Page #1
--------------------------------------------------------------------------
________________ THE INDIAN ANTIQUARY, A JOURNAL OF ORIENTAL RESEARCH IN ARCHEOLOGY, EPIGRAPHY, ETHNOLOGY, GEOGRAPHY, HISTORY, FOLKLORE, LANGUAGES, LITERATURE, NUMISMATICS, PHILOSOPHY, RELIGION &c. &c. EDITED BY RICHARD CARNAC TEMPLE, MAJOR, INDIAN STAFF CORPS. VOL. XXI.-1892. Swati Publications Delhi 1985
Page #2
--------------------------------------------------------------------------
________________ Published by Swati Publications, 34 Central Market, Ashok Vihar, Delhi-110052 Ph. 7113395 and Printed by S.K. Mehra at Mehra Offset Press, Delhi.
Page #3
--------------------------------------------------------------------------
________________ CONTENTS. The names of Contributors are arranged alphabetically. PAGE PAGE J. E. ABBOTT : PROF. A. F. RUDOLF HOERNLE, PH.D. :Similar Passages in the Bhagavatapurans and A NOTE ON THE DATE OF THE BOWER MANUBhagavatgita ... .. ... . . .. 94 SCRIPT ... ... ... ... SAYYID KHAIRAYAT AHMAD: THREE FURTHER PATTAVALIB OF THE DIGAN BARAS ... ... The Evil Eye in Bihar.. .. . ANOTHER INSTALMENT OF THE BOWER MS. ... G. BUHLER, PH.D., LL.D., C.I.E.: THE THIRD INSTALMENT OF THE BOWER MS.... 349 The Dates of the Vaghela Kings of Gujarat BERNARD HOUGHTON, I.C.S., M.R.A.S.:GAURDAS BYSACK : Handbook of the Haka or Baungahe Dialect of the Euphemisms in Bengal... ... .. . Chin Language ... ... .. ... .. 123 "No" as a word of ill-omen in Bengal ... E. HULTZSCH, Pa.D.; BANGALORE :8. J. A. CHURCHILL, TERRAN EKAMBANATHA INSCRIPTION OF GANAPATI, DATED The Evil Eye in Persia .. . SAKA-SAMVAT 1172 ... ... ... . C. P. CORY: BHARAUT INSCRIPTIONS .. . ... 225 Notes on the Traditional and Mythical Men and Materials for calculating the Date of Sundara Beasts of the Malagasy . .. * ... 350 Pandye ... ... ... ... .. ... .. 121 SOUTH INDIAN COPPER INCOREPPIONS ... ... 321 WILLIAM CROOKE, I.C.S., MIRZAPUR : Two Further Pandyan Dates ... ... ... ... 443 FOLKTALES OF HINDUSTAN No. 1.-The Prince and his Faithful Friend, Pror. F. KIELHORN, C.I.E., GOTTINGEN - the son of the Wesir .. No. 2.-The Parrot Prince and his Princess ... 277 Miscellaneous Dates from Inscriptions and Mss.. 47 No. 3.-How Eve reached the Prince ... ... 341 Tax AMCACHHI COPPER-PLATE GRANT OF VIORA HAPALADEVA III. ... ... ... ... ... 91 NARSINGRAO BH. DEVATIA: GORAKHPUR COPPER-PLATE GRANT OY JAYADITYA Notice of the Praobina Gujarati Sahitya Batas OF VIJAYAPURA ... ... ... ... ... 169 mala ... ... ... .. THE MUNGIR COPPER-PLATE GRANT OY DEVA PALADEVA ... ... GEO. F. D'PENHA: ... ... ... ... 253 FOLKLORE IN SALBETTE ) V. KANAKASABHAI PILLAI, B.A., B.L. - No. 11.-Francis and his Uncle ... . TAMIL HISTORICAL TEXTs No. 3. AN INSCRIPNo. 12.-The Fortune-teller's Daughter TION OF KULOTTUNGA-CHOLA .. ... .. 281 No. 13.-The Cowherd and his Wife ... ... No. 14.-The Ill-treated Daughter-in-Law ... LIEUT. R. M. RAINEY, I.S.C.:J. F. PLEET, L.C.S., M.B.A.S., PH.D., C.I.E.: Notes on the Chinbok, Chinbons and Yindus, on ... An Early Kadamba Rock Inscription ... the Chin Frontier of Burma .. .. ... 215 BHADRABAHO, CHANDRAGUPTA, AND SRAVANA D. ROSS : BELGOLA .. ... ** * Taila II. A note on the Tashon and Baungshe Chins with .. ... 167 . remarks on their manners, customs and agriG. A. GRIEKSON, B.C.S.: culture ... .. ... . ... ... ... ... 190 Tax INSCRIPTIONS OF PIYADASI, translated from the French of M. E. Senart : B. SENART, MEMBRE DE L'INSTITUT DX FRANCH:The Language of the Inscriptions, from the See G. A. Grierson. French of M. E. Separt ... ... 1, 101, 171 V. A. SMITH :Khalei, Dhauli-Jaugada, Columnar Edicta, Bhabra, Sabasaram, Rupnath, Bairat... ... 86 Notice of Catalogues of Coins in the Government The general character of the Language ; ite Museum, Lahore ... ... .... .. .. 184 Historical Position ... ... ... 145 Notice of Sir Alexander Cunningham's Coins of The Language of the Edicts, and the Linguistio Ancient India from the Earliest Times ... ... 344 History of India, the Chronology of the In Notice of Monumental Antiquities and Inscripscriptions ... ... .. . .. ... 318 tions in the N. W. P. and Oudh ... ... 303 Mixed Sanskrit and Classical Sanskrit ... ... 243 The Date of the Greco-Buddhist Pedestal from Monumental and Literary Prakrits ... ... 258 Hashtnagar ... .. ... .. ... ... 166 W. R. HILLIER : DR. H. W. SMYTH, PENNSYLVANIA:Notes on the manners, customs, religion and SACRED LITERATURE OF THE JAINS, translated superstitions of the Tribes inhabiting the Shan from the German of Prof. Weber... 14, 106, 177, States ... ... ... ... ... ... ... 116 210, 293, 327, 869 * 156 Fama
Page #4
--------------------------------------------------------------------------
________________ CONTENTS. PAGE K. SRIKANTALIYAR :A Folktale about the Komattis ... ... ... 93 Eclipse Customs in Madras ... Superstitions as to Crows in Madras Bad Omons in Madras ... ... ... ... Good and Bad Omens in Madras ... ... Social Customs in Madras ... ... ... Social Customs in Southern India ... Superstitions as to Snakes in Madras Superstitions about Animals in Southern India ... 994 Snperstitions in Madras ... 252 Superstitions about Animals in Madras ... ... 276 Spirit Haunts in Madras .. ... 279 Miscellaneous Superstitions as to Animals in 21dras ... .. .. . .. ... .. 318 224 MAJOR R. C. TEMPLE, I.S.C., M.R.A.S.: Offerings to Godlings in Bengal .. . An English Inscription at Moulmein ... ... 52 Glimpses into a Bhil's Life ... ... .. Sanskrit Words in Burmese ... ... ... .. 193 THE ORDER OF SUCCESSION IN THE ALOMPRA DYNASTY OF BURMA ... ... ... . 304 V. V.:Notice on the Vedanta-Siddhantamuktavali of Prakasananda ... ... ... ... .. . 48 L. A. WADDELL: Tibetan Folklore, 1. Cats ... ... ... .. PUTLIBAI D. H. WADIA : PARSI AND GUJARATI HINDI NUPTIAI, SONGS ... FOLKLORE IN WESTERN INDIA : No. 17.-The Princess Malika-Jarika ... ... 160 N. SUNKUNI WARIAR : Kallil, a famous Shrine in Southern India ... 95 Antiquities of Malabar ... ... Malabar Coast. Unlucky Actions and Lucky Actions ... ... ... ... .. ... 194, 379 PROE. A. WEBER, BERLIN : See Dr. W. H. Smyth. TAW SEIN-KO: Sanskrit Words in the Burmese Langungo ... 94 Origin of Alompra ... ... ... ... ... 252 Notes on the National Customs of the Karennis... 317 NOTES ON AN ARCHEOLOGICAL TOUR THROUGH RAMANNADESA (THE TALAING COUNTRY OP BURMA)... ... ... ... ... ... ... 377 MISCELLANEA. Miscellaneons Dates from Inscriptions and MSS., Taila II., by J. F. Fleet ... ... ... .. . 167 by F. Kielhorn ... ... ... ... ... 47 Two Further Pandya Dates, by Dr. E. Hultzsch ... 843 An Early Kadamba Rock Inscription, by J. F. Tibetan Folklore-1. Cats, by L. A. Waddell ... 378 Fleet ... ... ... ... ... ... ... 93 A Note on the Tashon and Baungshe Ching, with A Folktale about the Komatis, by K. Srikantaliyar. 93 remarks on their Manners, Customs and Agricul ture, by D. Ross... ... ... ... ... ... 190 Notes on the Manners, Customs, Religion and Notes on the Chinboks, Chinbons, and Yindus, on Superstitions of the Tribes inhabiting the Shan the Chin Frontier of Burma, by Lieut. E. M. States, by W. R. Hillier ... ... ... ... 116 Rainey, I.S.C.... ... ... ... . ... 216 Materials for Calculating the Date of Sandara Notes on the Traditional and Mythical Men and Pandya, by E. Hultzsch ... ... ... 121 Beasts of the Malagasy, by C. P. Cory ... ... 256 The Date of the Graeco-Buddhist Pedestal from Notes on the National Customs of the Karennis, by Hashtnagar, by V. A. Smith ... ... ... ... 166 T. S. K. ... ... . .. ... ... ... 317 NOTES AND QUERIES. Offerings to Godlings in Bengal, by R. C. Temple... 28 Social Customs in Madras, by K. Srikantaliyar ... 193 Au English Inscription at Maulmaiu, by R. C. Sanskrit Words in Burmese, by R. C. Temple ... 193 Temple ... ... Malabar Coast, Unlucky Actions and Lucky Similar Passages in the Bhagavatapurana and Bhaga Actions, by N. Sunkuni Wariar ... 194, 279 vatgita, by J. E. Abbott Social Customs in Southerc India, by K. Srikaa. Sauskrit Words in the Barmese Language, by Taw taliyar ... .. ... ... .. ... ... 224 Sein-Ko ... ... ... .. Superstitions as to Snakes in Madras, by K. SrikanKallil, a famous Shrine in Southern India, by N. taliyar ... .. ........... 224 pkuni Wariar... ... ... ... ... .. 95 Superstitions about Animals in Southern India, by Antiquities of Malabar, Paral, by N. Sunkuni K. Srikantaliyar ... ... ... ... ... 92 Wariar ... ... ... ... ... ... .. 95 Superstitions in Madras, by K. Srikantaliyar Eclipse Customs in Madrar, by K. Srikantaliyar ... 123 Euphemisms in Bengal, by Gaurdas Bysack... Glimpses into a Bhil's Life, by R. C. Temple ... 123 Origin of Alompra, by Taw Sein-Ko. ... The Evil Eye in Persia, by S. J. A. Churchill ... 168 Superatitions about Animals in Madras, by The Evil Eye in Bihar, by Sayyid Khairayat Srikantaliyar ... ... ... ... ... Ahmad ... ... ... ... ... ... ... 168 Spirit Haunts in Madras, by K. Srikantaliyar Superstitions as to Crows in Madras, by K. Srikan Miscellaneous Superstitions as to Animals in taliyar ... ... ... ... ... ... ... 168 Madre, by K, Srikantaliyar ... . ... Bad Omens in Madras, by K. Srikantaliyar ... ... 168 "No" as a Word of nl-Omen in Bengal, by Good and Bad Omens in Madras, by K.Srikantaliyar 192 Gaurdas Bysack ... ... ... .. . 89
Page #5
--------------------------------------------------------------------------
________________ CONTENTS. BOOK-NOTICES. PAGE PAGE The Vedanta-Siddhantamuktavli of Prakasananda, Catalogues of the Coins in the Government Museum, with English Translation and Notes, by Arthur Lahore, by C. J. Rodgers, by V. A. Smith ... 194 Venis, by V. V. ... ... ... ... ... ... 28 Journal of the Maha-Bodhi Society. Edited by H. The Prachins Gujarati Sahitya Ratnamala, or | Dharmapali . . . . . . 279 Garland of Gems of Old Gujarati Literature. The Coins of Ancient India from the Earliest Times First Gem, the Mugdhavabodhamauktika. Edited down to the Seventh Century A.D., by Major by H. H. Dhruva, B.A., LL.B.; by Narsingrao General Sir A. Cunningham; by V. A. Smith ... 844 Bh. Divatys ... ... ... ... ... ... 52 Archeological Survey of India. The Monumental Handbook of the Haks or Baungshe Dialect of the Antiquities and Inscriptions in the North Chin Language, by B. Houghton, I.C.S., M.B.A.S. 123 Western Provinces and Oudh, by V. A. Smith ... 318 ILLUSTRATIONS. A Map showing the distribution of the Ancient South Indian Copper Coins ... " ** Northern Indian Alphabets ... .. . ... 40 Inscribed Wooden Images from the Kogun Cavo ... 878 Plates illustrating the Manners of the China, A ... 216 The Kalyani Sima at Pegu ... ... .. ... 383 Do. do. B ... 217 The Stones on which the Kalyani Inscriptions are do. C ... 318 cut... ... ... ... ... ... ... . 883 South Indian Copper Coins ... ... . 324 do. Do. do.
