D. L. J. P. F. Series as No. 53 in A. D. 1920.

Page #499
462 Jaina Literature and Philosophy [ 1001. rasah Ta ! Avasyakasutravrttio."; pravezavyAkhyATippanaka pradesawyakhyatippanaka No. 1100 140. 1881-82. Size.- 101 in. by 41 in. Extent.- 97+1 =98 folios ; 15 lines to a page ; 52 letters to a line. Description. Country paper thin and white; Devanagari chara. cters with occasional Tea ; small, legible and very good hand-writing ; borders neatly ruled in three lines in red ink; nos, for foll. entered twice as usual ; foll. 14 and 975 blank; fol. 73 repeated ; edges of the first and the last foll. slightly worn out ; condition very good; com plete; extent 564 slokas. Age.- Not modern. Begins.-- fol. xb TAT easie ATEAUAlaska etc. as in No. 1099. Ends.-- fol. 97o ANTA BATOT etc. up to ghai gfa as in No. 1099. This is followed by jur 468 1 Ta Hard etc. N. B.-For further particulars see No. 1099. AvazyakasUtravRtti Avasyakasutra vrttiviSamapadaparyAya visamapadaparyaya No. 1101 736 (18). 1875-76. Extent.- fol. 178 to fol. 236. Description.- Complete. For other details see Pancavastuka paryaya No. 736 (1). vara d. 1875-76. Author. - Anonymous. Subject. - Difficult words etc. occurring in Avasyakasu travrtti explained in Sanskrit.

Page #500
itor:] M. 4 Malasatras 463 Begins.- fol. 17deg , jinetyAdi jinAH kSINopazAMtamohanIyakarmANaznastha vItarAgAH / kevalinaH aSTamahApAtihAryAdIMdra tatkAraNatvAt zravaNakAraNa tvAt tadavApleH jJAnakriyAvyApteH / etc. Ends.- fol. 23b iti haDaphau dezamUlaguNa iti zrAvakavratAni / vaudhagoviMda iti ekaviMzativArAn / pravrajita ityAmnAyo draSTavyaH / ityAvazyakavRttiviSamapadaparyAyAH smaaptaaH|| AvazyakasUtravRtti AvasyakasutravrttiviSamapadaparyAya visamapadaparyaya 789 (18). No. 1102 1895-1902. Extent.- fol. 26deg to fol. 384. Description.- Complete. For other details see Pancavastuka paryaya No. 89827 Begins.- fol. 26deg 3 jinetyAdi jinAH / kSINopazAMta etc. as in No: IION: - fol. 34* kathaM mAsetyAdi / vihANAtIti bhedA / ANa ti AjJA kAyavivayA iti kartavyA / / pUrva draSTavyamiti bhAvaH / / cha / / AvazyakatterviSamapadaparyAyAH samArthatAH // cha / -- fol. 34* maMgyate aneneti maMgaM dharma / saMzayata iti saMdeho dvidhA arthasaMdeho'narthasaMdehazca / sUtropadiSTamiti sUtraM / naMdI / etc. - fol. 35* Atriveti pUrvavidhaH pUrva / evamiti vakkhANavihI / dAravihI / virubhai iti laggai vidhAna iti bhedataH / lehavaNamiti AvazyakaTippaNakaM Ends.- fol. 38* iti haDaphau / dezamUlaguNa etc.. N. B.--For other details see No. IIOI.

Page #501
464 Jaina Literature and Philosophy (1103. vizeSAvazyakabhASya Visesavasyakabhasya ( FETETEFETHIE ) ( Visesavassayabhasa ) No. 1103 1256. 1887-91. Size.- 9 in. by 43 in. Extent.- 122 + 2 = 124 folios ; 15 lines to a page ; 45 letters to a line. Description. - Country paper thin and greyish ; Devanagari cha racters with SETS; small, bold, clear and good handwriting ; borders ruled in four lines in black ink ; red chalk used; yellow pigment, too, though very rarely ; foll. numbered in the right-hand margin; fol. 1 blank; marginal notes on fol. 19; fol. 30 repeated; the last but one line of the last fol. thrice scratched with black ink; edges of the last three foll. and those of the first fol. partly worn out; condition very fair ; complete. Age. - Samvat 1458. Author.- Jinabhadra Gani Ksamasramana. He is said to have died in Vira Samvat 1115. He is the author of the following works: - (i) Sanskrit commentary of Visesavasyakabhasya, (ii) Bphatsangrahani, (iii) Ksetrasamasa, (iv) Visesanavati, (v) Dhyanasataka, (vi) Jitakalpa and (vii) Nisithabhasya. The authorship of the last work is somewhat doubtful. See p. 468. Subject. - This important work is a metrical commentry in Prakrit elucidating Bhadrabahusvamin's niryuktion Samayikadhyayana, a part of Avasyakasutra. Vasavadatta and Tarangavati are alluded to in this work. That is what strikes me at present. Begins. fol. 15 Fa: gadgart 11 kayapavayaNappaNAmo vocchaM caraNoguNasaMgahaM spddh'| strehrangati gougatgandai I etc.

Page #502
465 1104.] III. 4 Malasatras Ends.- fol. 122 iya parisamApitamidaM sAmAiyami(matthao samAseNaM / / vittharao kevaliNo puvvavihU(? o) vA pabhAsaMti // savvANuogamUlaM bhAsaM sAmAiya(ssa) soUNa / hoi parikammiyamaI joggo sesANuogassa // 4314 iti vizeSAvazyakasUtraM samAptaM // cha // saMvat 1458 varSe mArgazarazudi 7 zanau ayaha zrImada(da)Nahalapure nagare vAcanAcAryajayakIrtimizrAvAcanArtha 'prAgvATa'jJAtIyamaharAmAkana pustikA likhitaa| lekhaka pAThakayoH // zivamastu // cha / cha / cha / graMthAgraM 5000 mAjanai // . Reference.- Published in the Yasovijaya Jaina Granthamala. Publi shed along with Maladharin Hemacandra Suri's commentary in the same series in.7 parts in Vira-Samvats 2437, 2438, 2438, 2438, 2439, 2439 and 2440 (?) respectively. Also published with Kotyacarya's commentary by Rsabhdevji Kesarimalji Svetambara-Samstha, Rutlam, in two parts in A. D. 1936 and 1937 respectively. Its Gujarati translation based upon Hemacandra's commentary has been published in two parts by the Agamodaya Samiti in A. D. 1924 and 1927 respectively. This Samiti has also published an alphabetical index of the gathas of this bhasya in A. D. 1923. For additional Mss. see B. B. R. A. S. vols. III-IV, p. 396 and G. O. Series vol. XXI, pp. 9 and 13. vizeSAvazyakabhASya Visesavasyakabhasya 1936. No. 1104 1886-92. Size.- 10 in. by 4t in. Extent.-- 84 folios ; 15 lines to a page : 56 letters to a line. Description.- Country paper thin and grey ; Devanagari charac ters with TEHETS ; neither too big nor too small, legible and good hand-writing ; borders ruled in four lines in black ink ; fol. 1* blank; yellow pigment used; numbers 9 J.L.P.]

Page #503
466 Jaina Literature and Philosophy [FITOS: for foll. entered twice as usual ; the 84th (last) fol. slightly torn ; its edges worn out; condition on the whole good; complete. Age.-- Seems to be old. Begins.- fol. ' mai namaH zrIjinabhadragaNikSamAzramaNebhyaH / / kayapavayaNappaNAmo etc. as in No. 1103. Ends.-- fol. 84deg3600 // iya parisamApiyamiyaM etc. up to sesANuogassa as in No. 1103. This is followed by the lines as under :iti samAptaM zrIvizeSAvazyakasUtraM / graMthAnaM gAhA 3672 zrutasalilapAthodhaye kutrApyapratihatabuddhaye jagajjaMtusaMtatirvihite(?) kAMtikAtyaMtika(?) samAdhAya / bhASyaratnarohaNAya lasadguNAya bhagavate zrIjinabhadragaNikSamAzramaNAya namaH // cha / // shriiH|| zubhaM bhavatuH // kalyANamastuH ||ch||| shriiH|| leSakapAThakayoH // ch|| N. B.-- For other details see No. 1103. vizeSAvazyakabhASya Visesivasyakabhasya No. 1105 . . 56. - 1880-81. Size.-25 in. by 2 in. Extent.--131 (?) leaves ; 4 to 6 lines to a leaf; 124 letters to a line. Description.- Palm-leaf thin and greyish ; Devanagari characters with pRSThamAtrAs3; small, legible and very good hand-writing; this Ms. presents an appearance of the work having been written in three separate columns; but really it is not so since the lines are continuous; borders not ruled; there are two holes in each leaf in the interspaces between the columns; red chalk used ; leaves numbered in both the margins as usual ; the first leaf seems to be missing or misplaced; since the leaves are in a poor condition, with edges worn out in several places, it is not advisable

Page #504
1106.1 III. 4 Malasatras 467 to make a search for it; otherwise the work complete'3B two wooden boards encompass the Ms.; 4336 verses. Age.- Fairly old. Begins.- leaf 23 (natthi) visasatthaMtarabhAvAo so khapuppha va // ' jaMgamavavahArA loyavvavahAratapparA so ya / pAraNa visesamau(o) to te taggAhiNo do vi // Ends.- leaf 1316(?) hoi parikammiyamatI jogo(ggo) sesANuyogassa // 4336 vizeSAvazyakabhASyaM samAptaM ... ... maMgalaM mahA ... ... N. B.-- For further particulars see No. 1103. vizeSAvazyakabhASya Visesavasyakabhasya vyAkhyAnasahita with vyakhyana 57. No. 1106 1880-81. Size.-- 25} in. by 2 in. Extent.-332 leaves; 5 to 7 lines to a leaf; 120 to 140 letters to - a line. Description.- Palm-leaf brittle and greyish ; Devanagari chara cters with pRSThamAtrAs; big, legible and good hand-writing; this Ms. presents an appearance of the work having been written into three separate columns; but really it is not so ; borders not ruled; this Ms. contains probably both the text and the commentary; some of the leaves broken ; some damaged ; condition on the whole poor ; leaves numbered in both the margins : in the right-hand one as 1, 2 etc. and in the left-hand one as for 4 etc.; red chalk used; complete; extent 13700 slokas. 1 This is the latter half of the 36th verse of the printed edition.

Page #505
468 Jaina Literature and Philosophy (1106. Age. - Samvat 1138. Author of the commentary.- Kotyacarya. Some identify him with Silanka Suri, the commentator of the ist two angas probably because it is so suggested in Prabhavakacaritra. But Anandasagara Suri refutes this in his Sanskrit introduction (p. 3) to Visesavasyakabhasya edited by him along with Kotyacarya's commentary on it. Subject.- Visesavasyakabhasya explained in Sanskrit. In this Kotya. carya's commentary on the 234th gatha' of Visesavasyakabhasya we come across the words" fararta TIA: ". Since neither any tradition nor any other evidence seems to suggest that Kotyacarya had composed a bhasya on Nisithasutra, it may be that this ullekha belongs to the svopajna commentary of Visesavasyakabhasya. If so, Jinabhadra Gani may be looked upon as the author of the bhasya on Nisithasutra. Kotyacarya's remark "Alora Tatfo TATTHI STUA:; evamanenaiva vRddhikrameNetyAdevAkana cedaM bhUyasISu prati hazyate" made by him while commenting upon the 637th gatha of Visesa. vasyakabhasya on p. 224 leads us to believe that Kotyacarya cannot be a direct pupil of Jinabhadra, and thus it goes against what is suggested in the pattavalis of the Kharatara gaccha noted in Indian Antiquary (vol. XI, pp. 243-249). For some of quotations which directly or indirectly mention Jinabhata and Jinabhadra see Jinavijaya's intro duction (p. 15 ) to his edition of Jitakalpasutra. Begins. -- (com.) fol. 16 ... ... ... ... stagrau Aerofafritasafaret ar ... Suite agraenta vafat ... ... griauna: 1 920COUPIT Rate I etc. --(com.) fol. 3255 receta suretta Ela Teater Treat galera purAha / kiM puNarukkamiUNaM joggaM tivihaM tti / tRtIyasthAne karaNasya vyAkhyAnaM 1 This gatha begins with "TOTEATTE" and it is 235th according to the printed edition ( Agamodaya Samiti Series ). ? See the Gujarati introduction (p. 9) to Jinavijaya's edition of Jitakalpasutra.

Page #506
106.] III. 4 Malasatras 469 kRtaM na tu yathoddezaM nirdeza iti / nyAyAhe(de)bamastu tiviheNaM na karemi na kAravami kareMta etc. karmaNa iti bhaavaarthH| tathAhi dede)shi(si)tmityaadi| evaM vyatyAsaM kurvatA sUtrakAreNa darzitaM yaduta sa yogH| karaNavazAniyatamapradhAna iti / kiM kAraNamityAha / tadabhAve karaNa(bhA)ve bhAvAdyogasya tadabhAve cApyabhAvAtkaraNaM karturanarthAntaramiti / kRtvA tathA tassetyAdi / tasya yogasya tadAdhAratvAt karaNAdhAratvAdasau pradhAna iti tAni kAraNamasyeti / tatkAraNastasmAnca karaNapariNatezca yogasya prAdhAnyaM tathA pariNaMturanarthAntarabhAvAkaraNAnAM karaNamevAsau yogaH Aha yayevamuddezo(s)pyevaM kasmAnna kRta ucyate / yogasya pratyAkhyayatvena prAdhAnyakhyApanArtha yata eva ca evaM tasya tadAdhAratA(s)to sarvA gAthAM paThitvA eto cciya ityAdi / ata etasyApi tanmayatA karaNAtmakatA gamyate / kuta ityAha / karaNayogapariNatirUpatvAtsA(5)vagamyate / ha(na)tA(yAM)tarAtkadAcitkathaMcitsamaye yato(5)bhihitaM / AyA ityaadi| ihAtmaiva paramArthato()hiMsA na bAhyA zubhamanoyogapariNAmAdananyatvAdviparyaye viparyayatastathA ca jo ityAdi evaM kartA karma karaNamiti ko(s)yamamISAM vibhAga ucyate / bhaNitamasakRdetattathAhi // tasyaiva paryAyA' ... ... Ends.- ( com.) fol. 332deg bhASyaM sAmAyikasya zrutvA sAmAyikasyamA vRttiM zrutvA kiMviziSTAmimAmityAha sarvAnuyogamUlaM sarvAnuyogasya kAraNaM kimata Aha bhavati saMpadyate kaH yogyo bhavyaH kuta ityAha parakammitamatIti etatparikamitamatitvAdetatprabodhitabuddhitvAt / kasya yogyo bhavatItyata Aha / zeSAnuyogasya dshvkaalikaacaaraadynuyogsyti| samAptamidaM vizeSAvazyakam // cha / / kRtijinabhadragaNikSamAzramaNapUjyapAdAnAM // cha / bhASyaM sAmAyikasya sphuTavikaTapadArthopagUDhaM yadeta__ cchrImatpUjyairakAri kSatakaluSadhiyAM bhUrisaMskArakAri / tasya vyAkhyAnamAtraM kimapi vidadhatA yanmayA puNyamApta pretyAhaM vAglameyaM paramaparimitAM prItimatraiva tena / / / / likhitaM pustakaM cedaM nemikumArasaMjJinA / 'prAgvATa'kulajAtena zuddhAkSaravilekhinA // vi. saM. 1138 pauSa vadi 7 // koTyAcAryakRtA TIkA samAteti / / graMthAgramasyAM trayodaza sahasrANi saptazatAdhikAni // 13700 / pustakaM cedaM visra(zru)tazrIjinezvarasUriziSyasya jinavallabhagaNeriti / Reference.--Both the text and the commentary published. See p. 465. 1. See pp. 964 and 965 of the printed edition.