Page #6
--------------------------------------------------------------------------
Page #7
--------------------------------------------------------------------------
________________ THE INDIAN ANTIQUARY. A JOURNAL OF ORIENTAL RESEARCH. VOLUME XXI.-1892. THE INSCRIPTIONS OF PIYADASI. BY E. SENART, MEMBRE DE L'INSTITUT DE FRANCE Translated by G! A. Grierson, B.C.S., and revised by the Author, (Continued from Vol. xx. page 266.) CHAPTER IV. (continued). THE AUTHOR AND THE LANGUAGE OF THE INSCRIPTIONS. PART II. - THE LANGUAGE. THE language of our inscriptions presents, especially as regards grammar, hardly any I absolutely impenetrable obscurities. Much light is thrown upon it by a comparison with the analogous idioms with which literature has made us familiar. Nevertheless, the orthograpbical or dialectic peculiarities which distinguish the different versions, and the chronological position which our monuments occupy, lend to their study a philological importance, on which it is not necessary to insist. I propose, in the first place, to sum up, in as condensed an inventory as possible, all the grammatical phenomena worthy of interest. In a second part I shall draw general conclusions from these phenomena. I sball endeavour to determine the true nature of the orthographical processes, to define the extent of the differences of dialect, and to group together those indications which are adapted to throw light on the state of linguistic development in the middle of the 3rd century B. C. In spite of the continual progress with which attempts at their decipherment are rewarded, the condition of the monuments does not permit us to hope that the texts will ever be fixed with a rigorous certainty. Our facsimiles, moreover, are, at least for several versions, still regrettably insufficient. It is, therefore, impossible to establish absolute accuracy in our statistics of the grammatical forms; and it must be understood that many of the facts which are about to be recorded, if they are rare and exceptional, are not free from doubt; but, fortunately, the characteristic phenomena reappear sufficiently often to entitle us to establish them on solid grounds, and what. remains in doubt is in no way likely to compromise our general deductions.
Page #8
--------------------------------------------------------------------------
________________ THE INDIAN ANTIQUARY. (JANUARY, 1892 I. - THE GRAMMAR OF THE INSCRIPTIONS. A. - GIRNAR. 1.- PHONETICS. I, 10 ; IIL, 4 ; rdja, V, 1; tada, XIII, 5; tatha, XII, 6. (several times tatha); yatha, IIL 8 (a). - Vowels. (several times yatha); va (in the meauing of Changes of Quantity. - Except in certain ta) V, 8, 5; VI, 2, 3, 4, &c. special cases, I enter neither here nor elsewhere Changes of Quality.- Pirinda or parinda under this heading, words in which the lengthening or the shortening is the result of com = pulinda (?), XIII, 9. Eta (= atra) VIII, 1, 3, IX, 3. E is weakened to i in ovaditavya (for pensation, and can be explained either by the simplification or by the doubling of the con ode) IX, 8; likh dpayisaril, XIV, 3 (for 16deg). - sonant which follows. It is hardly necessary The vowel si is written ra in vrachha, II, 8; - to add that, among the changes of quantity a in bhati, XII, 6; vadki, XII, 2, etc.; bhataka, here noted a great many may be and can IX, 4, &c.; dadha, VII, 3; kata, passim only be apparent, being referable either to kacha, IX, 8; maga, L 11,12; magavya, VIII, mistakes of the engravers or to incorrect 1; suhadaya, IX, 7; usata, X, 4; vistata, XIV, 2; vyapata, passim ;-iin turisa, IV, 5; 6tirisa, readings. IX, 7, &c.; yarisa, XI, 1, &c.; - u in pariVowels lengthened. - Anantarail, VI, 8; puchha, VIIL, 4; vrta, X, 2.. asampratipati, IV, 2; asu (=syuh), XII, 7; Additionsand Suppressions. - Additions: abhiramakani, VIII, 2; chikichhd, II, 51; natika, V, 8; vipule, VIL, 3; vijayamhi, XIII, 10; a in garaha, XII, 3; garahati, XII, 5; i in tatha, XL, 4; madharitaya, XIV, 4. At the ithi, XII, 9; u in prapundti, XIII, 4. end of words: cha, IV, 11 ; esd (nom. masc.). Suppressions : a in pi (passim) for api which XIII, 4; mitasarhatuta, III, 4; nd, I, 2; XIV, is preserved II, 2; i in ti (V, 8; XEL, 11) for 2.; parapasaindagaraha, XII, 13; sarvatd, II, 6; iti, which is preserved five times; & in va for tatu, XII, 8; XIII, 4; tatra, XIII, 1; &tamhi, era (passim). IX, 2; panthesil, II, 8. Contraetions. - ava into o in orodhana A long vowel regularly becomes short before (passim); bvaditavya, IX, 8; aho, IV, 3, if I anusvaray, or before a consonantal group, even am right in explaining it as equivalent to when, as here, the latter is not represented athava; - a(l) into o in kho; - a(y)u into in writing : but sometimes, instead of doubling o in mora, I, 11 ; - a(v)i into ai in thaira, IV, the consonant, the preceding vowel is leng- 7;V, 7; VIIL 3; - aly)i in & in vijatadya, thened in compensation : dhama, V. 4; vasa, XIIL 11, and several times in the formative V, 4 al. Sometimes the vowel remains long, affix of the causal, hupesati, &c. Cf. below:even though nasalized : anuvidhiyatan, X, 2; ayo into ai in traidasa, V, 4; -ya into i in atikantari, VIII, 1 ; susrusatari, X, 2; viharaya- parichijitpa, X, 4; - iya into e in etaka, XIV, tanit, VIII, I; samacheran, XIII, 7. We should, 3; - if patenika, V, 5, really represents & perhaps, add here several cases in which a corruption of pratishthana, we should have in it represents a Sanskrit ai (see below Nasalized the contraction of a(t) into e. vowels). Sometimes, finally, a vowel remains Nasalized Vowels. - The nasal, whether long before a consonantal group: banhana, IV, before & consonant, or at the end of words, 2; VIII, 3; XI, 2; nast, passim ; rustika, is, except in two cases in which a final mis V, 5; tadatpane, x, 1; atpa-, passim; and preserved by sandhi, invariably expressed by before a mute followed by r : bhratra, IX, anusvira. The anusvara is omitted in a certain 6; matran, XIII, 1; paralramami, v, 11; number of cases, such as achdyika for kar, pardkramena, VI, 14. VI, 7; -pasarida for dann, XII, 4; avihisa for Vowels shortened.- Aradhi, IX,9; aradho, hind, IV, 6, &c. These omissions, several XI, 4; etarixan, IX, 4; dane, IX, 7; Opayd, of which are, without doubt, only apparent, and VIII, 5; natikena, IX, 8; susrisd (once susuga). due to the condition of the stone, are in every At the end of words mahaphale, IX, 4; prana, case accidental, and are to be referred to the
Page #9
--------------------------------------------------------------------------
________________ JANUARY, 1892.) THE INSCRIPTIONS OF PIYADASI. -- - zegligence of the engraver. I lay no stress V, 5, is really derived from pratishthania, it upon them. would afford an example of the loss of the aspiCertain cases seem to imply the equivalence ration, t for th. of a long vowel to a vowel nasalized : aparata, Suppressions and Additions. - Suppres. V. 5; atikutasi, IV, I; V, 3; VI, 1; Susurinsa, sion of an entire syllable in atha (= athriye), XIII, 3; niyatu (=niryantu), III, 3; padd, XII, 9; iloleika, XIII, 12; ilskacha, XL, 4 (for JI, 2 ; susrnsd (accusative), X, 2; nicha (= ihal6%); loss of the initial y in dva(yavat), V, 2, nityash), VII, 3; puja (acc.), XII, 2, 8; vanhal.; of a medial consonant in kho (khalu), wora (=va, vai), XJI, 6; sc michani (nom.pl. masc. ?), (maytira). - Addition of a o in vuta (ukta), II, 3. But in most of these examples the nasa- IX, 6, &c. lized vowel is long by derivation, and it may Compound Consonants. as well be admitted that the sign for annsvara kt becomes t : abhisita, &c. has accidentally disappeared. It is also possible ky becomes k : saka, XIII, 6. that the apparent confusion between a and an may, in some cases, be due to an error in the ker becomes k: atikavitasi, VIII, I, &c.; reading. The second 14 of serwis being here parakamate, x, 3, &c. It remains unchanged almost always written short, there are grounds in parikramami, VI, 11 ; parakramena, VI, 14. for believing that the aungvara of susurhsa is. kesh becomes chh : ach hati, XIII, 7; chhanati, dne to an inadvertence of the scribe; the XII, 5; chhulaka, XII, 4, &c.; samchhaya, reading samichain and its interpretation are XIV, 5; vrachha, II, 8; - kh, in ithihakhanot certain. There would, therefore, only re mahamata, XII, 9; khamitave, XIII, 6; santmain nicha, an unique example, and but a khitana, XIV, 2. fragile basis for such a deduction. We might, gn becomes g: agikharivthani, IV, 4. perhaps, add eta, IX, 5, which would be equi- gr becomes 9, : agena, X 4, &c. valent to etari (nom. sing. nout.), unless, indeed jn becomes (nl: katarinata, VII, 3, &c.; it represents etain. anapayami, VI, 6, al. In one case also, karu, XI, 4 (cf. karak, XII, dy becomes d in pada (pandyah), IL, 2. 4), an appears to be replaced by W; and some- ny becomes in: anaina, VL 11; hirazina, times by &: in athe, VI, 4, 5; yute, III, 6; VIIL, 4 save (sarve) kale, VI, 3, 8. But several of tm becomes tp in atpa, XII, 3, 4, 5, 6. these facts admit, as we shall see, of a dif tth becomes st in us!ana, VI, 9, 10. ferent explanation. ty becomes ch: dchayika, VI, 7, &c. In pravasahumhi, IX, 2, the nasal is written tr becomes t, as in bhata, XL, 3, &c. It is twice over, by an abase which is too frequent unchanged in bhratra, IX, 6; matran, XIII, in the manuscripts to cause us surprise. 1; mitrana, IX, 7; paratra, VI, 12; prapritra, (b). - Consonante. IV, 8; potra, IV, 8; putra, IV, 8, al.; sarSimple Consonants. - Changes. -gh into vatra, VI, 8, al.; savatra, VI, 4 ; tatri, XIII, A, in lahuka, XII, 3; - dentals into cerebrals, 1; tatra, XIV, 5; yatra, II, 7. in pati- for prati (passim); perhaps prati to becomes tp : alochetpa, XIV, 6; artin hirarnapratividhano, VIII, 4, but pra is bhitpd, 1, 3; chatparo, XIII, 8; dasayitpa, XIV, doubtful; wala, X, 4; osadha, III, 5; vadki, | 4 ; hitatpa, VI, 11 ; parichijitpi, XIV, 4; tudat. XII, 2, 8, 9 (beside vadhi, IV, 11); dasand, pane, X, 1. It becomes t in satiyaputi, II, 2, IV, 3; dasana, VIII, 3 (darsana, VIII, 4); if the etymology proposed by Dr. Buhler is praprnoti, XIII, 4; yona, V, 5; - th into hin correct. aho (athavd); -d into rin tarisa, etarisa, ts becomes chh in chikichhu, II, 4, &c.; - yarisa ; - bh into h in the base bhi : hoti, and 8 in usatena, ., 4. ahusu, &c. ;-l into r, if pirinda or parinda, ddh is preserved : vadht, IV, 11, or more XIII, 9, is equivalent to pulinda. If petenika, ordinarily changed into dh in vadhi, XII, 9, al. The cerebral n is always preserved in the base; it never appears in terminations, even where it ought to exist according to the Sanskrit rulo, as in die priyaa, &c.
Page #10
--------------------------------------------------------------------------
________________ THE INDIAN ANTIQUARY. (JANUARY, 1892. dy beeomes ; in aja, IV, 5;-y in uyana, VI, 4. dr becomes d : chhudaka, &c. do is preserved : dve I, 11, al.; dvddasa IV, 12, al. dhy becomes jh : majhama, XIV, 2, &c. dhr becomes dh : dhuva, I, 12, &c.; it would appear to be preserved in (a)dhra., XIII, 9, according to the reading of Dr. Buhler. ny becomes in, ii; arine, V, 5, &c.; manate, X, 1, &c. The spelling nayasu, for niyyasu, VIII, 1, is connected, in a manner more or less arbitrary, with this transformation of ny into n. pt becomes t : asamaton, XIV, 5, &e. pr becomes p: pakarama, XII, 3; devdnashpiya, XIII, 9, &c.; - it is preserved in : asanipratipati, IV, 2; devana priya, I, 1, 5, 6, 8; II, 1, 4; IV, 2, 5, 8, 12; V, 1; VIII, 3; IX, 1; X, 3; XI, 1; XIV, 1; pracharhitesu, II, 2; pradesika, III, 2; prupunoti, XIIL, 4; prakarana, XII, 4; praja, V, 7; prajuhitavyan, I, 3; prana, 1, 9, 10; III, 5; IV, 1, 5; XI, 3; prapota, VI, 13; prapotra, IV, 8; pratipati, XI, 2; perhaps prasividhano, VIII, 4; pravajitani, XII, 2; prarase simhi, IX, 2; priyadasi, IV, 1, 5, 8, 12; VIII, 2; X, 1. bdh becomes dh: ladhesu, XIII, I, &o. br becomes b: bamhana, passim ; it would appear to be preserved in branuhana, IV, 2, 6. bhy becomes bh: arabhisu, I, 9; arabhare, I, tm becomes thm: kasime, &c.; dhama, V, 4. ry becomes y : niyatu, III, 3. rv becomes v: puda, VI, 2; sava, palasim ; - it is preserved in purva, V, 4; sarva, VI, 9 (and three other times) ; sarvuta, VII, 1; XIV 2 (and four other times); sarvatra, VI, 8 (od three other times); sarve VI, 8 (against eighteen sava or savata). ri becomes rs in darsar.c VIII, 4&c.; - becomes s in dasand, IV, 3. rah becomes s: vasa (vasa), VIII, 2, al. rshy becomes in kasati (for karshyati); Y, 3; kasaviti, VII, 2. th becomes rah: garaha, &c. lp becomes p: apa, passim. ly becomes 1 : kalana, V, 1, al. vy is always preserved : apavyayata, III, 5; divyani, IV, 4, &c., except in pujetaya, XIL, 4. or becomes : pravajita, XII, 2, &e. ech becomes chh: pachha I, 12. sy becomes 8: pasati, I, 5; - or siy: pativesiyehi, XI, 3. or becomes : sususa, III, 4, &c.; - or er in bahusruta, XII, 7; susrusu, XII, 22; XI, 2 (and three other times); sramana, IV, 2 (four times samana); srdvapakari, VI, 6; srunaju (), XII, 7; sustusatarin, XII, 2. bv becomes sv : sveto in the legend attached to the elephant. shk becomes k in dukata, V, 3; dukara, V, 11. bhr becomes th: bhata, XI, 3, &c.; it is preserved in bhratra, IX, 6. my is preserved : samyapratipati, IX, 4; XI, 2. mr becomes ab: tarnbapanini, II, 2. rg becomes g: svaga, passim. rgh becomes gh: digha, X, I. rch becomes ch: vachabhimika, XII, 9, &c. rn becomes thi: toshbaparini II, 2. rt becomes t, as in anuvatare, XIII, 9, &c.; - in sarvata, IV, 9: V, 2. rth becomes th, as in atha, passim. rd becomes d: madava, XIII, 7. rdh becomes dh, as in vadhayisati, IV, 7, &c.; - dh, as in vadhayati, XII, 4, &c. rbh becomes th: gabha, VI, 3. sher becomes 8f : rusfika, V, 5. shth becomes su: adhist ana, V, 4 ; seste, IV, 10; nistina, IX, 6; tistamto, IV, 9; tisteya, VI, 13. sk becomes kh : agikhardhdni, IV, 4. st is preserved : asti, passim ; &c.; - it becomes st in anusasli, VIII, 4, al. sth becomes st in gharastani, XII, 1; - and 84 in elita, VI, 4. om becomes mh, e. g. in the locatives in mhi. sy becomes 8, e.g. in the genitives in asa. sr becomes &: parisava, X, 3, &c. ; - it is preserved in nisrita, V, 8; sahasra, I, 9; XIII, 1. sv is preserved : svaga VI, 12, al., &c., except in sakau, IX, 5.
Page #11
--------------------------------------------------------------------------
________________ JANUARY, 1892.) THE INSCRIPTIONS OF PIYADASI. hm becomes mh; it is, at least, thus that I Bases in AN. - nom. s. raja; gen. 8. rano ; believe that we should read the group 8, instr, s. rand; nom. pl. rdjano. which, strictly speaking, could also be read hm. Bases in ANT. - Karani, XII, 4, nom. sing. of the participle present, beside karo(n)to, XII, (c). - Sandhi. 5, tis! anto, nom. pl. masc., IV, 9. Sandhi rarely occurs except between the Bases in AR(RT). - Contrary to the other parts of a compound word, and, as an almost versions, Girnar presents, for these bases, no invariable rule, requires the elision of final traces of the passage into the vocalic declenconsonants ; it is nearly exclusively vocalic. sion. Instrum. sing. bhrata, IX, 6; bhatra, XI, A final anusvara is changed into min kata- 3; pita, IX, 5; XI, 3. Locat. sing. matari, vyam eva, IX, 3; evan api, II, 2. I further pitari, passim. note the form anamarinasa, XII, 7. Bases in AS. - Acc. sing. yaso, X, 1, 2; A final d is retained in tadopayd VIII, 5; bhuya, VIII, 5, ought to be bhuyo. tad ujanatha, XII, 5. Bases is IN. - Here we have no trace of a + give 4. Uxcept in dhamadhistanaya, V, I i n v the vocalic declension. - Nom. sing. piyadari, 4; dhamanngah, IX, 7. In ndsti (passim), the priyadasi (passim); the final vowel is always long vowel is retained in spite of the double short. - Gen. sing. pi(pri)yadasino ; instr. consonant which follows. pi(pri)yadasini. a ti gives 6 in oijayechhd, XIII, 11.3 (c). - Declension of Vocalic Bases. <+u gives 6 in manusopagani II, 5. Bases in A. - Masculines. The terminaa+ e gives e in tenesa, VIII, 3; cheva, IV, 7. tions are the same as in Pali. I only note *+a gives i in ithijhal hamahamata, XII, 9. peculiarities worthy of remark. u+u gives 8 in pasopagani, II, 6, & curious Nominative singular. - Besides the regular form which would appear to be borne out by form in 8, there are several cases of the nomithe other versions. native in 6, as in Magadhi: apaparisave, X, 2.- INFLEXION. 3; puve, IV, 5; devanaripiye, XII, 1; prade sike, III, 2; rajuke, III, 2; sakala, X, 3; ye, It must be understood that, except in V, I. To these examples we should add the special cases, I shall not expressly quote those many more numerous cases in which the nomimodifications which are of a purely mechani native neuter ends in e, instead of, and beside, cal character, being merely the applications ask. It is the less permissible to suggest a of the phonetic rules which have just been mechanical change of an to e, because the indicated. termination ash is still retained in the majority (Q). - Gender. of cases. We have, therefore, here an imitaThe distinction between the masculine and tion of Magadhi; and, so far as regards the neuter tends to disappear. This, as we Magadhi itself, the final reason for the use of shall shortly see, is evidently due to the in the termination & in the neuter, lies in the fluence of the Magadhi spelling. obliteration of the distinction between the neuter and the masculine, which has resulted (b).- Declension of Consonantal Bases. in the common acceptation, for both genders, of This tends to go over into the declension of the uniform use of the masculine termination. bases in a : parishad becomes parisd; larman It is clearly in this way that, VIII, 4, we becomes karima, and is declined like a neuter in have hirashnapasividhdno (for odhanan). a; of varchas, we have the locative vachamhin Acousative singular. - I have quoted above VI, 3; the present participle of as, makes its the form in & in athe, VI, 4, 5, and yute, III, nominative singular santo, VI, 7; VIII, 2. 6, for the accusative. Twice, sarve kale, VI, The following are the traces which still 3, 8, corresponds to savarh kalash of the other exist : versions. It must, nevertheless, be stated that Dr. Buhler's interpretation would do away with this combination.