Page #507
470 . Jaina Literature and Philosophy [1107. vizeSAvazyakabhASya Visesavasyakabhasya vRttisahita with vrtti No. 1107 1255. 1887-91. Size.-- 122 in. by 48 in. Extent.-- 407 + 2 - 1 - 2 = 406 folios ; 17 lines to a page ; 64 letters to a line. Description.-- Country paper thin and grey ; Devanagari characters with qehers; big, bold, beautiful and legible hand-writing ; borders ruled in two pairs of lines in black ink ; space between the two pairs coloured red; red chalk used; a piece of paper of the same size as the fol. pasted to fol. 18; same is the case with the 407 ( last ) fol. ; unnumbered sides have a small circular disc in red colour in the centre, whereas the numbered, in the two margins also; small strips of paper pasted to foll. 2,5, 56 and 10o; edges of the foll. 1-7, 19-20, 53, 115-120, 136, 117-150, 179, 203-211 and 391 more or less worn out; foll. 4 and 188 partly torn; fol. 245 badly burnt and foll. 56, 74, 100, 188 and 264 slightly; condition tolerably good; foll. 11s and 268 repeated; fol. 228 is lacking ; fol. 278 etc. up to 399 seem to be mistaken for 378, 379 etc. up to 399; these wrongly numbered foll. 378,379 etc. and the rightly numbered toll. 300 etc up to 403 also numbered in the same margin as I, 2 etc.; the zooth fol. is rightly numbered; the preceding, of course, wrongly numbered as 399; the fol. 331 also numbered as 332 and 333, the subsequent ones hence numbered as 334, 335 etc. Age.- Seems to be fairly old. Author of the commentary-Maladharin Hemacandra Suri, pupil of Abhayadeva Suri. For his works etc. see No. 1099. Subject.-- The text along with its Sanskrit commentary. Begins.- (text) fol. rb 54974o etc. as in No. 1103.

Page #508
rtog.] Begins.--(com.) fol. rb namo bhagavate zrImahAvIrAya / iii. 4 Malasatras zrI siddhArthanareMdra vizrutakulavyomapravRttodayaH / sadbodhAMzunirastadustara mahAmohAMdhakArasthitiH dRptAzeSa kuvAdikauzika kulaprItipraNodakSamo jIyAdaskhalita pratApataraNiH zrIvarddhamAno jinaH etc. Ends.-(text) fol. 405b iya parisamApiyamidaM etc. up to sesANuogassa as in No. 1103. - ( com. ) fol. 4064 kSamo bhavatIti catvAriMzadgAthArthaH 799 pUrve cAdhyavasAneha gaNitAnItyeSA ziSyahitA[na] paryaMtavyAkhyAtagAthAnAM 288 (10) 3 ubhayaM vyAkhyAtabhASyagAthAnAM 3682 zeSANi tu caturdazAdhikasaptazatAni atidezenaiva gatAni na tu vyAkhyAtAni ato neha gaNitAnItyeSA ziSyahitA nAma vizeSAvazyakavRttiH samAptAH // cha // etc. - ( com. ) fol. 407 ka zrIjina bhadragaNeH pUjyAH saitAni bhASyavacanAni / tarkavyatikaradurgANyatigaMbhIrANi lalitAni // 1 vivRtAni svayameva hi kA grAhyA (SS)cAryaizva budhajanapravaraiH saMgacchate va punarapi mamApi vRtteH prayAso ( ( ) // 2 RjubhaNitimicchatAmiha tathApi matto ( ( )pi maMdabuddhInAM upakAra (:) keSAMcitsamIkSyate ziSTalokAnAM // 3 // tenAtmaparopakRrti saMbhAvya mayA (S) pi bhASyavRttiriyaM vihitA zruteti bhaktiM ca (zu) mavinodaM ca ciMtayatA // 4 yaceha kimapi vitathaM likhitamanAbhogataH kubodhAdvA / tatsarve madhyasthairmagyanukaMpApraraiH zodhyaM // 5 kRtvA ca vivaraNamidaM yat puNyamupArjitaM kiMcit // tenAbhavakSayAdastu janamate prItyavicchedaH // 6 // 471 graMthAgraM pratyakSaragaNanayA sahasra 28000 // cha / This is followed by the lines in a different hand as under: . zrImat 'tapa' gaNagaganAMgaNa gaganasaNiprabhaiH svapuNyArthe / vijayANaMdamunIMdvaizvitkoze (S) sau pratirmumuce // 1 // Reference.-Published. See No. 1103.1

Page #509
472 vizeSAvazyakabhASya greenda No. 1108 Jaina Literature and Philosophy Age.- Pretty old. Begins. (text) fol. 1b [ 1108. Visesavasykabhasya with vrtti Size. 11 in. by 4 in. Extent. 440 folios; 18 lines to a page; 59 letters to a line. Description.- Country paper thin, brittle and grey; Devanagari characters with ; bold, big, legible and elegant hand-writing; borders ruled in two pairs of lines in black ink; the space between the pairs coloured red; unnumbered sides have a small circular disc in red colour in the centre, whereas the numbered, in the two margins, also; several foll. horribly damaged; a piece of paper of the same size as the fol. pasted to fol. 1; the second fol. badly torn in three pieces; the third half torn; fol. 4, 122, 439 and 440 torn in two pieces; foll. 5-110, 333 and 357-359 very badly damaged; so they should be handled very carefully; strips of paper pasted to foll. 40, 42, 46, 46, 47, 48, 49, 50, 51, 56, 59, 61a, 64, 65, 76, 80, 81, 82*, 93, 97, 1orb, and several other foll.; fol. 174 partly torn; at times nos. for foll. worn out e. g. those of 201, 202 etc.; condition poor; foll. 365-367 also numbered as 1, 2 and 3 in the same margin. dr "" 1228. 1884-87. qar etc. as in No. 1103. --(com.) fol. rb N namo bhagavate zrImahAvIrAya // affefat etc. as in No. 1107. Ends.-- (text) tol. 4392 iya parisamApiyamidaM etc. up to joggo as in No. 1107. Then the portion is worn out. - ( com. ) fol. 440 kva bhIjinabhadra etc. up to prItryavicchedaH // 6 as in No. 1107. This is followed by the line as under

Page #510
t109.] Ill. 4 Malasatras graMthAnaM pratyakSaragaNanayA sahasra 28000 cha / cha / N. B. For further particulars see No. 1107. vizeSAvazyaka bhASya vRttisahita No. 1109 Size. 10 in. by 4 in. Extent. Age. Samvat 1673. Begins.--(text) fol. 99a rw 37 Description. Country paper thin and greyish; Devanagari characters with occasional ITS; neither too big nor too small, clear and fair hand-writing; red chalk used; borders ruled in four lines in black ink; foll. I to 98, 161 to 254, 429 and 624 lacking; so incomplete; edges of foll. 99 to 101 slightly worn out; condition fair; the last two foll. stained with blue ink to a certain extent; extent 28976 slokas. 6739894 2 479 folios; 15 lines to a page; 44 letters to a line. 473 Visesavasyakabhasya with vrtti iha sajjhamoggahAINa saMsayAittaNaM taha vi nAma | ambhuvagaM tu bhaNNai nANaM viya saMsathAI ya // - ( com.) fol. 994 abruptly ssiyamityatra yadanisRtaM muktaM tadapi gavAdikra(ka) mazvAdirUpeNa etc. Ends. (text) fol. 671b 625. 1895-98. --(.com. ) fol. 673deg as in No. 1108. 60 [J. L. P.] iya parisamApiyamidaM etc. up to sesANuogassa as in No. 1103. kva zrI jina (bhadra ) etc. up to prayAso'na 2 Then we have:

Page #511
474 faina Literature and Philosophy 110. iti zrIvizeSAvazyakavRttiH / / 28976 // saM0 1673 mAha su. N. B.- For further particulars see No. 1108. vizeSAvazyakabhASya Visesavasyakabhasya vRttisAhata with vrtti No. 1110 1254 1887-91. Size.-- 10f in. by 45 in. Extent.-- 355 folios ; 17 lines to a page ; 43 letters to a line. Description.- Country paper thick, smooth and greyish ; Deva nagari characters with occasional AETS ; bold, big, clear and good hand-writing; borders ruled in four red lines; foll. numbered in the right-hand margin; foll. 273 to 291 also numbered in Gujarati as 1, 2 etc.; fol. 297 wrongly numbered as 197 ; soll. 14 and 355 blank ; edges of the first fol. slightly worn out; some of the foll. seem to be exposed to rain'; condition tolerably good ; red chalk used ; white paste used as a pigment; incomplete, though the last fol, is blank. Age.- Pretty old. Begins.- (text) fol. 16 #UTTUOTTUTTAT etc., as in No. 1103. ,," - (com.) fol. ab A: staralgte 1 wtfagreinta etc. as in No. 1107. >>-( text ) fol. 354 agar AAP UTUT etc. Ends.-- (text) fol. 355 nahi paccakkhadhammatareNa tddhmmmettghnnaao| kayagatauvasiddhI kuMbhANiccamettassa //

Page #512
IIII.] Ill. 4 Malasatras Ends. -- (com) fol. 355 2 sarvatraitanna lakSyata iti 17000 athavA apratyakSamiMdrayajaM jJAnaM pUrve pratipAditavyutpattyA'kSasya jIvasya sU ( ? sva ) vyatiriktanimittavizeSAjjAyamAnAd dhUmAdagnijJAnavacca vyatiriktAni ca nimittAnyakSasya jIvasya karaNAnIMdriyANi maMtavyAni yacca pratyakSaM na tajjIvastha nimittAMtarAt jJAyate kiMtu jIvastatra sAkSAdeva jJeyaM pazyati yathA'vadhimanaH paryAyaf. This Ms. ends here abruptly. N. B. For further particulars see No. 1107. vizeSAvazyakabhASya vRttisahita No. 1111 475 Visesavasyakabhasya with vrtti 768. 1875-76. Size.-10 in. by 48 in. Extent. 94+38 +1+110+32 +470+7-5+29+77+226 - 3 +4+201+2=1252 folios, 9 lines to a page; 42 letters to a line. Description. Country paper thick, rough and white; Devanagari characters; bold, big, clear and good hand-writing; borders unruled; the right and the left edges coloured red; the other two, green; red chalk and yellow pigment used; this Ms. contains both the text and the commentary; fol. 1a blank; numbers for foll. I to 94 entered twice as usual; then the following foll. 1 to 38 not marked in continuation but only as 1, 2 etc. in the corner; in the second set the fol. 24 blank; in this set foll. 31 to 38 also numberd as 4, 5 etc.; the 39th is not at all numbered; the fol. 39b blank; then again the subseqnent foll. I to 110 numberd in the left-hand corner; in this third set the foll. 63, 83 and 97 repeated; foll. 108 and 109 lacking; in the 4th set the foll. 1 to 470 numberd as in the 3rd set; the foll. 3, 9, 18, 114, 291, 311, and 432 repeated; foll. 50, 53, 91, 157 and 309 lacking; the fol. 470 numbered as 39, too; the follow

Page #513
476 Jaina Literature and Philosophy 1 . ing foll. up to 68 only numbered as 40, 41 etc. in the right-hand corner; then commences the fifth set; herein foll. numbered as 1, 2 etc. up to 77 ; then we have the 6th set wherein the foll, are again numbered as 1, 2 etc, up to 226; in this 6th set foll. 33, 87 and 143 missing ; foll. 92, 120, 216 and 226 repeated; then follows the seventh set ; herein foll. numbered as 1, 2 etc. up to 201; the foll. 26 and 143 repeated ; condition very good ; complete, Age.- Appears to be modern. Begins. -- (text) fol. 2b 54Tuu etc, as in No. 1103. , --com.) fol. rb aftaTORTTU AA: 1 FH Hrad Aeratori wifhane etc. as in No. 1107. Ends.- (text) fol. 1962 * 39 G HTATOTTA etc. up to figs(NU) as in No. 1103, >> - (com.) fol. 2006 kka zrIjinabhadra etc. up to prItyavicchedaH 6 as in No. II07. This is followed by the line as under : iti zrIvizeSAvazyaka samAptaM // N. B.- For further particulars see No. 1107. ziSyahitA (rastalapur a] Sisyahita [ Visesavasyakabhasyavrtti ] No. 1112 58. 1880-81. Size.--- 279 in. by 2 in. Extent.- 345 - I = 344 leaves; 5 to 7 lines' to a leaf; tio to 120 letters to a line.

Page #514
1112.j III. 4 Mulasutras 477 Description.- Palm-leaf thin and greyish; Devaragari characters with TATEITS; sufficiently big, legible and very good hand-writing; leaves 22 to IIM are mostly written in a smaller hand ; this Ms. presents an appearance of the work having been written in three separate columns, but really it is not so, since the lines are continuous ; borders of each of the columns neatly ruled in two pairs of lines in black ink; the space between these pairs coloured red; red chalk used; there are two holes in each leaf in the interspaces bet, ween the columns ; leaves numbered in both the margins : in the right-hand margin as usual ; in the left-hand one as zrI, 3, eka etc ; the Ist leaf missing; almost every leaf has its edges slightly worn out; leaves I to 21 are in a frag. mentary condition ; the following few leaves worm-eaten ; condition poor; the Ms. placed between two wooden boards; one extra blank leaf in the beginning; colophon composed by Asaditya. Age.- Fairly old. Author.-- Maladharin Hemacandra Suri. For details see p. 460. Subject.- A Sanskrit commentary elucidating Visesavasyaka ____bhasya. It is styled as Sisyahita and Brhadvrtti as well. Begins.- leaf 2. TAdivastuvaditi / evaM prastutanAmasthApanAdravyAyuddezAnAmapi' tyAdi bhedAnedo yo etc. atha samAsoddezaM vivakSurAha / saMkhevA ityAdi etc. Fnds.-leaf 345 bhavatIti catvAriMzadAthArthaH // cha // 799 pUrva cAdyavasAnaparyaMta vyAkhyAtAnAM gAthAnAM 2823 ubhayaM bhASyagAthAnAM 3622 zeSANi caturdazAdhikasaptazatAni atidezenaiva gatAni na tu vyAkhyAtAni ato neha gaNitAni // cha // ityeSA ziSyahitA nAma vizeSAvazyakavRttiH parisamAptA // cha / yasyAga pUgakSagha(1)metya zeSA vyAnAdapIhAnyabhave'pi jAtaH / ravarivacchaMtabharaH pratApAt bhavaH pradeyAdRSabho jinaH zaM // 1 // 1 One letter is gone.