Page #12
--------------------------------------------------------------------------
________________ THE INDIAN ANTIQUARY. (JANUARY, 1892. save kale, can very well be explained as a Nominative singular. - In i. I note, how. locative, and that yute could, without diffi- ever, apachiti, IX, 11 ; hini, IV, 4; rati, culty, be understood as a Pali accusative plural. VIII, 5. It is true that we miss parallel examples to Dative singular. - Anusasfiya, III, 3, ought authenticate this termination here. However perhaps to read Oye. the matter may be, if we must really admit it, I can hardly imagine for the ending of the Ablative singular. - Tanbaparini, II, 2. accusative, any origin other than false analogy Bases in U. - Magoulines. - with neuter nominatives in e. Nominative singular. - Sadhu, IX, 5. Datire singular. - It is always in dya. Genitive plural. -'Gurunas, IX, 4. There is one solitary instance of the form etayo, Ablative plural. - Bahuhi, IV, 4. III, 3. Feminines. - Ablative singular. - In a : hitatpa, VI, 11 ; Nominative singular. - sadhu, IX, 4, 11. kapa, IV, 9. Locative singular. - In amhi or in e. The Neuters. - two terminations occur with about equal Nominative singular. - Bahu, XIV, 3, al.; frequency. sadhu, IX, 8, al. Neuters. - The terminations are the usual Nominative plural. - Bahuni, I, 8, al. ones. (a). - Declension of Pronouns. Nominative singular. - As examples of the Demonstratives, &o. - I give, according nominative in e, I quote : ane, IX, 5; bahu to the alphabetical order of the bases, the vidhe, IV, 7; charane, IV, 7, 10; dane, VII, forms found at Girnar. 3; VIIL, 3; dasane, VIII, 3; mangale, IX, 4 (mangalari, IX. 1, 2, 3, 4); kanime, IV, 10; Anya. - Nom. sing. neater: afe, IV, 7; mahdlake (vijitam), XIV, 3; mahaphall, IX, IX, 5 ana, IV, 9; IX, 19. - Gen. sing. : 4; katavyamate (lokahitar), VI, 9; mite, VI, ahamannasa, XII, 7.- Loc. sing. : anire, VIII, 10; patividhane, VIII, 4; seste kamme, IV, TV 5, beside anamhi, IX, 2.- Nom. pl.: arine, 10; vipvile, VII, 3; ye, V, 2; tarise, yarise, radhite, IV, 5. Ima. - Nom. sing. masc., ayan; fem. Nominative plural. - We have a termina iyash; neater, idar. Ayan is, however, used tion in d, instead of ani, in dasand, IV, 3; for the feminine : 1, 10; V, 9; VI, 13; XIV, prana (read ond), I, 10. 1, and for the neuter with phalan, XII, 9. -- Gen. masc. : imasa, IV, 11. - Dat. fem. : Feminines. - imayu, III, 3. - Instr. masc. : imind, IX,.8, 9. Instrumental singular. - In dya, as madhu- - Loc. : imamhi, IV, 10. ritaya, XIV, 4. katya. - Nom. plur. masc. : ekacha, I, 6. Locative singular. - In dyarn, as parisdyain, Eta. - Nom. sing. masc. : @sa, X, 3; used VI, 7. It is difficult to decide whether saihti. for the neuter, or rather with a masculine randya, VI, 9, is, or is not, an error of the which, by origin, is neater, such as kaime, engraver &c., IV, 7, 10; VI, 10; fem., esa, VIII, 3, 5; Nominative plural. - In ayo, in mahidayo, neuter, etan, X, 4 (perhaps under the form IX, 3. etd, IX, 5); the parallel use of ta would lead Bases in I. - Of Masculines we find - one to think that eta, X, 4; XI, 3=etad, and is not an incomplete writing of etn. - Dat. Genitive plural. - Natinam, IV, 6, al. sing. : etaya, once (III, 3) etaye. - Loc. : Locative plural. - Natisu, IV, 1. etamhi, IX, 2.- Nom. pl. : ete, which, being Feminines. - We have no example of the associated with ti prand, indicates again a conplural. For the singular, the accusative in fusion of genders. in, and the instrumental in iya, call for no Ka. - Nom. sing, masc. : kochi, XII, 5, remark. neuter: kimchi, passim. V, 5.
Page #13
--------------------------------------------------------------------------
________________ JANUARY, 1892.) THE INSCRIPTIONS OF PIYADASI. Ta. - Nom. sing. masc. : sa, XII, 5, and hape sati, V, 3; pafivedetavya, VI, 8; pajetausually so; fem. : sa, XIII, 10; neuter: tan, (ya, XII, 4. One exception : likhapayitan, XIII, 2, more often ta, IV, 10, al., whether for XIV, 3. In one case, braditavya, IX, 8, it is tam, or more probably for tad, preserved in even reduced to i. Likhapayisan, beside the composition, VIII, 5 and XII, 5; se is employed usual lekhapita, presents an analogous weakenadverbially as equivalent to tad, I, 10, as fre- ing in the base. quently appears in the versions in a Magadhi (b). - Terminations. spelling. It is unnecessary to draw special attention to tas, tasa, taya, tena, tamhi, te, Present. - The terminations of the middle tesan, tehi. voice, which in one case are, for this tense, Na. - XII, 1, we find ne used as an accusa used to form a passive, arabhare, I, 11, are tive, and applied to neuter substantives. generally used with a neuter, or even with an active sense : anuvatare, XIII, 9 (the reading Ya. - Nom. sing. masc. : yo, once (V, I) ye; anuvatait of Dr. Buhler appears to be at neuter : yarn, VIII, 3, but much more frequent least very doubtful); marnate, X, 1; XII, 8; ly ya, for yad, IV, 10; VI, 5, 6, 11 ; X, 3; parakamate, X, 3 (by the side of parakramami, XII, 3.- Nom. plur. : ye, ye, XIII, 6; yani. VI, 11); karote, IX, 1, 2, 3 (by the side of Sarva. - Nom. acc. sing. Deuter., sarvari karoti, V, 1). - In sukhupayami, VI, 12, as(savam). - Loc. sing. (?): sarve, VI, 8; save, sociated, on the one hand, with gachheyani, VI, 3. - Nom, plar.: save, VII, 1. and, on the other hand, with Arddhayantu, it is Personal pronouns. - The following forms difficult to avoid recognising the subjunctive occur of the pronoun of the first person: ahan, use. mama, me for the genitive and once (VI, 9), Imperative. - The 3rd pers. plur.: uradhafor the instrumental, maya. yantu, VI, 12; niyatu, III, 3; yujamtu, IV, (e). - Declension of Numerals. 11, require no remarks. The middlo termiDve, nom., I, 11 ; II, 4. - Ti, nom. neuter nation, with an active sense, is preserved in (prdnd), I, 10, 12. - Chatparo, nom. masc., the 3rd sing.: anuvidhiyatan, X, 2; susrusatarina X, 2. It will be noted that both exceptionally XIII, 8. - Panchasu, loc., III, 2. retain the long vowel am and not arh. The 3.- CONJUGATION. 2nd pers. plur. borrows, as in Prakrit and (a). - Verbal Bases. in Pali the termination tha of the present, pativedetha, VI, 5. The simple bases are, in general, the same as Fotential. - 1st pers. sing. : gachheyani, in Sanskrit, after making allowance for phone VI, 11; plur. dipayema, XII, 6. - 3rd pers. tic modifications, as when we have side by side, sing. in & in bhave, XII, 13; in eya, in tisteya, bhavati and hoti, prapunoti for prapnoti. There VL 13; in Stha, i, e. with the termination of. are, however, changes, as : chhanati, XII, 5, the middle, in patipajetha, XIV, 4 ; plural: in in place of chhanoti; karani, XII, 4, participle eyu, in vaseyu, VII, 1; in eram, termination present, beside karorto, XII, 6; we should of the middle : in anuvat(6)rasi, VI, 14; note the extension and alteration of the base of sususeranh, XII, 7. Dr. Buhler reads srunerun, the present in prajuhitavyan, I, 3. The con li.e. srundran, XII, 7, the form which to me sonantal conjugation is only preserved in asti; seems to give srundju. The correct reading in upahandti, XII, 6, it passes into the 9th class. For the root krat we have the two would be sruneju for stuneyu. But, at Girnar, we have no certain example of the spelling bases : parakramami, VI, 11, and pardkamate, for y. The verb as makes the 3rd sing. in X, 3. In the passive, the formative affix ya is asa, X, 3, and the plural asu (asu), XII, 7. combined according to the usual phonetic laws, There is considerable difference of opinion as in arabhare, I, 11 ; drabhisarnre, I, 12; arabhisu, to the origin of this form; some look for it I, 9. in the Vedic subjunctive asat, and others In the causals, whether in aya or in paya the in the extension by analogy of syllt, syuh into formative aya is contracted to e whenever it asyat, asyus (Kuhn, Beitr, sur Pali Gramm, would take the form ayi : alochetpa, XIV, 6; p. 104).
Page #14
--------------------------------------------------------------------------
________________ 8 THE INDIAN ANTIQUARY. Past. 3rd pers. plur. aorist: ahumsu, VIII, 2; arabhisu (= arabbhisu, passive sense), I, 9. The form nayasu, i. e. n(i)yayanu, VIII, 1, may be compared with the 3rd pers. sing. in asi, of the dialect of the Gathas (cf. Mahavastu, I, 548). The 3rd sing. ayaya, would seem to be a sort of imperfect, influenced, perhaps, by the analogy of the perfect yaye. - Future. The only example of the 1st pers. sing. is in am, for ami, as in Prakrit: likhapayisam, XIV, 3. The 3rd plur. has twice a middle form anuvatisare, V, 2; drabhisamre (passive), I, 12; in this last case, the m is a : [JANUARY, 1892. material error, unless it has been introduced after the analogy of the termination asti. Infinitive. Aradhetu (m), IX, 9.- It is very doubtful whether khamitave, XIII, 6, is an infinitive. Dapakam and sravapakasi (VI, 6), A solitary example of the perfect, in aha, which appear to perform the office of inpassim. finitives, are in reality adjectives, like pachaka, bodhaka, with this particular shade of meaning, which is to be given,' 'which is to be taught.' PHONETICS. Vowels. (a). The alphabet of Kapur di Giri does not distinguish between long and short vowels. We cannot, therefore, here discuss changes of quantity. Absolutive. In tpa (tvd): alochetpa. XIV, 6; drabhitpa, 1, 3. Once in ya, in sachhaya samikshayya, XIV, 5. Changes of Quality.--a for u in garunam, IX, 19; pana, ibid., by the side of guru and puna. for 6, in likhapayami, XIV, 13; bhagi amani, VIII, 17; vijinamani, XIII, 3; antikini, XIII, 9; ghatiti, XIV, 13; duvi, I, 1.-u for a in uchavucha, IX, 18; oshudhani, II, 5; muta, XIII, 8; e for a in etra, VI, 15; Straka, IX, 20. We cannot say that has been substituted for a in cases like sashkhaye, XIV, 14 and the datives in aye; all we can do is to infer the graphic equivalence of aya and aye.-e for i in disah XI, 28; al. - In bhuye (for bhuyo) we should not, I think, look for an actual change in this dialect of 6 into, but should simply consider it as an accidental Magadhism of the spelling. u for 8 in likhapitu, I, 1. The vowel ri has no real existence = B. KAPUR DI GIRI. The readings of Kapur di Giri have of late made marked progress. A few items of uncertainty, no doubt, still remain, a state of affairs which is sufficiently explained by the condition of the rock, but it is only in points of detail that certainty is really impossible, and we may believe that, so far as decipherment is concerned, we have not so much to expect from the future. I cannot, therefore, do better than take for the basis of my grammatical analysis the last publication of Dr. Buhler in the Zeitschrift der deutschen morgenlandischen Gesellschaft, XLIII., pp. 128 and ff. 1. Participles. The middle form of the participle present is preserved in bhujamanasa, VI, 3. in this dialect, which, however, does not prevent its being represented in several ways by the orthography. It takes sometimes the form ra, in grahatha, XIII, 4; XII, 1, sometimes the form ri, in vistritena, XIV, 13, and sometimes ru, in eruneyu, XII, 7; mrugo, I, 3. It is changed to a in dukatam, V, 11; vapata, XII, 9; viyapata, V, 13; usatena, X, 22; so also in vajri, in which the influence of the etymological form has introduced an r in the following syllable; to i in didha, VII, 5; edisa, IX, 18, al.; kita, VI, 14; the influence of the r has here cerebralised the dental, which shews that the orthography kitra, II, 4; VII, 12; VII, 5, is purely a learned and affected one; - to u in vudheshu V, 12; viyaputa V, 13; paripuchha, VIII, 17; mute, XIII, 1; dharmavutam, XIII, 10. In rukha, XII, 5, vri would be changed into ru, but Dr. Buhler's reading, vuta, gives an entirely different word. Additions and Suppressions.- Additions: initial i in istri, XII, 9. Suppressions: a in pi (passim); i in ti (passim); e in va eva X, 22, al.; vo and Note by Translator. The section regarding Kapur di Giri having been entirely re-written by the author for the purpose of this translation, it is hardly necessary to point out that the following, in no way, agrees with the corresponding pages of the original work.
Page #15
--------------------------------------------------------------------------
________________ JANUARY, 1892.] THE INSCRIPTIONS OF PIYADASI. yo = @vani (cf, below); in sha =eshasa, VI, 16, Changes. - kh into k in ku = khu (khalu), if Dr. Buhler's analogy is well founded. IV, 9. Contractions. - ava into 8 in orodhana, ginto k in maka, XIII, 9. VI. 14; &c. ; into a in ya matro, XIII, 6, if | gh into h in lahuka, XIII, 11. we must take it as equivalent to ya pamatra ; i into y in prayuhotave, 1, 1; raya (by the alu into 6 in kho (passim) and u in ku, IV, 9; side of raja), I, 1; al.; kamboya, V, 12;- into side iya into e in elukuye, x, 21; ayo into i in cha in vrachati, XIII, 10; oracheya, Vi, 16. tidasa, V, 11, if this is the correct reading, I which I strongly doubt; - va into w in the t is cerebralised into ! under the influence of an r-sound, whether vocalic or consonantal. participle absolute, and in chaturu, XIII, 9. The spelling, however, fluctuates. Not only As for examples of Hiatus like devanapriasa, ! does the classical appear side by side with the priadarsina I, 1; XIII. 1; ekatie, 1, 2; ia (hia) Praksit orthography, but we also find interV, 13; VI, 16; IX, 20; XI, 24, the resembl. mediate stages in which tbe r is retained in ance between a (l) and ya (ye) ha, is so close, writing, and often in an arbitrary fasbion. that it is perhaps still permissible to doubt Examples are, - prati becomes pati; but whether the reading is certainly correct. pratiresiyena, IX, 19; sampralipati, IV, 8; Nasalized Vowels. -- I believe that, consi. pratipajeya, XIV, 14 ; prativedetavo, VI, 14; dering the condition of the rock, it is just as palriredlaka, parrivedetu, VI, 14 ; parrivedetaro, impossible as it is at Girnar, or more so, to VI, 15; krita is written kilu, VI, 14; kata in attach here any definite significance to instances sukala, V, 11; kifra, II, 4; V, 11, 12; VII, in which the anusvara is omitted, especially 5; vyaprita is written va(viya)pala, passim ; as the last revisions have considerably reduced vyaputa, V, 13, and also viyapatra, ibid. I may the number. also quote vistrilena, XIV, 13; musXIII, 6, I shall have occasion, lower down, to draw and murs (P) XIII, 1. - t appears weakened to attention to the equivalence of ani and o final, d in hidasukhaye, V, 12, by the side of hita", the explanation of which still appears to me to ibid. be doubtful, although certain instances seem bh into h in aho (= athavd), IV, 8. really to indicate an actual phonetic pheno d into y in iyah for idari, nom. sing. neut. menon. A presumption favourable to this explanation might be drawn from the spolling dh into d in hida, 1, 1 = idha (?). alikasudaro for sano, XIII, 9. p into v in avatrapeyu, XIII, 8. As for the nominatives neater in e for ani, b into p in padhan, VII, 15. the concurrence of a number of masculine bh into h in the base hoti, by the side of bhoti, nominatives in e, only allows us to recognise bhavati. in them instances of Magadhisms, and not a I l into rin arabhati and its derivatives and in phonetic fact peculiar to the dialect of Kapur rochetu, XIII, 11. di Giri. So also in the cases of chature, XIII, v into y in yo for evan, if Dr. Buhler's 9, for chaturo, and rajani for rajano, equivalent analysis is correct (in IV, 9). to rajino, ibid., if, as I have considerable doubt, i into y in badaya, III, 5; IV, 10; -into the reading is really correct. As for ayi = in anusochanan, XIII, 2 ; samachariya, XIII, 8. ayant, VI, 16, the correct reading is very pro. sh into e in manusa, II, 4, 5 (by the side of bably ayo. manusha, XIII, 6); - into e in arabhiyisu, I, 2; (b). - Consonants. yesu, XIII, 4; abhisita, IV, 10 ; al. Simple Consonants. - In addition to the into in anusakanan, IV, 10; anusafisanti, obaracters of the alphabet of Girnar, Kapur di ibid. ; into sh in panchashu, III, 6 (cf. shashu Giri possesses, so far as regards consonants, below); - into h in hache (= sached), IX, 20. two poculiar signs, one for the cerebral and the Suppressions and Additions. - Loss of an other for the palatal sibila ut. I shall only note initial y in ava=yavat, passim ;-of a medial those instances in which their use does not h in ia, V, 13; VI, 16; IX, 20; XI, 24, if the correspond with that of Sansksit. reading is certain.