Page #515
478 Jaina Literature and Philosophy | III2. astIha sadratnanivAsAdhiSNya muktaprapaMcAvRtabhUmipIThaH / zrImAnanekAMgigaNAzrayazca sanmoDhavaMzaH saridIzatulyaH // 2 tasminvaMze prasRtasuyaza pUritAzAcatuSko dakSatvAdyairvaraguNagaNairanvitaH zrAvako'bhUt / samyaktvAkhyo varagurugirA(5)pAstamithyAtvamohaH zAMtyAhvAno jinapatipadAMbhojayugmadvirephaH // 3 // zIlAlaMkRtakAyA dAnadayoyuktamAnasA satataM / jinapUjAratacittA yazomatistasya varapatnI // 4 // tAbhyAmAdijineMdrapUjanavidhAbAsaktacitto'nizaM sUnuH sarvajanopakArakaraNaprahaH kRpAmaMdiraM / nityaM savrativargadAnanirato mAnAdidoSojjhito gAMbhIryAdiguNaughalabdhamahimA pradyumnasaMjJo'jani // 5 // itazca // ihaivavaMze jinapAdabhaktaH suzrAvako vosakasaMjJako'bhUt / sudharmakarmodyatamAnasA ca tasyAgrayabhAryA'jani sesikAkhyA // 6 // tasyAH sAhaDasaMjJakaH sucaritaH sUnurmahAtmA(s) bhava cchreSThA cArucaritralakSaNavatI putrI ca lakSmIMgitA / yA lakSmIriva kezavasya dayitA pradyamnanAmno gRhe vikhyAtAtmaguNotkareNa janatAcetazcamatkAriNA // 7 // apatyasaptakaM tasyA babhUva guNamaMdiram / sutAstrayo mahAtmAnazcatasraH putrikAstathA // 8 // jyeSThaH sUnurudAratAdibhiriha prAptaprasiddhirguNe rAgrayairAmrayazo(5)bhidho jinamahavyAsaMgatannidhva(?)dhIH / svacchaMdaM vicarana vareNyakarivadyaH kIrtiga(gA?)hataiH sahAnAsavalipsayArthimadhupavrAtaiH sadA sevyate // 9 //

Page #516
i112.] 111. 4. Malasatras voDhuM niyukto'khilakAryabhAradhUraM dhaureya iva svapitrA / dasyo'pi yastAM vahati sma dhImAn vizrabdhacetAH parakAryahetoH // 10 // jinamAnarato nityaM dvitIyo dhavalAbhidhaH sadguNAkaracakSuSyastRtIyo jesalAhvayaH // 11 // yazomatirjyeSThatA vareNyA tathA parAzrIriti cAruputrI / suzIlayuktA'tha ca rukmiNIti tatazva || yataH // tadyathA / rAjImatI turyasutA babhUva / / 12 / / zrI ' varddhamAnA' khyapure variSThe saMtiSThamAnAmadadhA'nyadA ( 1 ) tha | zrIdevabhadrAkhyamunIMdramUle zubhAva lakSmIrvaradAnadharme // 13 vijJAya prabalaprabhaMjanacaladdIpAMkurAlIsamaM loke jIvitayauvanArthaviSayA. mAyazeSaM sadA / dhImadbhirbhuvapuNyasaMgrahakRte karmakSayaikArthabhiH kartavyaH sunayAjitAtmavibhavaiH saGghAnadharmodyamaH // jJAnopaSTaMbhAbhayavibhedatastrividhamuktamiha dAnaM / jinamatajaladhAvAdyaM gRhiNAM tatrApi bahuphaladaM // 1 // mohAMdhakAzavRtacittadRSTe jJAnapradIpo vRSavartmadarzI / bhavArNavAjjJAnajale nimajjan nRNAM bhavejjJAnamihAyapotaH // 16 // jJAnaM muktipurIpratolI parighapradhvaMsanAnekapo jJAnaM nAkArIMvarasyazikharaprArohasopAnakaM / jJAnaM durgatidurgakUpapatatAmAlaMbanaM dehinAM jJAnaM saMzayapAdapa ruvipinocchede kuThAraH paTuH // 17 // 479

Page #517
480. Jaina Literature and Philosophy (1110. tasyaivamAdhairyatipuMgavedo caMcavacazcArumarIcibhiH saa| saMbodhitA kairaviNIva pazcAda dujjUbhamANA(''syasaroruheha // 18 // lekhayitvA(55) tmasAreNa vizeSAvazyakasya hi / vRttariyaM dvitIyAdhai tasmai sadgurave dadau // 19 // apanayati tamizra(laM) yAvadabiMbaM / dinarajaninilInaM tIvrazItAMzusaMdhaiH / iha jagati bariSyaM pustakaM tAvadetadvidudhamunijanaudhaiH paThayamAnaM pranaMgat // 20 // zrIvikramA.........vagrahacaMdrasaMkhya. tasyAM samarpitaM pravaragurudivase / 21 tadgatAtmA vilikhyedamAzAdityAbhidho dvijH| nijaprajJAnusAreNa prazastimakarodimAM // 22 // References:--Published. See No. 1103. For a Ms. see Limbdi Catalogue No. 2355.

Page #518
tuti.] IV. 4 Malasatras 48 388. THE FOURTH MULASUTRA piNDaniyukti Pindaniryukti (piMDanijjutti) (Pindanijjutti) No. 1113 1879-80. Size.-- 103 in. by 4 in. Extent.- 19 folios ; Is lines to a page ; 48 letters to a line. Description.-- Country paper thin and white; Devanagari charac ters with pRSThamAtrAs; sufficiently big, legible, uniform and elegant hand-writing ; borders ruled in two pairs of lines in black ink; red chalk used; foll. numbered in the righthand margin only; fol. I blank; complete; condition very good. Age.- Samvat 1560. Author.-- Bhadrabahusvamin. For details see Nos. 709 and 1002. Subject.- A Jaina agama dealing with rules and regulations pertaining to food etc. to be accepted by saints. The entire work is composed in 697 verses in Prakrit. Its main topics are as under : (1) piNDanirUpaNa, (2) udgamadoSa, (3) utpAdanAdoSa, (4) eSaNAdoSa and (5) grAsaiSaNAdoSa. For detailed information the reader is referred to pp. 164-167 of "zrInandI-anuyogadvAra-Avazyaka-odhaniyukti-dazabaikAlika-piNDaniyukti-uttarAdhyayanAnAM sUtrasUtragAthAniyuktimUlabhASyabhASyANAmakArAdikramaH aMkazuddhiH laghuIhaMzca viSayAnukramaH (nanyAdigAthAyakA. rAdikramaH aMkazuddhiH laghu haMzca viSayAnukramaH)" published by the Agamodaya Samiti in A. D. 1928. Begins.- fol. t" namo vItarAgAya // piMDe uggamauppAyaNesaNAsaMjoyaNApamANe ya / iMgAla dhama kAraNa aTTavihA piMDanijjuttI // 1 // 61 J.L.P.]

Page #519
Jaina Literature and Philosophy . [rini. piMDa nikAya samUhe saMpiMDaNa piMDaNA ya samavAe / samosaraNa nicaya uvacaya cae ya jjumme ya rAsI ya // 2 // piMDassa u nikkhevo cauktao cchakkao ya kaayvo| kAUNa ya nikkhevaM parUvaNA tassa kAyavvA // 3 // etc. Ends. - fol. 190 eso AhAravihI jaha bhaNio savvabhAvadaMsIhiM / dhammo(?mmA)vasa(ssa)ya(ga)jogA jeNa na hAyati taM kujjA // 96 / / jA jayamANassa bhave virAhaNA suttavihisamaggassa / sA hoi nijjaraphalA ajjhatthavisohijuttassa / / 97 // mahalliyA' piMDanijjuttI sammattA / cha / saMvat 1560 varSe bhAdrapadamAse zuklapakSe aSTamyAM tithau bhaumavAre zrI pattana nagare / zubhaM bhavatu // cha / Reference. The text along with the Prakrit bhasya and Malaya giri's Sanskrit commentary is published in Sheth D. L. J. P. Fund Series as No. 44 in A. D. 1918. For relation of this text with Dasavaikalikasutra see Preface. piNDaniyukti Pindaniryukti No. 1114 10. 1880-81. Size.- 123 in. by 2 in. Extent.- 228-167+1=62 leaves ; 3 to s lines to a leaf; so letters ... to a line. Description.- Palm-leaf durable and greyish; Devanagari charac ters with pRSThamAtrAs; small, legible, uniform and good hand-writing ; this Ms. presents an appearance of the work having been written into two separate columns; but, really speaking it is not so; for, the lines of the first column extend to the second ; red chalk used ; leaves 1 This word seems to have been used with a view to distinguish this Pindaniryukti from the smaller Pindaisananiryukti of the fifth adhyayana of Dasavaikalikasutra. See p. 488.

Page #520
IIS.) IV. 4 Malasatras 483 numbered in both the margins; in the right-hand one as 89, 8C etc., and in the left-hand one as q etc.; thus thu ghu grohA this Ms. starts with the 167th leaf; leaves 1678 and 228b blank; an extra blank leaf preceding the 167a leaf; complete ; condition on the whole good ; there is a hole in the space between the columns of each leaf and a string passes through it; the Ms. is placed between two durable wooden boards; this Ms is well-preserved as it is placed in a card-board box lined with oil-cloth, Age.- Old. Begins.-- leaf 1676 6011 FA: Ha(s) cal(?)or II piMDe uggamauppAyaNesaNa Ends.- leaf 228a eso AhAravihI etc. up to ajjhanthavisehajuttassa || as in No. II13. This is followed by the line as under : __ cha / piMDanijjuttI sammattA || gA 99 N. B.- For other details see No. 1113. piNDaniyukti Pindaniryukti igoulear with Sisyahita (vRtti)sahita (vrtti ) 46. No. 1115 1880-81. Size.--291 in. by 2 in. Extent.--226 leaves ; 4 lines to a leaf ; 135 to 140 letters to a line. Description.- Palm-leaf thin, durable and greyish; Jaina Deva nagari characters with garaS; small, quite legible and very good hand-writing ; this Ms. presents an appearance of the work haying been written in three different columns; but it is not really so ; for, the lines of the first

Page #521
184 Jaina Literature and Philosophy [ius. column extend to the remaining ones; borders of each of the columns ruled in three lines in black ink ; leaves numbered in both the margins; in the right-hand one as 3,2,3 etc., and in the left-hand one as 3, 2, 3, , etc.; leaves 1490 and 150* not quite legible, ink having faded ; the first leaf broken into two parts; several leaves somewhat worm-eaten; some have their edges worn out; condition on the whole tolerably fair ; both the text and the commentary complete; extent 7671 slokas ; one extra blank leaf preceding the first leaf as well as one following the last one; this Ms. is placed between two wooden boards; there is a hole between every two columns and a string passes through it; the commentary styled as "isyahita is composed in Samvat 1160 in Dadhipada (? Dadhipadra i. e. Dahod ) with the help of Mahendra Suri, Parsvadeva Gani and Devacandra Gani, the disciples of Vira Gani's guru Isvara Gaoi; this was revised by Nemi candra Suri, Jinadatta Suri and others in Anahillapataka, Age.-- Fairly old. Author of the commentary.- Vira Gani alias Samudraghosa Suri, pupil of Isvara Gani of the Saravala gaccha. This author was named as Vasanta before he took diksa. His father's name was Vardhamana and that of his mother Sramiti(?). They belonged to the families Bhillavala and Dharkata respectively. Subject. The text with a Sanskrit commentary. From the latter (p. 485 ) we learn that Haribhadra Suri had commenced to compose a commentary on this text. Begins.- (text) fol. 2a foE SITASOITU ete: as in No. 1113. , - (com. ) fol. 16 AR: STTATTI namrAmarezvarakirITaniviSTazoNa ratnaprabhApaTalapATalitAMhipIThAH / atomaati: f@ragris(a)#1(Fi)&arer F:STTTTTTArazi asia 118 W

Page #522
15.] IV.4 Malasatras 485 lokAgrabhAgabhavanA bhavatI(bhI)timuktA jJAnAvalokitasamastapadArthasArthAH / zvA(svAbhAvikasthiraviziSTasukhaiH samRddhAH siddhA vilInaghanakasmamalA jayaMte // 2 // AcArapaMcakasamAcaraNapravINAM(NAH) sarvajJazAsanabhare(rai)kadhuraMdharA ye| te stva)rayo damitadurdamavAdivaMdA vizvopakArakaraNapravaNA jayaMti // 3 // sUtrayataM natipadusphuTayuktiyuktaM yuktipramANanayabhaMgagamairgabhIraM / ye pAThayaMti varasUripadasya .yogyA ste vAcakAzcaturacArugiro jayaMti // 4 // siddhayaMganAsamasamAgamapaTTavAMcchAH sNsaarsaagrsmuttrnnaikcittaaH| zAnAdibhUSaNavibhUSitadehabhAgA rAgAdighAtaratayo yatayo jayaMti // 5 // iti vihitapaMcaparameSTisaMstavo guru(rU)padezena / vakSye ziSyahitAkhyAM vRttimimAM piNddniyukteH|| 6 // paMcAzakAdizAstravyUhapravidhAyakA vivRttimasyAH / Arebhire vidhAtuM pUrva haribhadrasUrivarAH // etc. Ends.- ( text ) fol. 2250 eso AhAravihi etc. , - (com.) fol. 226. iti vIragaNiviracitAyAM ziSyahitAyAM piMDa niyuktivRttau kAraNAkhyamaSTamaM dvAraM samAptamiti // cha / cha / tatsamAptau ca samAptA piMDaniyuktivRttiriti // cha / cha / bho bhavyA iha hi janmajarAmaraNanIranikarapUrite bahuprakAraparibhavapAtAlolbaNe mohamahAvarttasaMvarttanaduruttare kaSAyavaDavAnalajvAlAkarAlo(le) rAgazokadAridryaprabhRti etc. kathamapi mahApuNyaprAgbhAreNa dRSTrA mA vilaMbadhvaM kiM tarhi yathoktapravrajyApAlanArohaNena rigitatamAruhya nivRttipuraM gacchata yena tatrAnaMtajJAnadarzanasukhavIryasaMyuktA nirAkulAH sadaiva tiSTatheti ||ch / cha /

Page #523
[ THIS. 486 Jaina Literature and Philosophy zrI lATa'dezatilakazrI vaTapadraka'vizAlapuragatayoH / zrI bhillavAla'-'dharkaTa'yAtivyomeMdunirmalayoH // 1 zreSTivaravarddhamAna-zramityostIrthanAthamuninamane / ratayorvasaMtanAnA janmotpattiM samAzrutya // 2 pravrajyAgrahaNaM punarAzrRtya vizuddhasAdhuguNavAnmAM / vasativihArizrI caMdra gacchagaganeMdukalpAnAM // 3 satyApi tannAmnA zrIsamudraghoSAbhidhAnasUrINAM / vIra iti prAptAparanAmnA(5)tyaMta vimugdhadhiyA // 4 dIkSAyAH paripAlanazAzvatyatusakalavasatitilakAnAM / zrI saravAlaka'gacchasthavAcanAcAryavaryANAM // 5 adhizvaragaNinAmnAM sRtena saMprAptavIragANanAmnA / ekAdazazatopari SaSTikasaMvatsarodadhi(ke) / / 6 'padR'grAme 'karkazoNake pArzvavartini pravare / vokAusArato(s)kAri piMDaniyuktivRttiriyaM / / 7 teSAmevAM cezvaragaNinAM zrImanmaheMdrasUrivarAH / sakalAgamapAragatA dharmakathAkathananiratAzca // 8 apare(s)pi pAzva(zca)devAbhidhAnagaNinaH prdhaanmNtrjnyaaH| ucitatyA abhyarthitasUrAH saMgrahaparAzca dRDhaM / / 9 anye()pi devacaMdrAbhidhAkhyA gaNinaH kriyAparAH saralAH / kSAMtyAdidharmanicayAH parahitaratA yA vinItAzca // 10 ete trayo()pi ziSyAH sakalajanAnaMdadAyino'tyarthe / devAnAmapi baMjjAnaM haMtu ciraMtanA valaye // 11 yeSAM bhaktapradAnamukhyopaSTaMbhaprasAdena / nitarAM nirAkulenAkAri mayaiSA sphuTA vRttiH // 12 zrInemicaMdramUri-zrIjinadattAbhidhAnasUryAyaiH / zrImatyaNahillapATaka'pure vyazodhIyamupayuktaiH // 13 pazyati tathApi yadi ko(7)pi dUSaNaM kiMcidalpamitaradvA / tanmayi kRtAnukaMpa sa zuddhadhI(:) zodhayedvibudhaH // 14 kasya na chamasa syAnAbhoga syAdatIva viduSo(Da)pi / nitarAM vimugdhabuddhaH kiM punarasmAdazajanasya // 15

Page #524
1116.] piNDaniryukti vivecana sahita cha || graMthAgraM zlokasaMkhyAyAM // 7671 // cha // cha // samApteti // cha // cha || zivamastu sarvvajagataH // cha // maMgalaM mahAzrIH // cha // 15 IV. 4 Malasatras yAvazcaMdro pAvacca bhAskaro yAvadamaragirimukhyAH / tiSThati jagati tAvannaMdatu sutarAmiyaM vRttiH // 16 iti vyastimitAM kRtvA yatkiMcidupArjitaM mayA puNyaM / tene tasthA (:) pAThe samudyato bhavatu sAdhujanaH // 17 evaM sapta sahasrA zataSaGkA (TUra) caikasaptatizvAsyAH // dvAtriMzadakSaramitaiH zlokaiH sarva pramANamiti // No, 1116 Size - 10++ in. by 44 in. -- Description. iti vIragaNiviracitAyAM ziSyahitA nAma piMDaniryuktivRttiH Extent.-- ( text ) 1o2 folios ; 5 lines to a page ; 27 letters to a line. (com.) ; 10 92 ;35 33 Country paper rough and grey; Devanagari characters with pRSThamAtrAs; this is a paJcapATI Ms., containing the text and its commentary; the former written in a slightly bigger hand ; clear and good hand-writing; borders ruled in three lines and edges in two, in red ink; foll. numbered in the right-hand margin only; fol. ra blank ; yellow pigment used; both the text and the commentary complete; condition very good. " " "" 487 " " Pindaniryukti with vivecana 389. 1879-80. 99 99 22 Age.-- Pretty old. Author of the commentary.- Manikyasekhara Suri, pupil of Meru tunga Suri of the Ancala gaccha. For a list of his works see p. 457. Subject. The text in Prakrit together with its explanation in Sanskrit, based upon a commentary by Malayagiri Suri,

Page #525
488 Jaina Literature and Philosophy [1116, Begins.- text ( fol. I') piMDe uggama upAyaNesaNA etc. as in No. III3. - com. (fol. I') zrIAcArAMge dvitIyazrutaskaMdhe AyaM dazavaikAlike paMcamaM piMDaiSaNAdhyayanaM / asya niyuktirmahArthatvAt zrIbhadrabAhuNA pRthakkatA' sA piMDaniyuktiriti prasiddhA'syA arthamAtraM kathAmAtraM [ kathAmAtraM ] ca likhyate / yA piMDaiSaNAniyuktirdazavaikAlikapaMcamAdhyayanasyAsti sA stokArthA eSA tu vistRtArthA / piMDaiSaNAyA niyuktiH piMDaniyuktiriti madhyapadalopisamAsaH / maMgalaM tu "vaMditu samvasiddhe" ityAdinA AcAraniyuktau zastrAstraparijJAdhyayane eva zrIbhadrabAhuNoktaM vighnazAMtyai / athAtrAdhikAra saMgrahagAthAmAha // piMhe u * piMDasaMghAte / piMDanaM piMDaH etc. Ends.-- (text) fol. 102a eso AhAravihI etc. up to juttassa // 36 // as in No. III3. -(com.) fol. 102 eso A0 eSa AhAravidhiH piMDavidhi(H) yathA e(te)na prakAreNa bhaNitastIrSa(rtha)karAdibhistathA kAlAnurUpasvamativibhavena mayA vyaakhyaataa| eSA piMDaniyuktiyuktirasyA vinirmitaa| dvAdazAMgavide tasmai namaH zrIbhadrabAhave // 1 // viSamA piMDaniyuktirvivRtA yena suurinnaa| tasmai zrImalayagirigurave praNamAmyahaM // 2 // zikSayA tasya saMkSipya viSamArthavivecanaM cakre zrIpiMDaniyukto(kteH) sUrirmANikyazeSaraH // 3 // zrI aMcala gacchanAthAH / zrImerutuMgasUrayaH / ziSyasteSAmimAM tene saMzayadhvAMtadIpikAM // 4 // iti zrIpiMDaniyuktidIpikA // cha / saMpUrNa // zubhaM bhavatu // cha / cha / / 1 Cl. "Aha-niryukyo na svatantrazAstrarUpAH kintu tattatsatraparatantrAH, tathA navyutpanyAzrayaNAt , nathAhi--sUtropAttA arthAH svarUpaNa sambaddhA api ziSyAn prati niyujyante-nizcita sambaddhA upadizya vyAkhyAyante yakAbhistA niyuktayaH bhavatA'pi ca pratyajJAyi, 'piNDaniyuktimahaM vivRNomi', tadeSA piNDaniyuktiH kasya sUtrasya pratibaddhati ? ucyate--iha dazAdhyayanaparimANaalikAyugalabhUSito dazavaikAliko nAma zrutaskandhaH, tatra ca paJcamamadhyayanaM piNDaiSaNAnAmakaM, dazavakAlikasya ca niyuktizcaturdazapUrvavidA bhadrabAhutvAminA kRtA, tatra piNDaiSaNAbhidhapazcamAdhyayananiyuktiratiprabhUtagranthatvAtpRthakzAstrAntamiva vyavasthApitA tasyAzca piNDaniyuktiriti nAma kRtaM" -Malayagiri Suri's commentary (p. 1) on Pindaniryukti.

Page #526
1117.1 IV. 4 Malasairas 489 piNDaniyuktayavacUri Pindaniryuktyavacuri - 169. No. 1117 1873-74. Size.-- 114 in. by 5g in. Extent.-- 85 folios ; 15 lines to a page ; 42 letters to a line. Description.-Country paper tough and white: Devanagari charac ters; big, clear and good hand-writing ; borders ruled in three lines in red ink; yellow pigment profusely used ; foll. mostly numbered in the right-hand margin; fol. 11 blank ; condition very good ; complete ; this Ms. contains the garages of the text. Age.- Sarivat 1931. Author.- Ksamaratna, pupil of Jayakirti Suri. Subject.-- A small commentary in Sanskrit based upon the bihad. vitti to Pindaniryukti. Begins.-fol. b zrIgaNezAya namaH / / __ zrIpiMDaniyuktiravacUrilikhyate pUrvamadhikArasUtraM gAthA piMDe gAhApiMDe AhAraviSaye udgama 1 utpAdanA 2 eSaNA 3 saMyojanA 4 pramANa 5 iMgAla6 dhUma 7 kAraNa 8 bhedAdaSTavidhA piMDaniyuktibha(bha)vati etc. Ends.-fol. 85* jA jagAhA yatamAnasya sUtroktavidhiparipAlanapUrNasya adhyAtma vizodhiyuktasya rAgadveSAbhyAM rahitatvAt yA bhavedvirAdhanA apavAdapratyayA sA - bhavati nirjarAphalA 70 // ___ zrIbRhadvattimAlokya gaMbhIrArthA(oM ) vinizcitaM mayA zrIpiMDaniyuktiH prakaTA vinirmame 1 iti zrIpiMDaniyuktiravacUritA ? iti zrI vidhipakSa gacchagaganaravimaMDalazrIgacchezvarazrIjayakIrtimariziSyakSamAratnena svaparAvabodhAya zrIpiMDaniyukteravi(ba)cariralekhi // 1 // yatkiMcinmayA daurbalyAdasaMgatamihAgataM tacchodhane vidhAtavyA rupA sadbhiH subudvibhiH // cha / yAvadiMduravI vizve pramodaM kuruto bhRzaM / tAvannaMdatu sAdhUnAM hitaiSA(s)vyarthasaMtatiH // 2 // 1 In a different hand we have: pra.3001. 6. J.L.P.]

Page #527
49.0 Jaina Literature and Philosophy (1117. zrIrastu etc. saMvat 1931 varSe mAsottamamAse prathama AvAhanAse kRSNapakSe aSTamyAM ravivAre likhitamidaM vyAsa gopIdAsAtmajena malAkhyena nAmnA // zrI // etc. piNDaniryuktiviSamapadaparyAya No. 1118 Pindaniryuktivisamapadaparyaya 736 (21). 1875-76. Extent. fol. 25b to fol. 264. Description. Complete. For other details see Pancavastukaparyaya No. 736 (1). 1875-76. Author.-- Not known. Subject.-- Difficult words etc. occurring in Pindaniryukti explained in Sanskrit. piNDaniryuktiviSamaparyAya etc. Begins. fol. 250 parisaMThiyamiti svacchaM / pAINa iti prAcInaH / sarahu phala. iti abaddhAsthi / amilA iti gaDarikA / Ends. fol. 264 atha bullIti avalhakaH / aicchA ci (tthAvi ) u iti nAsti bhedicchAH / piMDaniryuktiviSamapadaparyAyAH / Pindaniryuktivisamapada paryaya 789 (21). 1895-1902. No. 1.1.19 Extent.-- fol. 4rs to fol. 41. Description.-- Complete. For other details see Pancavastukapar yaya No. 789 (1). 1895-1902. Begins. fol. 414 parisaMThiyamiti etc. as in No. 1118. Ends.-- fol. 41b atha vulhIti avalhakaH etc. N, B. For further particulars see No. 1118.

Page #528
491 in21.] IV. 4. Malasatras . piNDaniyuktiviSama Pindaniryuktivisama padaparyAya padaparyaya 332(4). No. 1120 A.1882-83. Extent.- fol. 23deg to fol. 23deg. Description.-- Complete. For other details see Nandisutravisama padaparyaya No. 623. Begins.- fol. 23 parisaMThiyamiti etc. as in No. III8. Ends.- fol. 23deg avabhullIti avakaH etc. N. B.-- For additional information see No. 1118. piNDaniyuktiviSamagAthA Pindaniryuktivigamagathi. vivaraNa vivarana 736 (22). No. 1121 . 1875-76. Extent.-- fol. 26 to fol. 28. Description.- Complete. For other details see Pancavastukapar __yaya No. -736 (1). 1875-76.. Author.- Not known. Subject.-- Explanation in Sanskrit of difficult gathas pertaining to Pindaniryukti. Begins.- fol. 26deg dasasasihAgA gAhA / iha sAdharmikArci(ciM)tAyAM pravacanaliMga___ darzanajJAnacAritrAmigrahabhAvanAkSaNeSu saptapadeSvekarSizatiIikasaMyogA bhavaMti etc. Ends.-- fol. 284 yAnugrahatrayamadhye sA cirasthApitA kevalamasau na parihAryA(:) crittvaajghnyvyaahRtvdityrthH| piMDaniyuktiviSamagAthAvivaraNaM samAptam / This is followed by the verse as under :

Page #529
192 jaina Literature and Philosophy [1122. yAvatyailokyazAlaH kamalapativapulajAlapratiSThA - naageNdrskNdhbNdhstridshptindiipllvvNdrgucch:| AzAzAkhApazAkhaH zivasadanazilAsaphalo dhiSNyapuSpo tAtyAmevaya(?)tAvahAlitakale(li)mala pustakaH paThayamAnaH / / piNDaniyuktiviSamagAthA Pindaniryuktivisamagatba vivaraNa vivarana 789 (22). Mo. 1122 1895-1902. Extent. - fol. 41 to fol. 456. Description.-- Complete. For other details see Pancavastukapar 789(1). ___ yaya No. 1885-1902.. Begins.-- fol. 41deg dasasasihAgA gAhA | etc. as in No. 1121. Ends.-- fol. 45' yAtugRhatrayamadhye etc. up to pustakaH paThyamAnaH as in ___ No. 1121. N. B.- For further particulars see No. 1121. piNDaniyuktiviSamagAthA PindaniryuktivisamagathavivaraNa vivarana No. 1123 ___332(5). A. 1882-83. Extent.- fol. 230 to fol. 29". Description.-- Complete. For other details see Nandisutravisama . . padaparyaya No. 623. Begins.-- fol. 23deg dasasasihAgA gAhA // etc. as in No. 1121. Ends.-- fol. 29- yAnugRhatrayamadhye etc. N. B.- For additional information see No. 1121.....

Page #530
IV. 4 Malasatras 498 1124.1 odhaniyukti (ohanijjutti) Oghaniryukti (Ohanijjutti ) - 94. No. 1124 1872-73. Size-101 in. by 44 in. Extent.- 20 folios ; 17 lines to a page ; 70 letters to a line. Description.- Country paper thin and grey ; Devanagari charac ters with occasional pRSThamAtrAs; bold, clear, small and good hand-writing; borders ruled in two lines in black ink3B red chalk and yellow pigment used ; complete ; most of the foll. more or less worm-eaten ; condition rather unsatisfactory. Age,- Fairly old. Author.- Bhadrabahusvamin. For details see Nos. 709, 1002 and 1113. Subject. This agama deals with rules and regulations prescribed for a Jaina saint and is an extract taken out of the 20th prabhrta of Samacari, the 3rd vastu of the ninth purva. This work mainly deals with the following topics :(1) pratilekhanadvAra, (2) piNDadvAra, (3) upadhinirUpaNa, (4) anAyatanavarjana, (5) pratiSeSaNAdvAra, (6) AlocanAdvAra and (7) vizuddhidhAra. ___For additional particulars see "nanyAdigAthApakArAdiyuto viSayAnukramaH" (pp. 149-155) published in the Agamodaya Samiti Series as No.55 in A. D. 1928. Begins.-fol. ! OM namaH zrIsarvajJAya arihaMte vaMdittA caudasapunbI taheva dspubbii| ikkArasaMgamuttatyadhArae savasAhU ai(y)|| 1 etc. Ends.-- fol. 20deg esA aNuggahaTTA phuDaviaDavisuddhavaMjaNAinnA ikkArasahiM saehiM saTTIahiehi saMgahiyA // 1164

Page #531
jaina Literature and Philosophy (1134. - zrIodhaniyuktisUtraM // navamapratyAkhyAnapUrvAta(va tihattIyasAmAcArIvastugataviMzatitamaprAbhRtAnnirmUlaM zrIbhadrabAhusvAminIta FAIR ll getc. ___ maMgalamastu likhitaM lIMbAkena // Reference.- Published along with the commentary of Dronacarya in the Agamodaya Samiti Series in A. D. 1919. For quotations etc. see Weber II, p. 622 and p. 816. For additional Mss. see G. O. Series vol. XXI, p. Is and Limbdi Caralogue Nos. 402 and 404. For a portion of this wrok (gathas 1160 to 1164, 1160 beginning abruptly ) see p. 1o8, 9. oghaniyukti Oghaniryukti : No. 1125 1880-81. Size.-12 in. by if in. Extent.-- 110 leaves ; 4 to s lines to a leaf ; so letters to a line. Description.-- Palm-leaf thick, durable and grey; Jaina Devanagari characters with frequent EHETS; big, quite legible, uniform and very good hand-writing; this Ms. presents an appearance of the work having been written into two separate columns; but really it is not so; for, the lines of the first column are continued to the second ; borders of each of the columns ruled in three lines in black ink ; red chalk used; the central portion of the unnumbered sides and this portion as well as the middle portion of each of the margins of the numbered sides decorated with a red spot; there is a hole between the two columns in each leaf; leaves numbered in both the margins : in the righthand margin with ordinary numerical figures beginning with s7 and the left-hand margin with letter-numerals such as } } } } } 3,2), 8), 6), o), $), mi), rf}, } } }