Page #16
--------------------------------------------------------------------------
________________ 10 THE INDIAN ANTIQUARY. Addition of a prosthetic h in hia, IX, 20; hida, XIII, 12; hediea, VIII, 17; of a vin vachati, XIII, 8, in vuta II, 5, if this reading (upta) should really be preferred to the reading rukha. Compound Consonants.kt becomes t abhisita, V, 11; &c. ky becomes k in sako = sakyash, XIII, 7. kr remains unchanged: parakramati, X, 22; &c. ksh becomes kh: samkhaye, XIV, 14; rukha (?), II, 5; khudrakena, X, 22; - and chh: mochhaye, V, 13; istridhiyachha, XII, 9; chhamitaviye, XIII, 7. khy becomes kh: mukhamute, XIII, 8. gr remains unchanged: agrabhuti, XIII, 4; &c. jn becomes i, except in the base anapeti, in which it becomes . jy becomes j: jotikamdhani, IV, 8. nj yields n in vananato, III, 7. tt becomes cerebralised into !, under the influence of an r-sound, in dharmavulam, XIII, 10; nivatiya, IX, 19. tth is written both th and th in uthana, VI, 15. tin becomes t in atadeg XII, passim. ty becomes regularly ch. The Sanskrit spelling is, however, preserved in ekatie (or elatiye), 1, 2; and it is changed into ti in paritijitu, X, 22, and also, perhaps, in the participle absolutive in ti, if it is to be analysed as equivalent to tya (by false analogy). tr remains unchanged, except in tidasa (or to) equivalent to trayodasa. [JANUARY, 1892. ts becomes a chikisa, II, 4, usatena, X, 22. ddh is cerebralised into dh under the influence of an r-sound: vudhi, IV, 10; vudhanash, VIII, 17. tv becomes t. I can hardly believe in the absolutely solitary example of a double tt in tadattaye X, 21, as read by Dr. Buhler. I ehould prefer to suggest the reading tadatraye, were I not much more disposed to think that it is simply tadalaye which we should read. Cf. satiyaputra, II, 4. dy becomes j. except in uyana, where it becomes y, VI, 14. In shashu, I do not think that the sh can be considered as representing the groups. We have here an instance of formation of the locative after the analogy of substantives. ndy becomes and in panda, XIII, 9. ny becomes in, except in ananiyam, VI, 16, patriredetu, VI, 14). in which it is written niya. dr remains unchanged in khudrakena, X, 22. dv, becomes d in diyadha, XIII, 1, and is resolved into duv in duvi, I, 3; II, 4; it is reduced to b in badaya, IV, 10. dhr remains unchanged: dhruva, I, 3; &c. nt, instead of the spelling it, appears, according to Dr. Buhler, to be written in in atikratnam, VIII, 17, and karotne, IX, 18. This is a detail which deserves verification. ndhr is written mdhr in andhra, XIII, 10. ny becomes : amna, IV, 9; &c. pt becomes t: nataro, IV, 9, &c. pn is resolved into pun: prapunati, XIII, 6. pr usually remains unchanged. Excluding doubtful cases, I, however, note pajupadane, IX, 18; papotra XIII, 11. We have already seen how extremely fluctuating is the spelling of prati: sometimes prati (pratiresiyena, XI, 24), but also pati (passim), prati (samampratipati, IX, 19), and patri (patricedaka, bih becomes dh: ladheshu, XIII, 8. br remains unchanged: brama na, passim. bhy becomes bh: arabhisanti, I, 3. bhr remains unchanged: bhratuna, IX, 19; al. my becomes m or sim: abhiramani, VIII, 17. The double m admitted by Dr. Buhler in me to be improbable. I prefer to read saman, samma, IX, 19; XI, 23; XIII, 5, appears to and to suggest that either saman is for samma, or that samyak has taken the form saman by analogy. mr becomes mib in tambapamni, II, 4. rg becomes g: sagam, VI, 16; or is written gr in vagrena, X, 22. rch becomes ch, with the r transposed to the preceding syllable, in vrachasi (= varchasi) VI, 14, if my analysis of the word is justified, and we should not understand "vratyasi. rn becomes sin in tambapasimi, XIII, 9. rt becomes (nuvafisanti, V, 11): sometimes written r! (kirti, written kitri, X, 21),
Page #17
--------------------------------------------------------------------------
________________ JANUARY, 1892.] THE INSCRIPTIONS OF PIYADASI. 11 or with transposition of the r to the preceding sh!r is written st in rastikunari, V, 12. syllable (kratava, I, 1); sometimes, also, t: shth is written th in oretha, IV, 10; th in kataro, XI, 24. tithe, IX, 20, adhithane, V, 13; and st in sresta, rth asually gives us thatha, passim), but I, 2, and tistiti, IV, 10. also th (athon, IX, 20; anatheshu v, 12), both shy becomes s in all futures: anapesariti, III. one and the other being sometimes written 7; &c. with r. thr (VI, 14; IX, 18) and thr (IV, 10). sk becomes k (and not kn) in jotikuidhani, Tthy is written thriya in nirathriyar, IX, 18. JV, 8. rih becomes dh : vadhisati, IV, 9; &c. st remains unchanged, whether written with rbh gives us bh with transposition of the r in the special sign to which Dr. Buhler appear's garbhagarasi (written grabhagarasi) VI, 14. to have correctly given its true value, or with rm remains unchanged, but with a transposi- the group st, as in suistuta, ix, 19. tion of r in writing: krama = karma; dhrama str remains unchanged: striyaka, IX. 18; dharma. The spelling dhrarma, IV, 8; X, istrio XII, 9: cf. also vistritena, XIV, 13. 7, marks the real character of this method of sth becomes th: chirathitika, V, 13; grahatha, riting. XIII, 4; and also th, graha! hani, XII, 1. ry becomes riy: ananitariyena, VI, 14; ein becomes o in all locatives in ani; but these sumachariyani, XIII, 8. forms do not properly belong to the language rv usually remains unchanged, with transposi- of Kapur di Giri. tion of the r either in the same syllable as - sy usually becomes e, as in the genitive in in savra, or to the syllable preceding, pruva, V, asa. But we find written siya as equivalent to 11: erava (?) VI, 11. But the spelling is not svat, IX, 20; al. are: savatra, 11, 5; V, 13 (several times); VI, sr remains unchanged : sahasrani, I, 2; &c. 14, 15, 16; VII, 1; XIII, 10 (several times); savuri, X, 22. sv is assimilated into o in sagani, VI, 16; samikena, IX, 19; and written sp in spusunani re remains unchanged with transposition of (V, 13), if the reading is renlly certain, and it the r: "drasi. is not simply a badly written sv. rsh is written sh in vasha, passim. It remains hem becomes m : bramana, passim. unchanged in prashanda, scil. parshanda, V, 12; VII, 2; XII, 1, 2. hy becomes h in mahai=mahyar, V, 11. rshy gives us sh in kashanti, v, 11. (c). - Sandhi. lp becomes p: krpa, V, 11 ; &c. A final an ustura is changed to m in evamera, ly becomes l in kalana, V, 11. XIII, 9; paratrikum era, XIII, 11. vy becomes either va (vasanan, XIII, 5; In compound words, I have noted :katata, VI, 15; vatava, XI, 24; &c.), or viya a elided before i : bramanibheshu, v, 12. (viyapatra, V, 13; pujetaviya, XII, 3), often in a combined with u into 6 : manuzopakari, the same words; or it becomes y in mrugaya, II, 5. VIII, 17, a elided before u: pajupadane, IX, 18. ech becomes ch (and not chl) in pacha, 1, 3; a elided after i : istridhiyachhu, XII, 9. XMI, 2. sy become siy in pratiresiyena, XI, 24. u combined with u into o: pasopakari, II, 5. ir usunlly remains unchanged (sueruska, 2. -- INFLEXION. passim); it is written sr in sresta, I, 2; srethu, (a). - Gender. IV, 10. Here, as at Girnar, the nominative singular shk becomes k: dukuranit, V, 11; dukafani, neuter of bases in a often ends in e, e. g. ibid. IV, 8: yadicani.....athutapurva tadise, shkr becomes kr : base nikrawali, passim. &c. Another example of the confusion of gender sh! becomes st in dipista, IV, 10, &c.; - appears in the plurals yutani, III, 7, and and th in atha = ashtu, XIII, 1. kulingani, XIII, 2 (if indeed it is thus that we
Page #18
--------------------------------------------------------------------------
________________ 12 THE INDIAN ANTIQUARY. JANUARY, 1892. T 17. should read). One is tempted to attribute to ally in &; but often also in asi, as in Magadhi : the same cause the not unfrequent use of the mahanasasi, L, 2; gananasi, III, 7; dharmadesinence 6 for an, dharmacharano, IV, 9; yutasi, V, 13; 8rodhanasi, &c. VI, 14; &e. praficedetavo, VI, 14, 15; katavo, IX, 18, 19; We find the locative in e written as weakened XI, 24; rataro, IX, 19; XI, 24 ; sako, XIII, 7; to i in bhagi anni, VIII, 17. pranatrayo, 1, 3, which I take as equvalent to Neuters. - The nominative singular ends pranatrayari; but the accusatives imi, IV, 9; in am, which is several times written /, as I anudivas8, 1, 2; iatabhago, XIII, 7, and, above have noted above. I have also pointed out the all, the nominative karotitori (for karanto) XI, frequent Magndhism of the nominative neuter 24; XII, 4, 6; (perhaps, also, shtoni = sunto, in e, which is sometimes written i, as in ghatiti, VI, 14); vo = evun (Buhler, in II, 5), appear XIV, 13. to shew that in these cases there is only a Feminines. The loc. sing. in aye: athasamechanical equivalence between the sounds o miranaye, VI, 15; parishaye, VI, 14. and ath. There is still, however, so, often used Bases in I. - Femininos. - Dat. sing. in (I, 2; IV, 7; &c.) as a particle, equivalent to iya : ayatiya, X, 21; nivutiya, IX, 19. - Instr. tad, and which cannot be explained as a sing. in iya: anusastiya, IV, 8. - abl. sing. mechanical substitute for toit. It only remains the same, tambaparimniya, XIII, 9. for us to see in it an arbitrary restitution from the Magadhi se, based on false analogy. Bases in U. Masculines. - Cf. bases in AR. (b). - Declension of Consonantal Bases. Feminines. - It is questionable whether Of this only a few traces survive. sadhu, III, 6, 7; IV, 10, represents the femiBases in AN. - Nom. sing. raja (raya), pag- nine, or whether it is not rather the nominative sim; gen. rano; instr. rarina, XIV, 13;- nom. neuter. plur. rajano, XIIL 9. I do not believe in the Neuters.- Nom. and acc. sing. in : bahu, reading rajani. IX, 18, &c. - Nom. plur. in uni : bahuni, I, 2. Bases in AR (RI).- Except the nom. plar. (d). - Declension of Pronouns. nataro, IV, 9; VI, 16, the other forms have adopted the vocalic declension, the bases in ar Demonstratives, &c. having gone over to the declension in : Anya. - Nom. sing. neut. : arinan, IV, 9; mituna, bhratuna, IX, 19; bhratunach, spasunatit, IX. 19. - Dat. sing. : annoye, III, 6; IX, V, 13; matapitushu, passim. 18. - Loc. sing. arini, VIII, 17. - Nom. plur. Bases in AS.- Acc. sing. yaso, x, 21. The masc. are, V, 13; al. loc. varchasi, VI, 14, can indifferently belong Ima. --- Nom. sing. fem. ayam, I, 1 ; al. I to the base varcha or the base varchas. Bhuye, have no hesitation in considering that ayi, VI, VIII, 17, is a Magadhism for bhuyo. 16, should be read ayo = ayoni; neuter, idari, Bases in IN. - Priyadarsin has gone over IV, 10; iyan, V, 13; XII, 2 (ivo); imanir, VI, to the declension in i : priyadaraisa, passim. I | 16; al. - Gen. sing. imisa, III, 6; IV, 10. - note, however, the instr. priyadarsina, IV, 10. Dr. Bubler considers that, iu VI, 16, we should We have also the nom. plur. hastino, IV, 8. read esha = echan. I donbt this. (c). - Declension of Vocalic Bases. Ekatya, - Nom. sing. masc. ekatie, I, 2. Bases in A. - Masculines. - Here, again, Eta. - Nom. sing. masc. eshe, XIII, 8; I only note such peculiarities as deserve atten- neut. &tam, IX, 19; X, 22; eshe, X, 22; perhaps tion. The nom. sing. regularly terminates in eta, I, 3. - Gen. sing. etisa, III, 6. - Dat. o, which appears to be weakened to u in sing. etaye, passim. - Gen. plur. &tesha, which likhapitu, I, 1; sometimes it takes the form in should probably be read &leshan, XIII, 5. &, the Magadhi termination (samaye, I, 2; Ka. - kichi, the nom. neut. is of frequent devanapriye, jane, X, 21; mukhamute vijaye, occurrence. - IX, 20, Dr. Bubler reads kesha, XIII, 8; Turamaye, XIII, 9), written i in amti. which he explains as the gen. plur. This kini, XIII, 9; sr@stamati, I, 2 - Dat, sing. aya passage should not, however, be considered as written more commonly aye -- loc. sing. usu having received its definitive analysis.