Page #532
1125.] IV. 4 Malasatras for 61 to 99 etc., leaf ra blank; so is the leaf 1666; a string passes through the holes ; leaves are placed between two wooden boards ; left-hand corners of several leaves gone; on leaf 59 even some letters are gone; cendi tion on the whole good; the Ms is well-preserved as it is placed in a card-board box lined with oil cloth; complete3B 1162 gathas in all. Age.- Fairly old. Begins.--leaf 57 '6 // OM namaH sarvatride // duvihovakkamakAlo sAmAyArI ahAugaM ceva / sAmAyArI tivihA moha(he) dasahA payavibhAgo // 11 NavamayapazcakkhANAbhihANaM puvvassa tiyvtthuuo| vIsaimapAhuDAo tato ihAnINiyA jaiyA // 2 so u okkamakAlo tayatthaNivigyasizka(:kakhaNaM sthaM ca / AyakayaM ciya puNo maMgalamAraMbhaye taM ca / / 3 arahate vaMdittA etc. as in No. II24. Ends. --leaf 166* esA ma(?oNuggahatthA etc. up to saMgahiyA // as in No. 1124. This is followed by the lines as under: cha // // cha / gAthA 1162 // cha / cha / 6.. ||ch||* // cha // || ... .. N. B.--For additional information see No. 1124. Reference, This Ms. having some special symbols for decoration given on the last leaf has been described by F. Kielhorn in his Report for 1880-81 on p. 9. But the title is given there as "Ohasamayari (METAI )" 1 This is not the symbol in the Ms. It differs from this to some extent. : 2 This verse is quoted by Drona suri in his commentary (p. 10 ) on Oghapiryukti.

Page #533
496 traff Jaina Literature and Philosophy Ends. fol. 26b No. 1126 Size. 123 in. by 4 in. Extent. 26 folios; 16 lines to a page; 52 letters to a line. Description. Country paper somewhat thick, rough and grey; Devanagari characters with Is; bold, big, legible and good hand-writing; borders ruled in two pairs of lines; the space between these pairs coloured red; fol. 1a blank; unnumbered sides decorated with a disc in the centre; the numbered, with two more, one in each of the two margins; red chalk used; complete; condition very good; the last gatha numbered as 1154. Age.-- Pretty old. Begins.--fol. P etc. as in No. 1124. [1126. Oghaniryukti 17. 1877-78. N. B. For further particulars see No. 1124. esA aNuggahatthA etc. up to saMgahiyA // 1154 as in No. 1124. This is followed by the line as under :-- cha || ohanijjutIsa (mma) ttA // cha // zrIH etc. Oghaniryukti 1212. 1886-92. oghaniyukti No. 1127 Size.-9 in. by 4 in. Extent.-- 47 folios; 13 lines to a page; 36 letters to a line. Description. Country paper thick and whitish; Devanagari characters with gas; bold, big, uniform, legible and good" hand-writing; borders ruled in two pairs of lines in black

Page #534
1128. ] IV. 4 Malasuti as 497 ink; the space between these pairs coloured red; numbered sides decorated with three small discs, one in the centre and one, one in each of the two margins; complete ; yellow pigment used; condition very good; the last gatha numbered as 1164. Age.--Samvat 1720. Begins.- fol. 1b aftin dien etc. as in No. II24. Ends. - fol. 47 TAI UTEPUT etc. up to tight 1 33984 as in No. 1124. This is followed by the following lines :iti zrIu(o)niyuktiH // samApta saMpUrNamidaMH / / gai gon etc. Then run the lines as under:-- saMvat 1720 varSe jyeSTa(Ta)mAse zuklapakSe pUrNimAtithau ravivAsare mit Faja'atto (fosfrea: il v HTT" FUTUTATT 1 soft II #T! TeamTE TTTTTTTT[:]" N. B.- For other details see No. 1124. oghaniyukti Oghaniryukti 652. 1892-95. No. 1128 Size.-- 11 in. by 48 in. Extent.-- 32 folios ; 14 lines to a page ; 78 letters to a line. Description.-- Country paper thin, rough and greyish in colour ; Deranagari characters; bold, clear and fair hand-writing; borders ruled in four lines in black ink; the edges of the first fol. ruled in two lines ; foll. 14 and 32b blank; yellow pigment used; complete ; condition very good ; the last gatba numbered as 64 i. e. 1164. 63 [J. L. P.]

Page #535
498 Jaina Literature and Philosophy in28. Age.-- Samvat 1671. Begins.--fol. I OM hI(hI) namaH // zrIjinAya namaH // arihaMte vaMdittA etc. as in No. 1124. Ends.-fol. 32a esA aNuggahatthA etc. up to saMgahiyA // 64 64) as in No. 1124. This is followed by the lines as under: iti zrIohAnijjuttI sNmttaa| zubhaM bhavatu cha saMvat 1671varakheM (1) kArtikamadi ujavAlI 5 tithau zrIvIra)vAre zrI'malacarkamahAnagare zrI vRhatkharataragacche zrIyugapradhAnazrIjinacaMdrasUri tatpaTTe zrIyugapradhAnazrIzrIzrIjinasiMhasUrivijai(yi )rAjye "rIhaDa 'vaMzaziromANazrIyugapradhAnazrIjinacaMdramarizAkhAyAM tatsi(cchi)dhyaprazastaguNaviziSTazreSTaSTi)pa(paM)DitAtmatilakakamalamunInAM tatsi(cchi)khya(Sya)mukSa(khya)pravaravAcanAcAryazrIpadmahemagaNiguNagariSTA(TA)nAm - tasi(cchi)kSya(pya)paM. nemasuMdaragaNinA lilekhya(khi) svavAcanArthe // 1 kalyANaM bhavatu. N. B.- For additional particulars see No. 1124. ___. 95. odhaniyukti Oghaniryukti TIkAsahita with tika No. 1129 1872-73. Size.--124 in. by 44 in. Extent.-- 155 folios ; 15 lines to a page ; 60 letters to a line. Description.-- Country paper thin and grey; Devanagari charac ters with pRSThamAtrA; big, clear, uniform and good handwriting ; borders ruled in two pairs of lines in black ink ; the space between these pairs coloured red rather inut differently ; unnumbered sides decorated with a small disc in the centre; the numbered with two more, one in each of two margins%3; red chalk used; the yellow pigment, too, in some cases; the numbering of the foll. originally wrong, but corrected later on, e. g. in the case of foll. 112, 113

Page #536
1129.] IV. 4 Malasatras 499 etc.; small strips of paper pasted to fol. 1*; the edges of the 1s5th (last ) fol. worn out; a piece of paper pasted to the fol. 15503; condition on the whole very fair; this Ms. contains the text and the commentary as well; both com plete; extent 7385:Slokas. Age.- Pretty old. Author of the commentary.-- Drona Suri of Nivrtti kula. He had assisted Abhayadeva Suri, the navangiyrttikara. He had a pupil Suracarya whose life is narrated in Prabhavaka caritra ( pp. 245-261 ). Subject. -- The Prakrit text along with the commentary in Sanskrit. Begins.- (text) fol. 20 arahaMte vaMdittA etc. as in No. 1124. (com. ) fol. 1 namaH sarvajJAya // namo arahatANaM / namo siddhANaM / Namo AyariyANaM / Namo uvjjhaayaannN| Namo loe savvasAhUNaM / eso paMcanamukkAro savvapAvappaNAsaNo maMgalANaM ca samvesiM paDhamaM havaha maMgalaM // 1 etc. ahaM(ha)dbhayastribhuvanarAjapUjitebhyaH siddhebhyaH / muma)taghanakarmabaMdhanebhyaH / AcAryazrutadharasarvasaMyatebhyaH siddhayartha satatamahaM namaskaromi // 1 etc. Ends.--(text) fol. 1558 esA aNuggahatthA etc. ikkArasahi sarahiM eguNavannehi sammattA ||ch|| ,, -- (com.) fol. IS5* sugamA oghaniryaktiTIkA samAptAH / kRtiriyaM droNA cAyaMsyati // cha / zubha bhavatu: kalyANamastu: ||ch / graMthA 7385 // cha / . zrI zrI zrI // cha / cha / cha / cha / 'naMdurabAra'nivAsI bhImaH saMghAdhipo(s)bhavad bhavikaH / zrIjinadharmadhArastattanayo dduNgrskRtii||1 savaMzakavilAsI 'prAgvATaH' prakaTajinamatAbhyAsI zrIguNarAjo guNavAna pada (?)di(? ti)vAdikArayitA // 2

Page #537
500 Jaina Literature and Philosophy [ 1129. zrI zatrujaya'-'raivata'-'jIrApallya'-(s) buMdAdiyAtrAyu(?su ) . vittavyayasaphalIkRtajanmA taiMcapalaSamAi (?) // 3 tanayastayo(:) suvinayaH kAlUnAmA kRtAnukRtasukRtI / tajAyA jasamAI lalanAdevI ca vIrAI // 4 zrIjinabhavanajinArcAyu(?)srakasaMghAdike sadA kSetre / vittavyayasya kartA dAnArthijanAnasamuddhartA // 5 yugma(ma) zrImatkAlUnAmnA nijakarakamalArjitena vittena / cikoze siddhAMtAH sasUtrakA vRttisNyuktaaH||6 zrImadvAcakanAyakamahIsamudrAbhidhAnamukhakamalAt / labdhA(bdhvA) varopadezaM naMdatu ca lekhitAsa vi(?) mahopAdhyAyazrI mhiismudrgaannishissypNknkjygaannlikhaapitaaH|| Reference.-- Both the text and the commentary are published. See No. 1124. For additional Mss. see Limbdi Catalogue No. 404 and G. O. Series vol. XXI (pp. 15 and 16). There is a palm-leaf Ms. of the commentary written in Samvat 1289. See G. O. Series vol. XXI, p. 41. oghaniyukti Oghaniryukti TIkAsahita with tika 1175. No. 1130 1884-87. Size.- 11 in. by 41 in. Extent.-- 121 folios ; 15 lines to a page ; 68 letters to a line. Description.- Country paper thin, rough and greyish ; Devanagari characters with pRSThamAtrAs; small, quite legible and good hand-writing ; borders ruled in three lines in red ink; foll. numbered in the right-hand margin only ; foll. ja and 121deg blank ; yellow pigment used ; edges of the first fol. slightly worn out; some of the foll. worm-eaten ; condition on the whole very fair; this Ms. contains the text and the commentary as well ; both complete. Age.- Pretty old. Begins-- (text) fol. r" arihaMte baMdittA etc. as in No. 1124.

Page #538
1131.] IV. 4. Mulasatras SOI Begins ( com.) fol. 16 FAD IHATTAIT ! FAT STga tuj etc. up to TTA TTC ATE II 11 11 NEFTiayaatin etc. Ends.-- (text) fol. 121* esA aNuggahatthA etc. up to sammattA as in No. 1124. , --( com.) fol. 121deg UTAI[:] Stafafell FATA:(F1) 117|| starta rotatiofa ll 3 112 11 N. B. - For further particulars see No. 1124. For an addi tional Ms. see Limbdi Catalogue No. 404. oghaniyukti TIkAsahita Oghaniryukti with tika 1213. No. 1131 1886-92. Size.-- 104 in. by 48 in. Extent.-- 162 folios ; 14 lines to a page ; 52 letters to a line. Description.- Country paper thin and greyish ; Devanagari cha racters with qaras; bold, big, clear and good handwriting; borders ruled in two lines in black ink ; the first two and the last few foll. slightly worn out at the corner; condition very fair ; foll. numbered twice : once as 833, 838 etc. and once as %, P etc.; so this Ms. seems to be a part of some other Ms. ; the first fol. is numbered as 433 only ; yellow pigment used; red chalk, too; both the text and the commentary complete ; extent 8385 slokas. Age.-- Samvat 1436. Begins.-- ( text ) fol. 2a BATEN Jigar etc. as in No. 1124. >> -- (com.) fol. 1b namo sarvajJANAM FAT s ari etc. as in No. 1130. HEFURETAT etc

Page #539
502 Jaina Literature and Philosophy [13. Ends.-- (text ) fol. 162b. __esA aNuggahatthA etc. as in No. 1124. ,, - (com.) fol. 162' sugamA / oghaniyuktiTIkA samAptA // cha / / kRtiriya droNAcAryasyeti // cha / zreSTI(TI) prAgvATa'vaMze(s)sti somaH soma iva priyaH / dRDhasamyakatvasadbrahmaguNagrahaNasAgrahaH // 1 // nijanyAyArjitaM vittaM matvA sArataraM hRdi / saphalIkartamudayuktaH saptakSetrInivezanAta // 2 tathA ca zrAvikAcArapraSaNA vidurAzayA // karamIti nAmnA dharmakarmaThA()sId vivekinI // 3 // gurUNAM zrIjayAnaMdasarINAM guNazAlinAM dharmopadezamAkarNya sAdarau tau jinAgamau // 4 // ubhAbhyAM lekhitaM zrImadoghaniyukti pustakaM / caturdazazate patriMzadvarSe zubhaM bhuvi // 5 // cha // zubhaM bhavatu // zrIsaMghasya // cha etc. graMthAnaM 8385||ch / sasUtra // cha ||ch||ch / Then in a different hand we have : 3 ... . N. B.-- For additional particulars see No. 1129. oghaniyakti . . Oghaniryukti TIkAsahita with tika 417. No.1132 1882-83. Size.- in. by 4} in. Extent. - 134 - 18 = 116 folios; 17 lines to a page ; 48 letters to a line. Description.-Country paper thin, rough and white; Devanagari characters with pRSThamAtrA; clear, big and good hand-writing%3B ink faded at times ; borders ruled in four lines in black ink; red chalk used ; most of the foll. have their edges more or less worn out; so even the written portion gone

Page #540
-1133.] IV. 4 Matasatras - 503 in some cases e. g. the beginning of the 19th fol. ; numbers of some of the foll. worn out ; so it is difficult to ascertain whether the matter is continuous or not; condition poor; fol. I to 18 seem to be missing%3 otherwise both the text and the commentary appear to be complete ; total extent 8635 slokas. Age.-- Fairly old. Begins.- (text) (abruptly) tol. 19deg tattha pAhANajalaM aJca(ka)tamaNakyAMte cana etc. , - (abruptly) (com.) fol. 19* vbavanujalapoSaNagAhA / 'pASANajalaM madhuAsakthatthu)jalavAlukAku(ja)laM kardamajalaM ceti te tatra pASANajalaM yatpASANAnAmupari vahati etc. __ atha saMghaTTAdijalAla)kSaNapraNinISayA bhAjyadAha / cha / jaMghe(gha)TTA (ddhA)gAhA jaMghArdhamAtrapramANa(Na) jalaM etc. Ends.-- ( text ) fol. 1346 esA aguggaha etc. up to saMgahiyA || as in No. 1124. This verse is cumbered as 1148. , - (com.) fol. 134deg sugamA / odhaniyuktiTIkA sUtrasahitA samAptA / TIkAyAM akSaragaNanayA graMthAnaM 6025 tadA stragAthApramANena graMthAyaM 1460 ubhayagraMthAnaM 8385 // zubhaM bhavatu // cha / N. B.- For additional particulars see No. 1129. oghaniyuktiTIkA Oghaniryuktitika No. 1133 . . . .. .. ...._ll14. 1887-91. Size.-- 104 in. by 4s in. Extent.-- 144 folios ; 15 lines to a page ; 46 letters to a line. Description.- Country paper thin and grey; Devanagari chara ___cters with pRSThamAtrA; bold, clear, big, uniform and good I This occurs on page 324 of the printed edition ( Agamodaya Samiti Series)

Page #541
504 Jaina Literature and Philosophy [1133. hand-writing; borders neatly ruled in three lines in red ink; numbers for foll. entered twice on one and the same side but in different margins; foll 1 and 144b blank ; this Ms. contains the ares of the text; yellow pigment used; complete ; condition very good. Age. -- Samvat 1662. Author.-- Dronacarya. For details see p. 499. Subject. - A Sanskrit commentary to Oghaniryukti. zrIsarvvajJAya namaH Begins. fol. rb namo arihaMtANaM etc. as in No. 1129. Ends. fol. 1344 sugamA // evaM gAhA // cha || iti oghaniryuktikA samAptA graMthAgraM saMkhyA 6545 vRttisaMkhyA rei pustakaM dRSTaM etc. 1 tailAdrakSet etc. 2 adra (ha) STidoSAnma)mativibhrameNa / yadArthahInaM likhitaM mayebhyaH / te (tanmArjanayitvA parazodhanIyaM / kopaM na kuryAt khalu leSakasya // 1 // bhagnapRSTi (SThi) kaTigrIvA / baddhamuSTiradhomukhaM / - kaSTena likhitaM zAstraM / yatnena paripAlayet // 2 // saMvat 1662 varSe dvitIyacaitra vadi 14 zukre 'Idala 'puravAstavya paM0 zavasI likhitaM // cha // cha // Reference. -- Published. See No. 1124. In "A Descriptive Catalogue of Manuscripts in the Jaina Bhandars at Pattan" ( vol. I, pp. 215 and 323 ) published in the Gaekwad's Oriental Series as vol. LXXVI, two palm-leaf Mss. of the commentary are noted. Out of them, at least one noted on p. 215 is certainly composed by Drona Suri. 1 This will be hereafter referred to as "The Pattan Catalogue vol. I".

Page #542
1134. ] eitaagi avacUrNisahita No. 1134 dr - (com.) a line. IV. 4 Malasatras Size. 10 in. by 48 in. Extent. (text) 43 folios; 12 to 15 lines to a page; 40 letters to a line. rd ; 28 "" 33 33 Ends. (text) fal, 43b "" Oghaniryukti with avacurni ---( com. ) fol. ra nama ( : ) zrI pravacanAya // 147. .1881-82. 505 ; 49 Description.- Country paper thin, rough and white; Devanagari characters with pRSThamAtrA ; this is a qaret Ms.; the text written in a much bigger hand than that for the commentary; quite legible and good hand-writing; borders ruled in three lines in red ink; red chalk used; foll. numbered in the right-hand margin only; edges of the first and last few foll. slightly worn out; condition on the whole good; both the text and the commentary complete; this Ms. is lacking in the two verses of the colophon to be found in No. 1135. rw Age. Samvat 1527. Author of the commentary- Jnanasagara. For his another work see No. 688. Subject. The text along with a small commentary in Sanskrit. Begins. (text) fol. ra e namo (maH ) sarvajJAya // a afar etc. as in No. 1124. prAMto(s) yamAva kAnuyoga etc. as in No. 1135. 99 esA aNuggahatthA up to saMgahiyA 64 (1964) as in No. 1124. This is followed by the lines as under: iti zrI oghatiyuktimahA siddhAMtamUtraM // iti zrI oghaniyuktimahA siddhAMtasUtra samAptaH / / saMvat 1527 varSe phAyajabidi 7 huye hitaM / 54 [J. L. P.)

Page #543
Jaina Literature and Philosophy 506 (1134. Ends. com.) fol. 436 Arro Il grey etc. practically up to FATHT as in No. 1135. Reference. For a Ms. containing the text and an anonymous ava. curi see Limbdi Catalogue, No. 403. For palm-leaf Mss, of the text see the Pattan Catalogue Vol. I (pp. 40, 95, 98, 107, 112, 119, 161, 175, 177, 309, 378, 385, 390, 406 and 409). oghaniyuktayavacUrNi Oghaniryuktyavacurni No. 1135 1116. 1887-91. Size.-- 104 in. by 43 in. Extent.--- 35 folios ; 24 lines to a page ; 64 letters to a line. Description.-- Country paper very thin and greyish ; Devanagari characters with ES ; very small, quite legible and good hand-writing ; borders ruled in three lines in red ink; foll. numbered in the right-hand margin only; the first 15 foll. more or less worm-eaten ; condition on the whole good; complete; composed in Samvat 1439; fol. 356 practically blank; for, the title is written on it; tales of the text given, Age.-- Samvat 1534. Author.- Jnanasagara Suri, pupil of Devasundara Suri. Subject.-A small commentary in Sanskrit to Oghaniryukti. Begins.-fol. ra Af: Lauiry: prakAMto(s)yamAvazyakAnuyogastatra sAmAyikAdhyayanamanuvarttate / tasya catvAryanu(yoga)dvArANi upakramau nikSepo'nugamo neyaH // etc. tadanena saMbaMdhena pUrva namaskAramAha // arihaMtetyAdi / vyAkhyA sA caM, saMhitAbhedena paDiyA wefat etc.

Page #544
136.] IV. 4 Malasatras 507 Ends.-fol. 35b ArA0 // utkRSTazabdo'trAtizayArthe draSTavyoH na tu bhAvAnaMgI kRtya // 1162 esoha0 // spaSTA0 // 63 e aMsA0 // spaSTA0 // 64 esA a0|| spaSTA0 // 1165 // iti zrIdroNAcAryanirmitavRttyanusAreNa edaMyugInasuvihitaziro'laMkaraNakoTIrakaraNibhaTTArakaprabhuzrIjJAnasuMdarasIrapAdaviracitA zrIoghaniryuktyavacUArNa samAptA // cha // zrI // zrImattapA gaNanabhoMgaNabhAskarAbhAH zrIdevasuMdarayugottamapAdukAnAM / ziSyairjinAgamasudhAMbudhilA(lI)nacittaiH zrIjJAnasAgaragurUttamanAmadheyaiH // 1 nidhivaminu1439miti(Date)bde'vacUrNirekhA(SA) kRtaudhaniyukta svaparopakRtikRte tadvivRterupari sphuTA jayatAt // 2 // prazasti // cha / cha / saM0 1534varSe zrAvaNasudi 12 bhaume // zrI'rANapura nagare devAkena likhitamasti cha / / zubhaM bhavatu // This is followed in a very big hand by the lines as under: oghaniryuktyavacUriH kartA jJAnasAgaramUriH / Reference-See No. 1134. oghaniryuktatyavacUrNi Oghaniryuktyavacurni No. 1136 1115. 1887-91. Size.-- 104 in. by 4} in. Extent.--37 folios ; 21 lines to a page; 68 letters to a line. Description.- Country paper rough and white; Devanagari char racters with occasional HATETS; very small, quite legible and good hand-writing ; borders ruled in three lines in red ink; red chalk used; foll. numbered in the right-hand margin only; a wet presented as SS SS SS SS S etc., on the 4th fol. perhaps referring to the pASANa; another bhaGgI on fol. 18deg; complete; edges of some of the foll. slightly damaged ; condition on the whole very good ; complete. Age.-- Fairly old.

Page #545
508 Jaina Literature and Philosophy [1136. Begins.-fol. I namaH zrIsarvajJAya prakAMto(s)yamAvazyakAnuyogastatra etc. Ends.-fol. 37 ArA0 // utkRSTa etc. practicaily up to jayatAt / / 2 // as in No. 1135. This is followed by the line as under: ityopaniyuktayavacUrNiprazastiriyaM // cha / / zrIH // etc. N. B. - For further particulars see No 1135. 18. oghaniyuktaravArNa Oghaniryuktyavacurni No. 1137 1877-78. Size.- 104 in. by 45 in. Extent.-43 folios; 19 lines to a page; 68 letters to a line.' Description.-Country paper thin, rough and white; Devanagari characters with as; small, quite legible and elegant hand-writing ; borders ruled in four lines in black ink ; red chalk used; this Ms. contains the gates of the original text; foll. numbered in the right-hand margin only ; fol. 43b blank; complete ; extent 3400 slokas; almost every fol. awfully worm-eaten ; condition poor. Age.--Fairly old. Begins.-fol. !' namaH shrutdhrebhyH|| prakAMto'yamAvazyakAnA(nu)yogastatra etc. Ends.- tol. 43* aaraa0|| utkRSTazabdo(s)jAtizayAtheM etc. up to prabhuzrI jJAnasAgarasAripAdaviracitA zrIoghaniyuktyavacUrNiH samAptA (tA) as in No. 1135. This is followed by jo 3800. N. B.--For additional information see No 1135.

Page #546
1139. ] oghaniryuktavacUri No. 1138 IV. 4 Malasutras Oghaniryuktyavacur 1214. 1886-92. Size.- 1o in. by 4g in. * Extent.-- 39 + 1 = 40 folios; 19 lines to a page ; 64 letters to a line. wd? Description. Country paper very thin and greyish; Devanagari characters with ears; very small, legible and good hand-writing; borders ruled in four lines in black ink ; red chalk and yellow pigment used; foll. numbered in the right-hand margin only ; fol. 28 repeated; fol. 39b blank ; some of the last foll. slightly worm-eaten; condition good; complete; this Ms. contains the gates of the text. Age.-- Pretty old. Author.-- Not mentioned. Subject. A small commentary in Sanskrit to Oghaniryukti. - oghaniryuktavacUri No. 1139 Begins. -- fol. 14 prakrAMto ( s)yamAvazyakAnuyogastatra sAmAyikAdhyayanamanuvartate / tasya catvAryanuyogadvArANi / etc. Ends.--fol. 398 ArA || utkRSThato'tizayane samyagArAdhAnaM kRtvA trIn bhAvAn gatvA nirvANamavazyaM prApnoti / utkRSTazabdo'trAtizayArthe draSTavyo na tu bhavamaMgIkRtya // 29 // esA / / 1130 eaM // 31 esA // / 1932 zrI oghaniryuktavacariH samAptA // cha // zrIH // etc. Oghaniryuktyavacuri 286. A. 1883-84. Size.- ro++ in. by 4g in. Extent.-- 24 folios ; 23 lines to a page ; 62 letters to a line.

Page #547
$10 Jaina Literature and|Philosophy (1139. Description.-- Country paper tough and white ; Devanagari cha racters with occasional pRSThamAtrAs; small, legible and tolerably good hand-writing ; borders ruled in four lines in black ink ; red chalk used ; a right-hand corner of almost every fol. partly worn out; condition very fair; this Ms. contains only the states of Oghaniryukti ; complete ; foll. must have been numbered, but the portions containing numbers have perished, that is way we do not find them now; this is the only paper Ms. dated so early as Samvat 1333 that I have handled up till now.' Age.--- Sainvat 1333. Author.- Not known. Subject.- A small commentary in Sanskrit elucidating Ogha niryukti. Begins.- fol. 1 ahe prakrAMto'yamAvazyakAnuyogaH // tatra sAmAyikAdhyayane catvAryanuyogadvArANi | etc. . AcAryo maMgalAdyartha gAthAdvayamAha / arihaMte azokAdyaSTamahApAtihAryAdi. rUpAM pUjAmahetItyarhataH etc. Ends.-fol. 24deg AdyasaMhananamAzritya trayastu chevATikAsaMhanane // 61 // e0e0 esA // 1164 zrIoghaniyuktayavacUri samAptA // cha / saMvat 1333 mArgazira zuddha 10 gurudine / pustakaM likhitaM padma.This Ms. ends thus. odhaniyuktiparyAya Oghaniryuktiparyaya 736 (20). No. 1140 1875-76. Extent.-fol. 25* to fol. 250. Description.--Complete. For other details see Paificavastukapar yaya No. 736(1). 1875-76. 1 For a discussion in this connection see my paper " The Jaina Manuscripts" (p. 106 ) published in " Journal of the University of Bombay " ( vol. VII, pt. 2, September 1938 ).

Page #548
1142.] IV. 4 Malasatras SII Author.- Not known. Subject.-- Difficult words etc. occurring in Oghaniryukti explained in Sanskrit. Begins.--fol. 25* prayojanamiti nagaradvArAdivat / anuyogAnAM tatkrame prayojanam / etc. Ends.-- fol. 250 mUlakati gAdAnArtha (zATanArtha) vA yadAnaM / bahudezakAla iti prastAvaH / siMheti behaH / oghniyuktipryaayaaH| oghaniyuktiparyAya Oghaniryuktiparyaya No. 1141 789 (20). 1895-1902. - Extent.--fol. 40" to fol. 41'. Description.-- Complete. For other details see Pancavastukapar _789 (1). yaya No. 1895-1902. Begins.--fol. 40 prayojanamiti etc. as in No. IH40. Ends.-- fol. 411 mUlakammati etc. N.B.-- For additional information see No. 1140. oghaniyuktiparyAya Oghaniryuktiparyaya 332 (3). No. 1142 A.1882-83. Extent.- fol. 220 to fol. 230. Description.-- Complete. For other details see Nandisutravisamar ___padaparyaya No. 623. Begins.-fol. 220 prayojanamiti etc. as in No. 1140. Ends.-fol. 24deg bhUlakamIta etc. N. B.--For further particulars see No. 1140,

Page #549
512 jaina Literature and Philosophy [ 1143 pAkSikasUtra Paksikasutra (haagaa) ( Pakkhiyasutta ) No. 1143 750 (a). 1892-95. Size.-10 in. by 48 in. Extent.-- 11 folios ; 13 lines to a page; 36 letters to a line. Description.- Country paper thick, rough and whitish ; Deva nagari characters; bold, big, clear and good hand-writing; borders ruled in three lines in red ink ; edges singly ; fol. ja blank ; red chalk used ; numbers for foll. entered twice: once as usual and once as q. 3,TR, etc.; edges and corners of the first fol. slightly damaged ; condition tolerably good; complete ; this Ms. contains are A EE. See No. 953. Age.- Samvat 1842. Author.-Not mentioned. Subject.- One of the sutras to be recited by Sadhus at the time of the fortnightly pratikramana. It deals with mahavratas and srutakirtana thus giving us a list of canonical treatises. Prof. Winternitz says on p. 471 of pt. II of A History of Indian Literature'as under : "The Pakkhi or the Paksika-Sutra is a liturgy in verse for the Pakkhi-Padikamanam ( Paksi-Pratikramana), i. e. the fourteen days' confession. The confession of the " five great vows" ( mahavrata ), with which the work begins, also includes the worship of the "patient ascetics" (khamasamana ), who are accounted the authors of the "sacred scriptures which stand outside the Angas" (angabahiram) and of the the twelve Angas, which gives rise to a solemn enumeration of the sacred writings (suttakittanam )." The following observation made by him in this very work (pt. II, pp. 429-430 ) may be here noted : "The third and fourth Mula-Suttas are also sometimes given as Ohanjjutti (Ogha-Niryukti ) and Pakkhi ( Paksika