Page #19
--------------------------------------------------------------------------
________________ JANUARY, 1892.) THE INSCRIPTIONS OF PIYADASI. 13 Ta.- Nom. sing. masc., so, V, 11; al. - IX, 18, but I am very sceptical regarding this Nenter: tani, passim.-- so, frequently employed reading. Even the passive, as we have just as a particle, when it represents practically the seen, always takes the terminations of the sande form : I have already intimated above parasmaipadla. how this has come aboat. - Of the other cases, Potential. - As has its 3rd pers. sing. siya, it is sufficient to note tesha (teshan ?) XIII, 6. X, 22, al., which serves in one passage as base Ya. - Nom. sing. masc. yo, passim ; Fem. : of an anomalous ploral siyasu, XII, 7, by the ya, XIII, 7, 12, Neuter : yari, passim ; ye side of which appears also asu, XIII, 11. The IX, 18. - Gen. plur. yesha or yeshan, XIII, 3rd pers. plur., @yasu, instead of the usual eyr 5.- Loc. plur. yesu, XIII, 4. (sruneyu, XII, 7; avatrapey, XIII, 7) also Sarva. -- Nom. sing. neut. : sarva, XIV, 13. appears in hannneyasu, XIII, 8. The usoal - Acc. sing. masc. and neut. sarvara, VI, 14; formation of the singular is in eyani, eya; but VII, 2.- Nom. plur. masc. : sarve, VII, 1; the form in e (Skr. et) appears to have been al. - Loc. plur. : sarveshu, V. 13. retained in tithe, IX, 20, and prabhare, XIII, 7 Personal Pronouns. (which it does not appear to me to be possible to analyze as a locative). 1st person. - Nom. sing. ahant, passim. Gen. sing. me, V, 11; al.; maha (mahani) V, Past. - 3rd. pers. sing. nikerami, VIII, 17. 11. - instr. maya, VI, 15; al. - The last revisions have revealed the middle form dipista (Pali dipittha) IV, 10; V, 13; (e). - Declension of Numerals. VI, 16; XIII, 11, with a passive meaning. The Duvi, nom. I, 3; II, 4. 3rd plur. usually keeps the sh; nilramishu, Chature, nom. masc. XIII, 9. VIII, 17; manishu, XIII, 11 ; luchesh, IV, Panchashu, loc. III, 6. 10. We have, however, also, arabhiyisu, I, 2. Shashu, loc. of shat, XIII, 8. Abhavasi, VIII, 17, is an anomalous formaAlha, -ashtau, in composition, XIII, 1. tion, due to false analogy. It seems that the form of the numeral | Future. It is written everywhere in isati djective for twelve, was badaya, III, 5, and instead of ishati. We have, however, kaskati for thirteen, tidasa, V, 11. = kar(i)slyati, v, 11. It is doubtfal it achhariti, V, 11, onght to be classed as an 3.- CONJUGATION. irregular future of as. (a). - Verbal Bases. Participle Absolutive. - Usually formed in Save for phonetic modifications, these have, , tu, e. . brutu, XIII, 10, and the irregular in general, the usual forms. I only note the vijinitu, XIII, 2: in ye in samkhaye, XIV, 14. presents upahanti, XII, 6; prapunali for pra. It would appear that we have the termination punti, XIII, 6, and the participle praywhotave, ti in alochati, XIV, 14, and, if the reading will I, 1, with an irrogalar extension of the base of stand verification, in tistiti, IV, 10. I still the present. Aha is transferred to the present prefer to explain it, after the analogy of under the form ahati, never aha. paritijitu (X, 22) for paricha(tyajitu, as a In the passive, the formative affix ya follows contraction of tya, rather than as representthe ordinary rules in combination : haninanti, ing the vedic tvi, which Dr. Buhler sees in I, 3; arabhisarnti, I, 3; vuchati, XIII, 8. In arabhiyisu, I, 2, it is expanded into iya. Cf. Infinitive. - I note the infinitive forms anuvidhiyisanti, XIIL 10. dapakain and oravakarit, VI, 14. The causal formative affix, aya is usually contracted to e. Nevertheless, we have, VI, 14, Participles. - I find the following middle napayami, by the side of anapemi in the follow forms of the present participle : asamanasa. ing line. VI, 14 and vijinamani, XIII, 3. (b). - Terminations. The Future Participle Passive usually has According to Dr. Buhler, there survives one the termination taviya; but tava also occurs in example of the middle termination in karonte, kafavainatari, VI, 15. it.
Page #20
--------------------------------------------------------------------------
________________ THE INDIAN ANTIQUARY. (JANUARY, 1892: WEBER'S SACRED LITERATURE OF THE JAINS. TRANSLATED BY DR. HERBERT WEIR SMYTH. (Continued from Vol. XX. page 878.) XVII. The Afth upangam, sariyapannatti (sAryaprajnapti) bhagavati, in 20 puhudas (prabhirita) of which 1 has eight, 2 three, and 10 twenty-two subdivisions called puhadapibuda. This strange name pa huda is found beside here only in the puvva contained in the ditthivia. By the nse of this word a special connection between the ditthivaa and this upa nga is eo ipso rendered probable. Cf. also the direct statement in the introduction to up. 7. In discussing abga 3 I have remarked (p. 269) that its mention of a su apatinatti designated as angab&hira had reference to this upanga, though it could not be regarded as certain that the present form of this apange was thereby attested for that period. If it is doubtful whether the present form of this up. existed even at the date of the Nandi [402) in which the surapannatti also is enumerated among the anamgapa vittha texts; but there are two other texts enumerated together with (or immediately after) the strap., treating in all probability of the same subject, which are at present discussed in books I and 9 (see note 1, pages 406, 407). Perhaps the double mention of the surap. in Avasy. Nijj. 2, and 8 64, is to be referred still farther back, though it is still in dubio whether this mention refers to the present text or not. In the first of these passages, the author says of himself that, besides other texts, he desired to provide both the suriapannatti and the isibhasiya with a nijjutti. If tradition is correct, Bhadrabahusvamin is to be regarded as the speaker; and Malayagiri in the commencement of his comm. on uv. 5 makes especial mention of a lost niryukti of Bhadr. on the fifth uvanga. In the second passage both of the texts just mentioned are adduced together with the kaliasuam (the 11 avgas according to the schol.) and the ditthivaa as the four anuyogas, i. e. objects of study. In this passage the isibh. occupy the second place, the surap. the third, the ditthivaa the fourth. The surap. occupies here manifestly a very important position. The importance of the work is in fact very great, as is apparent from the thoroughgoing report I have made concerning is in Ind. Stud. X. 24 - 316. In it we find the most remarkable statements concerning the astronomy of the Jains arranged in a systematic form of presentation. [403] Apart from these most peculiar lucubrations, this account is of especial interest inasmuch as it displays remarkably close affiliations with the Vedic calendar-text called Jyotisham, with the Nakshatrakalpa and the parisishtas of the Atharva-Veda. The quinquennial yogam, sun and moon, and especially the 28 nakshatras, are placed in the foreground. The planets are known (Jupiter and Saturn with their periodic times), though they assert a very unimportant position and are not cited in the Greek order. There is no mention whatsoever of the zodiac. The 28 nakshatras begin withi Abhijit, and the yugam consequently begins with the summer and not with the winter sulstice. The libido novandi of the Jains, which has intentionally changed almost entirely everything which they enjoyed in common with the Buddhists or Brahmans, is here very apparent. In reality, the Jains are but tolerably fitted out with intellectual gifts. In order to conceal and compensate for this lack of originality they seek to possess something that is their individual property, and to attain this end they do not hesitate to indulge in the wildest dreams of fancy. In the province of astronomy they have viven full reins to their imagination. The polemical spirit, manifested especially in the surap. against other opinions (padivatti), proves that they are perfectly aware of the opposition between their own views and those generally accepted. The beginning of the nakshatras with Abhijit as the sign of the summer solstice, [404) which Malayagiri presumably refers back to Padaliptasurit (1. 1. 286), pre-supposes Asvini as the sign of the vernal equinox (1. c. pp. 304, 305). It is 1 In up. 6 - see p. 414- a division into vatthus is ascribed, as seems probable, to our text. The name vatthu at least recalls the purvas. ? isibhAsiy him is explained by the schol. here by uttaradhyayanidini; on 2, 6 by devendrastavkidini. See pages 259, 281, 429, 432, 442. * An imitation of this passage is the one quoted from Slanka on p. 258. 4 In the year Vira 437 according to the theravali of the Kharatarag. see Klatt, p. 23.
Page #21
--------------------------------------------------------------------------
________________ JANUARY, 1892.) SACRED LITERATURE OF THE JAINS. 15 based, therefore, upon the rectification of the old Krittika series, which had already taken place, and which upon occasion (see 20., 17) appears as the old traditional series. It is an open question whether Greek influence made itself felt in this rectification ; at any rate we have to deal here with an indigenous stage of Indian astronomy antecedent to the authoritative and preponderating influence of the Hellenes. It is probable, therefore, that the period opened up to us by these astronomical conceptions, is the period embracing the first few centuries of our era. G. Thibaut, in two treatises on the Suryaprajnapti in the Journal As. Soc. Beng. 1880, pp. 107-127, 181-206, has collected some facts of especial interest in this connection, facts which make for the connection of the contents of the Suryapr. with the corresponding statements in the Tcheou Pey, see Ed. Biot in the Journal Asiatique, 1841, pp. 592-639, the second part of which Biot holds to be not later than the second century A. D. Thibaut does not attempt any answer to the question whether or not there is here any historical connexion. If such a connection be proved, the Chinese must be regarded as the borrowers, through the medium of Buddhism, with which Jainism was frequently confused by the Chinese. The opposite opinion appears entirely removed from the domain of possibility by the actual facts of the case. [405] The text has been handed down to us contaminated by many corruptions. The numerous gathas contained in it often appear with entirely uninflected noun-forms (used in the nominative or accusative) in apabhramsa fashion. The nom. sing. of the first declension mostly ends in o and not in e. The numerals appear in a form that is excessively curtailed. If all these are peccata al origine, they are besides secondary corruptions of the text which are easily traceable. Several gathas stood originally at the end of several SS in Book l; the MSS. containing the express statement : attha .. gathan bhaaitavvau, but the words of the gathas have disappeared. Even Malayagiri is unable to restore them, since they were no longer extant when he wrote: samprati kva 'pi pustake na drisyarite, l. c. p. 266n. The text begins with the legend (and in fact in the customary formula : tenain kilenan) that Imdabhuti, at the time of king Jiyasattu in Milila, requested that he should be instructed by Mahav.) in ....., and then follows in 15 gathase a complete statement of the contents of the 20 or the 33 sub-divisions in books 1, 2, 10. The redaction is, therefore, the result of the activity of one individual. Books 10 and 15 close with the formula tti bemi, which we met with in the case of angas 1 - 3. Is it possible from this fact to conjecture (406] that originally they existed separntely, before the anthor incorporated them in his work P7 In I. 3 there is a reference in the text to the Jaribuddivapannatti which here in tarn cites our text. I lere reproduce from my treatise cited above a short statement of the contents : Book I. in 8 chapters, madalai, the circles traversed annually by the sun, viz. : - 1. vaddiivaddhi muluttinam, increase and decrease of the number of hours for day and night. 2. addhamamdalasamthit, the position (of the two suns) in the semicircle traversed by each daily. 3. ke te chinnam pariyarai ? how does one sun traverse the space traversed by the other?, and how great is this space ? 4. amtarar kim chara mti P in what intervening space do the two suns course ? 5. ogahai kevaiyam ? how great a surface does each dip into illuminate)? 6. kevaiyan vikampai ? how large a tract does each pass over every day? 7. mandala nam samthane, the figures of the orbits described by them. 8. vikkhambho, compass and extension of the revolutions of the sun. 51, states their number to be 140 ! & Seel. o. pp. 261, 273, 285. * See the next note and note 1, page 407. * mandalappaveso is enu nerated in the Nandi as a separate text. . See Colebrooke, Miscell. 2, 223, in reference to the two buns of the Jains, etc.