Page #550
1143.]. 11. 4 Malasatras Sutra) and sometimes the Pimdanijjutti and Ohanijjutti appear in the list of the Cheya-Suttas." See Weber, Jnd. Stud. XVII, 85. Begins.-fol. 1 zrIjinakuzalamUrijI sadA sahAya chai / titthaMkare a titthe atitthasiddha ya titthasiddha ya / siddheya jiNe risI maharisI ya nANaM ca vaMdAmi // 1 // etc.' -fol. I0A // namo tesiM khamAsamaNAgaM jehiM imaM vAiyaM aMgabAhirayaM kAliyaM bhagavaMtaM taM jahA uttarajjhayaNAI dasAo kappo vavahAro isibhAsiyAI nissIhaM mahAnisIhaM jaMbUdIvapannatI sUrapannatI caMdapannatI dIvasAgarapannatI khuDiyAvimANapavibhattI mahalayAvimANapavibhattI aMgacUliyA vaMgacUliyA vivAhacUliyA aruNovavAe varuNovavAe garuNovavAe vesamaNovavAe velaMdharovavAra deviMdovavAe uhANasue samuhANasue nAgapariyAvaliyAo nirayAvaliyAo kappiyAo kappavaDaMsiyAo puphiyAo pupphacUliyAo vaNhIdasAo AsIvisabhAvaNAo diDIvisabhAvaNAo cAraNasamaNabhAvaNAo mahAsuviNabhAvaNAo teagginisaggANaM savvehiM pi eyaMmi aMgabAhirie kAlie bhagavaMte samutte saatthe sagaMsthe sanijattIe sasaMgahiNIe etc. Ends.-fol. II muyadevayAi bhagavaI nANAvaraNIyakammasaMghAyaM / tesiM khaveo sayayaM jesiM sayasAyare mattI 1 // .. .... . iti zrIpAkSikasUtraM / saM01842 rA zrAvaNasudi 9 dine / pAlI madhye / paM0 vivekakalyANena likhitaM / Reference.- Published along with Yasodeva Suri's commentary in the D. L. J. P. F. Series, as No. 4 in A. D. 1911. See Weber II, p. 819. For additional Mss. see B. B. R. A. S. vols. III-IV, p. 394, G. O. Series vol. XXI (p. 25 ) and Limbdi Catalogue Nos. 1544-1547. Nos. 1545, 1546 and 1547 recorded in this Catalogue contain Ksamanaka, Yasobhadra Suri's vitti and tabba respectively, over and above the text. For description of a Ms. having the bare text see Keith's Catalogue No. 7504. For palm-leaf Mss. of the text see the Pattan Catalogue vol. I (pp. 24, 33, 58, 64, 107, 143, 150, 158, 300, 406, 409 and 411). 6 [J.LP.]

Page #551
514 pAkSikasUtra No. 1144 Jaina Literature and Philosophy No. 735. Begins.-- fol. 5b Ends. fol. IIb Extent.--fol. 5b to fol. 11. Description. Complete. For other details see Namaskaramantra fifa etc. as in No. 1143. sudevayA bhagavaI etc. up to bhaktI | 1 // N. B. For further particulars see No. 1143. (1) (No. 886) (2) pAkSikakSAmaNasUtra (No. 960) (3) gurusthApanAsUtra (paMcidiya) ( 4 ) caraNa saptatikaraNasaptatigAthA pAkSikasUtra No. 1145 Size. 10 in. by 4 in. Extent. 8-17 folios ; 15 lines to a page; 42 letters to a line. Description.-- Country paper thick, tough and white; Devanagari characters; sufficiently big, broad, legible and good handwriting; borders ruled in three lines in red ink; red chalk used; foll. numbered in the right-hand margin. only; the 6th fol. lacking; otherwise complete; edges of the first fol. slightly damaged; condition on the whole very good; this Ms. contains in addition the following four works: Age.-- Samvat 1864. See No. as in No. 1143. 1202 (e). 1887-91. * [1144. Paksikasutra 1269 (41) 1887-91. dr fol. 8a dw dr Paksikasutra 1202 (a). 1887-91. 8a to fol. 8a 8b 8b

Page #552
145.1 1V. 4 Malasatras 515 Begins.-fol. . farajes a fazer etc. as in No. 1143. Ends.--fol. 8a muyadevayA bhagavaI etc. up to bhattI 1 as in No. 1143. This is followed by the line as under : iti zrIpAkSikasUtraM sammattaM cha. pAkSikasUtra Paksikasutra No 1146 613 (a). 1884-86. Size.- 11 in. by 4in. Extent.-53 folios; 15 to 16 lines to a page; so letters to a line. Description.- Country paper thick and tough ; Devanagari cha racters with pRSThamAtrAs; bold, big, legible and good handwriting ; borders ruled in four lines in black ink; red chalk used ; corners of some of the foll, worn out; condition tolerably.good; this work ends on fol. S.; this Ms. contairs over and above this, the following 12 works :(1) dazaliMkasUtra ( No. 705) foll. 5 to 21' (2) yati sAvitikramaNaba , 21, 220 (3) upadezamAlA ,, 22 , 360 (4) zIlopadezamAlA , 36, 39 (5) piNDavizuddhi ( No. 410) , 399, 420 (6) praznottararatnamAlikA (7) jIvavicAra " 43*, 44deg (8) navatattva , 44deg ,, 45. (9) catuHzaraNa ( No. 274) . , 45, 474 (10) gautamapRcchA , 47* ,, 480 (1) vivekamaJjarI ,, 48', (12) paryantArAdhanA ( No. 403) , 52, ,, 43* 26n ,

Page #553
$16 Jaina Literature and Philosophy (1146. Age.-- Old. Begins.--fol. . .. Fazejant or farzet 3 etc. as in No. 1143. . Ends.--fol. so. geant Hilari etc. up to wat as in No. 1143. This is followed by gra qrretto FATH:. N. B. - For additional information see No. 1143. pAkSikasUtra Paksikasutra No. 1147 . :::: : .... 1892-95. Size.--104 in. by 4.in..! Extent:-4 folios ; 15. lines to a page ; 46 letters to a line. Description:- Country paper tolerably thick and greyish ; Deva nagari characters ; bold, clear and good hand-writing; borders ruled in three lines in red ink ; yellow pigment used ;. unnumbered sides decorated with a small circular disc in the centre whereas the numbered, with two more, one in each of the two margins; edges of the first fol. slightly tors; a strip of paper pasted to fol. 1b; condition tolerably good ; complete so far as it goes; this Ms. contains on fola 4 an additional work viz. Paksikaksamanasutra which is already described as No. 956 (vide this very pt., pp. 318-319 ). Age. - Samvat 1.540(?) See No.956. ? Begins.----fol. s fritt faret etc, as in No, 1143,

Page #554
1149.] IV. 4 Malasatras 517 Ends.- fol. 4. duvAlasaMgaM gaNipiDagaM bhagavaMtaM saMmaM kAyeNa / phAsaMti pAlaMti pUrati tIraMti kiTThati saMmaM ANAe ArAhati / ahaM ca nArAhami / tassa micchA mi dukkddN| iti zrIpAkSikasUtraM samApta / __N. B.-For further particulars see No. 1143. ... ... ........... pAkSikasUtra Paksikasutra 1171 (b).. No. 1148 1887-91. Extent.- fol. 30deg to fol. 42b. Description.-- Complete. For other details see No. 708. . Begins.--fol. 300 .... titthaMkare Atitthe etc. as in No. 1143. Ends.-- fol. 42 saMmaM kAraNa etc. up to dukkaDaM as in No. 1147.. This is ___ followed by sayadevayAi etc. up to bhattI // 1 // as in No. 1143. ........Then we have:-- . ...... . .. ............. pakkhiyapaDikamaNasuttaM sammattaM // N. B.-- For further particulars see No. 1143 : pAkSikasUtra Paksikasutra No. 1149 ... 434 (b). ..1882-83. Extent.- fol. 14. Description.-- Incomplete as it ends abruptly. For further details ..... .. SPN o106. -. . ...... .

Page #555
318 Begins. fol. 145 T pAkSikasUtra vRttisahita Jaina Literature and Philosophy Ends.-- fol. 14 tattha khala (la) paDhame bhaMte mahatrae pANAivAyAo veramaNaM / savvaM bhaMte pANAivAyaM pazJcakkhAmi / sa (se) suhamaM vA bAyaraM vA / tasaM vA / thAvaraM / vAneva saNaM (paM) pANe ai. It ends thus abruptly. N. B.--For further particulars see No. 1143. No. 1150 titthaMkare ya titthe / atitthasiddhe ya titthAsiddhe ya siddhe jeNe risI maharisI nANaM ca vaMdAmi // 1 // Size.-137 in. by 2 [1149 in. Paksikasutra with vrtti 45. 1880-81. Extent. 189 12 177 leaves; 5 to 6 lines to a leaf; 45 letters to a line. Description.- Palm-leaf durable and greyish; Devanagari characters with gears; sufficiently big, legible, uniform and good hand-writing; this Ms. presents an appearance of the work having been divided into two columns, but really it is not so; for, every line of the first column extends to the second; borders of each of the columns ruled in three lines in black ink; leaves numbered in both the margins: in the right-hand one in numbers as 1, 2, etc and in the left-hand one as t, 2, 3, u, etc.; leaves 22b 1 and 23 illegible, since the ink has faded; leaf 1896 blank; red chalk used; last few leaves stuck together; leaves I to 157 are followed by leaves 170 to 189; both the text

Page #556
use] ... 17. Melasarar: . and the commentary incomplete ; the 18th leaf ends abruptly ; condition unsatisfactory; for, edges of almost every leaf partly worn out. Age.-- Old. Author of the commentary.- Yasodeva Suri, pupil of Sricandra Suri, pupil of Vira Gani. Subject. The text together with its explanation in Sanskrit. The latter is composed in Vikrama Samvat 1180. See No. 1155. Begins.-( text ) leaf 6* titthaMkare ya titthe etc. as in No. 1147. -, (com.) ,, b namo vItarAgAya // zivazammakAnimittaM etc. as in No. INSI. Ends.-( text ) leaf (?) This cannot be written, since this cores ponding leaf has stuck together with another. ,, -(com.) leaf 188b evaM paDikkamaNakAlaM etc. up to mAnata: as in No. 1155. This is followed by the line as under :- . cha // 11 // maMgalaM mahAzrIH // cha / cha | zubhaM bhavata lekhakapAThakayoH // ch| Then on leaf 1896 we have: yoganivRttAH vibhAgazo aSTAdazapApasthAnavivarjakAnapi tathApi kecidanAbhogAtsahasA... karaNAta mUlottaraguNAticArasUkSmataravizuddhayartha umayasaM. prAkAle guptasannikai rAjarSizuddhabhAvaprayuktAlocanA uparyupari vizuddhazuddhataracAritrasthAnarohiNaH saMvegataH AtmaniMdA gardA prayuktAH / evaM pratyahaM pratikramaNena vizuddhA api prApte pakSAMte vizeSapratikramaNena pratikramitumicchaMtaH // imANattimaparisANa vaMdaNaM kareMti nANAisatthabhAvabhAvaNaM ca // cha / titthaMkare ya gAhA // coyaga Aha // ciTTara tAva gAhattho / imaM ta.vanAumicchAmi paidiNamAloiya paMDikkatta() kapapacchittavisacissa / kiM pakkha caummA. It ends thus. Reference.- Both the text and the commentary are published. See No. 1143. For an additional Ms. see No. 1546 of the Limbdi Catalogue..... . .......

Page #557
sto Jaina Literature and Philosophy faina Lerature in [ni. . . pAkSikasUtravRtti .. .... .. Paksikasutravrtti . ... .. . Faksikasutravrtti ..... .. -1284 No. 1151 ___1886-92. Size:-ing in. by 4 in.. ... .. .... Extent.- 63 folios ; 14 lines to a page; so letters to a line. Description.-Country paper thin and rough; Devanagari cha racters with pRSThamAtrA; bold, big, legible and good handwriting ; borders ruled in four lines in black ink ; red chalk and yellow pigment used; fol. ra blank; edges of the first fol. slightly damaged; condition on the whole good; foll. doubly numbered: once as '1, 2 etc. and once as 766, 767 etc; over and above this, fol. 3 and the following are also numbered as 79, 80 etc.; this work seems to be incomplete so far as the colophon is con... ... cerned............. Age.- Pretty old. Author.- Yasodeva Sari, pupil of Sricandra Suri, pupil of Vira ____Gani. Subject.--A Sanskrit commenrary to Paksikasutra. . Begins.- fol. rb hai nmH|| - zivazamaikanimittaM vighnaughavighAtinaM jinaM ntvaa|| . .. vakSyAmi mukhavibodhAM pAkSikasUtrasya vRttimahaM // 1etc. Ends.- fol. 630 ... evaM ca paDiLamaNakAlaM tuliralaM)ti jahA paDikkamaMtANaM / zuiavasANe ceva paDilehaNavelA bhavai ti|| samAptA ceyaM zAstrAnusAriNI pakSapratikramaNavRttiriti // cha / 'caMdrakulAMbarazazino bhanyAMbujabodhanakadinapatayaH / guNagaNaratnasamudrA Asana zrIvIragaNimizrAH // 1 //

Page #558
1152.] ye ca 1 2 IV. 4 Mulasutras zuddhadhyAnajalApanItakalilAH sajjJAnadIpAlayA niHsaMgavratabhAradhAraNaratAstItre tapasyudyatAH grISme vAtapavedanaM gurutaraM jetuM sadopasthitA / hemaMteSu ca zArvaraM himabhavaM (raM) soDhuM sadA nizvalAH // 2 // zrIcaMdrasUrinAmA teSAM ziSyo babhUva guNarAziH / AnaMdita bhavyajanaH zaMsitasaMzuddha siddhAMtaH // 'kali' kAladurlabhAnAM guNaratnAnAM nidhAma (Tena ) manavayaM / samayAvadAtabuddhistathA paro devacaMdragaNiH / 'zrI[:] 2 caMdranAmasUreH pAdapaMkaja sevinA hRbdheyaM prastutA vRttiH zrIyazodevasUriNA // 5 " gaMbhIta ( ra?) metadAkarSe nivohazaktirasti mama dakSA || nApIha saMpradAyaH samyagbahavazva pAThagamAH // 6 zAstrAnusArAtsukhabodhapAThe (Thai) rAtmIyazaktyA vivRtaM tathApi / yacceha kiMci. It ends thus abruptly. Reference. -- Published. See No. 1143. pAkSikasUtravRtti No. 1152 For additional Mss. see G. O. Series vol. XXI (pp. 8, 18 and 35) and Limbdi Catalogue No. 1546. For a palm-leaf Ms. of the commentary styled as " pakSapratikramaNavRttiH" see the Pattana Catalogue (vol. I, p. 310): 66 [J. L. P.] Size-- rr in. by 44 in. Extent. - 78 folios; 13 lines to a page ; 48 letters to a line. Description. - Country paper thin, grey and brittle; Devanagari characters with qua; bold, big, legible and very good ' zrI zrIcaMdra' iti / In the printed edition we have: 46 521 gambhIrametadA na cohane zaktirasti mama dakSA " Paksikasutravrtti 168. 1873-74.

Page #559
Jaina Literature and Philosophy 522 [us. hand-writing; borders ruled in four lines in black ink; red chalk used; foll. 26-35,48,49,54-66 and 70-75 very grey; edges of some of the foll. somewhat damaged; corners of one and all the foll. badly worn out; a piece of paper of the same size as the fol. pasted to fol. 1a; condi tion fair; complete. Age.-Samvat ISI9. Begins.-fol. b jai namaH sarasvatyai // zivazamaikanimittaM etc. as in No. IISI. Ends.- fol. 770 evaM ca paDikkamaNakAlaM tu etc. up to j0 3100 as in No. IISS. This is followed by the lines as under :saMvat 1519 varSe zrAvaNa zudi 8 zanivAre liSitaM / iti zrIpAkSI(kSi)kasUtravRttiH samAptA // maMtrikelAlikhAvitaM / AMbAlikhitaM / This is followed by the following lines written in a different hand: 'prAgvATa maMtriThAkurasiMhasutaH puNyakRjjayati maMtrI / jhabakUdarakhaniratnaM karmAdevallabhaH kelhH||1|| yo 'girinAre' yaharadurgottuMgatridevakulikAnAM / kArayitA caa('s)hmdngrottmdhrmshaalaayaaH|2|| paMDitapadapratiSThAdevAlayapaMcakAdikArayitA / sakalavibudhaveSArpaNasAdharmikasamahabhaktikaraH / 3 // . zrI..' sUrIzvaropadezena tena siddhAMtaM / lekhayatA'lekhi pratireSA rasazazitithimite(s)bde / 4 // This is followed in a still different hand by the verse as under: zrImad bRhattapa'nAthazrIsUrasuMdaragurUNAM / ziSyo(s)vAcayadetAM pratimasamA smymaannikyH| 5 // N. B.- For further particulars see No, ILSI. - 1 Letters are gone since the folio is worn out. 1519.

Page #560
It33.] IV. 4 Malasatras 523 pAkSikasUtravRtti Paksikasutravrtti No. 11.53 764. 1899-1915. Size.- 12] in. by 4t in. Extent. -- 49 folios ; 15 lines to a page ; 64 letters to a line. Description.-Country paper rough and greyish; Devanagari cha. racters%3 bold, big, clear and good hand-writing: borders ruled in four lines in black ink ; red chalk used ; yellow pigment, too ; edges of the first fol. slightly damaged; on fol. I we have patra 38 aMtormadhyavicAra // 1, patra4pAkSIvicAra 2 written ; otherwise it is blank ; condition tolerably good; complete ; composed in Samvat 1180; extent 2700 slokas. Age.- Fairly old. 3egins.- fol. 10 ahe namaH zivazamaikanimittA(taM) etc. as in No. IISI. Ends.-fol. 496 evaM paDikamaNa etc. up to grNthmaantH|| 11 // as in No. IISS. This is followed by the lines as under: graMthAnaM 2700 / AgamikazrIamarasiMhasUribhiralikhyate / pajjUjasaNe caumAse paMkkhi ya pavamIsa nAyavvA / tAu tihiu jAsiM uDayau suro na anaao||1|| dazAzrutaskaMdha bhASyate / iti pAkSikasUtraTAkiA saMpUrNA. Then in a different band we have :ityAdyA sasUtrA vRttila) 3100 / zrIyazodevamUribhiH kRtA / saMbat 11800 varSe 'aNahallapATake nagare vRtti kRtA N. B.- For further particulars see No. IISI.

Page #561
227. see Jaina Literature and Philosophy pAkSikasUtravRtti Paksikasutravrtti No. 1154 1902-1907. Size.--101 in. by 41 in. Extent.- 63 folios; Is lines to a page ; 48 letters to a line. Description.-Country paper whitish and cough ; Devanagari cha * racters with pRSThamAtrAs; bold, big, legible and good hand writing ; borders ruled in four lines in black ink; toll. numbered twice as usual; fol. IN blank; foll. 55 to 60 slightly worm-eaten ; condition tolerably good ; complete; extent 2700 slokas. Age.- Pretty old. Begins.-fol. rb OM namaH sarasvatyai / zivazamaikanimittaM etc. as in No. IISI. Ends.-fd evaM ca paDikkamaNa etc. up to vikramAdgataH as in No. IISS.. This is followed by the lines as under ve sahasre zatairadhikaiH saptabhigraMthamAnataH // yAva lavaNa samudro yAvaccanakSatramaMSTito 'mes(ruH)| yAvaccaMdrAdityau tAvavidaM pustakaM jayatu // zrI // graMthA 2700 cha // etc. - N. B.--For further particulars see No. IISI. pAkSikasUtravRtti Paksikasutravrtti ___1203. No. 1155 1887-91. Size.-- 134 in. by 54 in. Extent.- 57 folios ; 15 lines to a page ; 56 letters to a line.

Page #562
jess. 1 N. 4 Malasatras 525 Description.-- Country paper thin and tough; Devanagari characters with occasional TS; bold, big, legible and elegant hand-writing; borders ruled in two thick red lines; the interlinear space coloured yellow; numbers for foll. entered twice as usual; the first fol. slightly torn; foll. 6 to 17 somewhat worm-eaten ; so are the foll. 31 to 42; condition tolerably fair; complete; unnumbered sides decorated with a small pattern in the centre, whereas the numbered, in the margins, too ; extent : 310o slokas ; composed in Samvat 1180. Age.-- Pretty old. Begins. fol. 1 OM namaH sarasvatyai // zivamkanimittaM etc. as in No. 11gt. Ends- fol. 572 evaM ca paDikamaNa etc. up to vivRtaM tathApi as in No. 111. This is followed by the lines as under : use kiMcitithaM nibaddhaM tatrAstu mithyA mama duHkRtaM hi // 7 // 'aNahilapATaka 'nagare sauSaNikanomacaMdrasatkAyAM / varaSauSadhazAlAlAM(yAM) rAjye jayasiMhabhUpasya / 8| vizAradaiH sUrivarairbihAribhi vizodhitA yatnaparAyaNairiyaM tathApi yanAdhikaM padaM tacchodhinIyaM kuzalaiH kRpApadaiH // 9 // zubhAzayavazAcceha yanmayA sukRtaM kRtaM tena bhUyAnmamAbhyAsaH sarvadaiva jinAgame // 10 // ekAdazazatai (tai) racikairazItyA vikramAgataiH / trINi zlokasahasrANi zataikaM graMthamAnataH // 11 // graMthAgraM 3100 zubhaM bhavatu // cha // cha // N. B.-- For further particulars see No. 1151.

Page #563
526 Jaina Literature and Philosophy (1156. pAkSikasUtravRtti Paksikasutravrtti No. 1156 1283 1891-95. Size.--144 in. by rg in. Extent. 259-2=257 leaves ; 3 to 4 lines to a leaf ; 44 letters to a line. Description.-- Palm-leaf durable and greyish; Jaina Devanagari characters with SAETTS; big, legible, uniform and good hand-writing ; this Ms. presents an appearance of the work having been written in two separate columns; but, really speaking, it is not so; for, the lines of the first column extend to the second ; borders of each of the columns ruled in four lines in black ink; red chalk used ; leaves numbered in both the margins; in the right-hand one as 8,4, etc. and in the left-hand one as e etc.; the first two leaves missing; the leaf placed before the fourth is taken here to be the third ; but since the marginal portions etc. are worn out, it is difficult to ascertain its real number; almost half the part of several leaves worn out; condition unsatisfactory; leat 2596 blank ; leaves 1276 and 128* illegible, ink having faded ; an extra blank leaf at the end; a hole almost in the centre of each leaf through which a red string passes ; leaves are placed between two wooden boards. Age.-- Samvat 1275. Begins.--leaf 3b (?) tarta TOTENT FIHURTA Per I 349 ATAT Tat: ay halat sorat a gli AT.......good etfa si abia for etc. Ends.-leaf 258 evaM ca paDikkamaNa etc. up to vivRtaM tathApi as in No. 1151. This is followed by the lines as under : paJcehaM kiMciditathaM nibaddha tatrAstu mithyA mama humlataM hi // 7 // 'aNahilapATaka nagare sauvarNiNakanomicaMdrasatkAyaM( yAM) parapauSadhazAlAyAM rAjye jayasiMhabhUpasya // 8 //

Page #564
-157.] IV. 4. Malasatras 527 vizAradaiH sUrivarai[:]vi(vi)hAribhi vizodhitA yatra parAyaNairiyaM ... ... zIlakRpAparaiH // 9 // zubhAzayavazAha yanmayA sukRtaM kRtaM tena bhUyAnmamAbhyAsaH sarvadeva jinA... ekAdazazatairadhikarazItyA vikramAdataH / he sahasra zataradhike sptbhidhmaantH|| cha / saMvata 1275 varSe kArtikazadi 5 yuro aoha zrIma('daNahilapATake' pUjyazrIkulaprabhasUriyogyA Thakkara AzApAla Tha0 sUhadevyAH sutayA sUmalabhAvikayA pAkSikasUtravRttipustikA lekhitA' // cha / zivAya bhavatu // cha / etc. N. B.-- For further particulars see No. 1151. pAkSikasUtrAvacUri Paksikasutravacuri No. 1157 214. 1871-72. Size.-- 104 in. by 4; in. Extent.-- 6 folios ; 23.lines to a page ; 70 letters to a line. Description.- Country paper very thin and greyish; Jaina Deva nagari characters with occasional pRSThamAtrAs; very small, clear and good hand-writing; borders ruled in four lines in black ink; edges of the 6th fol. slightly damaged ; con dition on the whole good; red chalk used; complete. Age.- Pretty old. Author.- Not mentioned. Subject.- A small commentary on the Paksikasutra based upon the bigger commentary by Yasobhadrasuri. Begins.- fol. I' titthaM cazabdAdatItAnAgatAdIn / tIrtha vibhaktivyatyayAt / pAThAMtarato vA titthaM ti| etc. __1 If this is to be taken as likhitA meaning ' written', then this is a Ms. written by a female. For a Ms. of Malayagiri Suri's com. on Avassaya written by a bravika named Rupade, see Jainacitrakalpadruma (Punyavijayaji's article, p, 53 foot-note 70).

Page #565
528 Jaina Literature and Philosophy [ 1157. Ends. fol. rh iha bhagavaMtamiti zeSaH / gurava nitthAra0 nistArakAH saMsArasamudrAbijapratijJAyA vA pAragAH saMsArasamudratIragAmino bhavata yUyamityAzIrvacanaM // cha // iti zrIpAkSikasUtrAvacUriH // zrIcaMdra sUriziSya zrI yazobhadrasUrikRtavRttito likhitA // cha // graMthAgra 629 Reference. In the Limbdi Catalogue there are two Mss. of fersUtrAvacUri one of which is anonymous and the other by Balacandra. Their Nos. are 1548 and 1549 respectively. pAkSikasUtra avacUrisahita No. 1158 Age. Fairly old. Author of the avacuri.- Not mentioned. Size. 10 in. by 4 in. Extent. 4 folios; 13 to 14 lines to a page; 56 letters to a line. Description. Country paper very thin, rough and white; Jaina Devanagari characters with frequent gas; small, legible, uniform and good hand-writing; this is a q Ms., the commentary written in a very very small handwriting; borders ruled in four lines in black ink; red chalk used; yellow pigment, too; foll. numbered in the right-hand margin only; condition very good; the text complete; but the avacuri ends abuptly, on fol 3b; this Ms. contains an additional work viz. qfar which commences on fol. 4b and ends on the same fol. 4b; it is described as No. 958. - rw Paksikasutra with avacuri Subject. The text with a small commentary in Sanskrit. Begins. (text) fol. ra - 1282 (a). 1891-95. tithaMkare ya tithe etc. - - (com) fol. 14 arhatpravacanAnusArisAdhavaH sAvayayoganivRttA adhyanAbhogAdinotpannasya mUlo...... syAticArajAtasya vizodhanArtha etc.

Page #566
I159.] ..IV. 4 Malasatras 529 Ends.- ( text ) fol. 4 imaM vAi duvAlasaMgaM gaNipiDagaM bhagavaMtaM saMmaM kApaNa phAsaMti pAlaMti pUraMti tIraMti kiTRti saMmaM ANAe ArAhati ahaM va nArAhAmi tassa micchA mi dukkaDaM // cha / iti pAkSikaM / / -,, -(com.) fol. 30 evaM navaNeNa bhaviyava ti / / .8 // pRthivyaptejovAyuvana......nicatu paMceMdriyabhedAt // . . navabaM navabraha. This ends thus abruptly. Reference.- For description of a Ms. having the. text and an anonymous avacuri see Keith's Catalogue No. 7505. See also G.O. Series, vol.XXI, p. 35, No. 275:(4). pAkSikasUtrAvacUrNi Paksikasutravacurni No. 1159 ___1182(b). 1884-87. Extent.- fol. 14s to fol. 22deg. Description.- Complete. For other details see No. 728. Age.- Pretty old. Author.- Not mentioned. Subject.- A small commentary in Sanskrit on Paksikashtra. Begins.- fol. 14deg 3 natvomaH shriisudhrmsvaamine| - titthaMka0 cazabdo(s)tItAnAgatAditIrthabhedasaMgrahArtha etc. Ends.-fol. 22* zrutadevatAstutimAha / sua0 zrutAdhiSThAtrI devatA zrutadevatA bhavati ca zrutAdhiSThAtrI / / yaduktaM kalpabhASye sallaM ca lakakhaNoveyaM samahiTuMti devayA / suttaM tu lakakhaNoveyaM teNaM savannabhAsi // 1 // pAkSikasUtrAvacUrNi(:) samAptA / Reference.- See Nos. II57-1158.

Page #567
Jaina Literature and Philosophy [1160. 530 : pAkSikasUtrAvacUri Paksikasutravacuri No. 1160 1285. 1886-92. Size.-- 10.1 in. by 44 in. Extent.- Io folios ; 19 lines to a page ; 64 letters to a line. Description.-- Country paper thin and greyish ; Devanagari cha racters with occasional pRSThamAtrAs; bold, small, clear and good hand-writing ; borders ruled in three lines in red ink; red chalk used; edges of foll. 9 and 10 partly torn; condition tolerably good; complete; extent 1000 Slokas. Age.- Pretty old. Author:- Not mentioned. Subject.- A small commentary on the Paksikasutra. Begins.-fol. !" titthaMkare tIrthakarAMzcazabdAdatItAnAgatAditIrthAn / tIrtha jina pravacanaM tadAdhAratvAJcaturvarNasaMdhazca / etc. Ends.- fol. 10deg ihAcAryavacanaM nitthAragapAragA hoha / nistArakAH saMsArasamudrAta prANAnAM pAragAH saMsArasamudratIragAmino bhavaMtu yUyamityAzIrvacanamiti // 4 // iti pAkSikasUtrasyAvacUriH samAptaH / cha / etc. zreyo'tra zrIzramaNasaMghasya / yAdRzaM etc. leSakaDAhAliSitaM / 'senApUra'vAstavyaH / leSaka etc. Then in a different hand we have : graMthAMka 1000 // Reference.- See No. IIS7-1158.

Page #568
_