Page #22
--------------------------------------------------------------------------
________________ THE INDIAN ANTIQUARY. (JANUARY, 1892. Book II. in three chapters, tirichchha kim gachhai, how does the sun go sideways?, viz. : [407] 1. Eight different antagonistic opinions in reference to the rising and setting of the sun. 2. Of the passing of the sun from one circle to another, etc. 3. Of the speed of the sun's motion through each of its 184 circles. Book III. obhasai kevaiyam ? how much (space) is illuminated (by sun or moon) ? Book IV. Of the seya, svetati, the luminous body and field of illumination of the sun and - moon. Book V. Of the resistance which is met with by the light of the sun (20 different pratipattis). Book VI. Of the nature of the sun's light, and of the continuance of the power of its beams. Book VII. Who draws to himself (absorbs) the light of the sun ? Book VIII. Of the rising of the sun, or of both the suns, in Jambudvipa, and of the 4, 12, 42, 72 suns in the other dvipa. Book IX. Of the amount of shade in the different seasons.70 See Ind. Stud. 10, 284. Book X. in 22 chap. (about of the whole). Of the connection of the moon with the nakshatras, viz. : 1. &valiya, the order of succession of the 28 nakshatras beginning with Abhijit. 2. muhuttagge, the number of hours for the connection of each of the naksh, with the moon or with the sun. [408] 3. bhaga, the parts of the day or night (or of the heavens) which belong to each of the nakshatras. 4. jogasa, more exact statements in reference to the time of day in which the nakshatras some into conjanction with the moon and the length of this conjunction. 5. kulaim, the family connections of the naksh. with the months. 6. punnamisi, the days of the full moon; how and with which nakshatra these end during each of the five years of a yoga. 7. sanivae, the mutual harmonious concatenation of the days of the new and full moon. 8. samthii, figures of the naksh, 9. taraggam, number of stars of the naksh. 10. nota, leader, i. e. which naksh. lead which month? 11. chamdamaggam, relation of the nakshatras to the 15 day-circles of the moon. 12. devatana ya ajjhayane, the tutelary divinities of the nakshatras. 13. muhuttanam namayai, the names of the 30 muhurtas. 14. divasarai, the names of the 15 days and the 15 nights of the karmamasa, calendar month. 15. tihi, tithayah, ditto of the lanar month. 16. gotta, the families of the naksh. 17. bh@yankni, the foods which are good during each of the naksh-That the naksh. begin here with Ksittika (!), is due to the influence of the well-known material that is here treated of. 18. Aichchachara, course of the naksh.) with the sun or with the moon during the yoga. [409] 19. musa, names of the months of the world and those above the world (18kottara, chiefly of climatic contents). 19 poris mandalam is oited in Nandi as a separate text.
Page #23
--------------------------------------------------------------------------
________________ JANUARY, 1892.] SACRED LITERATURE OF THE JAINS. 72 20. pamcha samvachharai, the five years, viz. :1. the nakshatra year with 12 periodic months of 32744 rux@hapa. 2. the yoga year, lunar year of 3544} wux@hucpa. 3. the pamana (pra) year, of which there are five kinds. In addition to the two just mentioned, the pitu year (savana) of 360 vuxhuepa, the solar year of 366 vuxhepa, and the lunar leap-year of 3834 ruxonnepa. 4. the lakshana year, divided into the same five groups as above; there are, however, in addition certain requisites or characteristics. 5. the year of Saturn (30 years), during which Saturn completes his circuit though the 28 naksh. 21. jdisassa sayadarain, the gates of the nakshatras (in what quarter of the heavens they bring good fortune). 22. nakkhattavijal (vichayah), transit of the sun and moon through the 28 naksh. Book XI. Of the beginning of the five lunar years belonging to the yuga. Book XII. Of the five kinds of year, which were discussed in 10, 20 on pamanasamvatsara ; they receive a much fuller treatment here. Book XIII. Of the waxing and waning of the moon. Book XIV. When is moonlight the brightest ? Book XV. Of the rapidity of the five classes of constellations-son, moon, planets, naksh. and tara. - According to Leumann cf. also Jiv. 4, 31, 19. [410] Book XVI. Of the properties of moonlight. Book XVII. Of the fall (passing away) and uvavaya (resurrection) of the genii of the moon, sun, etc. Book XVIII. Of the height of the constellations above, and their distance from, the earth - cf. Jiv. 4, 31, 3 (L.) Book XIX. Of the number of the suns, etc., in Jambudvipa, etc.; cf. Jiv. 4, 16, 17, 1. 20, 6. 10. 16 21 (L.) Book XX. Of the nature and substance of the five classes of constellations. There is a commentary by Malayagiri. XVIII. The sixth upangam, the Janbuddivapannatti. We have seen (above p. 268) that in the third anga 4, 11 a work of this name was cited, if not as upanga, at least as angabahira. In that anga we find the same minute division of time which we meet with here; hence the existence of this upanga is assured even if its present form is different from that then in vogue. In our text upon a definite occasion there is a special reference to up. 5 and ap. 7, each of which in turn cites our upanga. It is, therefore, probable that these works are synchronistic, sopposing that the citations in this instance are not, as usually the case, the work of the redactor. The legendary introduction to this upanga is wholly identical with that which commences [411] upangas 5 and 7, - upangas which are connected by a very close tie. This introduction is inserted between upangas 5 and 7 in a very remarkable manner. Our up. is, however, different from these, in that, like angas 1-3, it concludes with the formula ti bemi, which, it must however, be confessed, is found at the end at least of books 10, 15 ; see p. 405. There are no sub-divisions in the text itself, whence the Vidhiprapa calls it egasara. The commentary, however, recognizes seven sections which it calls by the strange title of vakbhaskara 13 11 In 8, 1, however, only the titles of up gas 7. 5 (and the title of a part of ap. ) aro mentioned. The title of our up. finds there no mention whatsoever. 13 This recurs e. g. in Hemahansa's nykyamarijdah. .
Page #24
--------------------------------------------------------------------------
________________ 18 THE INDIAN ANTIQUARY. [JANUARY, 1892. The mythical geography of Jambuddiva, interfased with many legends, forms the contents of this upanga. The chief part of the whole - concerns the description of the seven vasas (varsha) and of the six vasaharas (varshadhara). The description of Bharaha vasa which is placed in the fore-front comprises at least of the entire account. The legends of king Bharata, from whom it takes its name, claim a good half of the entire section. The detailed account of Bharaha vasa in the different gradations of the past and present (in all 4), and in the future (in all 8), is preceded by a minute description of the divisions of time and extent; of which we have already in anga 3) met the first, from kvaliya to sisapaheliye (or to usappini) - see above, p. 268. One difference is, however, noticeable :- Heres the increase is by hundreds after the willennium, [412] after 100,000 years by 84's (chaurasitivasasayasahassaim se ege puvvamge), und from this point on by 8,400,000 (chaurasitipuv vamgasaya ... bahassaim se ege puvve); in anga 3, however, we find no more exact statement in reference to the manner of the progressions (vasakodi 'ti va, pavvanga ti va, pavva ti va). As the result of the above we may observe one divergence as regards up. 5, where in book VI. (see Ind. Stud. 10, 22), the word puvva occurred in the signification of a million years, and the increase from that point on (without any special mention of the names in question) simply passing by palidvama and sagardvama, up to osappini, merely by 10's. The eno meration of the 72 kalas in a legend of Usabha is not mentioned in detail; its beginning and end alone being mentioned. The women of the foreign peoples known to us from the Bhagavati - see p. 302 - are enumerated as servants of king Bharaha: - Tate nam tassa Bharahassa ranno bahuo khuyyal6-Chilati-vamani-vaqabhid Babbari-Vausiya8 Joniya-Palhaviyao, Isiniya-Tharuniya (Tharukinia, Charubbasiya) Lasiya Lausiya Damilf Sthali taha Aravi Pulimdi ya Pakvani Vabali Marumdi [413](Mura', Muro) Savarid Parasid ya appigatiyad chamdanakalasahatthayayao.. According to the commentary, the first four vaksbaskaras treat of the following subjects :The first, of the Bharatakshetrasvarupam; the second, of its special relations during the 14 temporal divisions, Bharatakshetrasvarupavarnanaprastavanagatavasarpiny-utsarpiridvayarupakalachakravarnano nama; the third, of the legends concerning king Bharata, BharatakshetrapravsittinimittavirbhivaBharatachakricharitrav. nama; the fourth, of the remaining 6 vasas, or 6 vasaharas, 16 kshudra Himavadadivarsbadbarairavatamtavarshavarnano nama. The fifth treats, in legendary form, of the birth and consecration of a tirthakrit, tirthaksijjanmabhishekadhikarav. The sixth, unfortunately, gives but a very short review of the divisions, extent, mountains, temples, lakes, rivers, etc., of Jambudvipa, Jambudvipagatapadarthasamgrahav.17 The seventh deals with astrological and chronological matters, jyotishkadhikarav., and especially with the number, etc., of the moons, suns and stars in Janbudvipa. Herein it is in very close agreement with the surapannatti and chandapannatti, both of which are cited at the end. The answer to the questions under consideration found at the end is based chiefly upon the discussion : pamchamasue padhame uddesae, by which (414) Bhagavati 5, 1 is doubtless meant. It 15 So also in the Anuyngadvarastra, Bee Bhag. 1, 427. See Ind. Stud. 13, 108. Ind. Streifen, 3, 3. Pafchadandachhattrapr. p. 17 in reference to the customary une of the number 84. 14 According to the scholiast, we must assume that the relations of modality in anga 3 are identical with those here :- purvini parvingAny eva chaturavitivarsbalaksheg upitani; purvani chaturabftilakshagunitani trufitangani bhavainti... 15 kubjah kubjika vakrajanghah, Chilstyah chilatade otpannab, v manjki atyamtabrasvonnatahridayakoshthard, valabhika madahakoshth vadha(vakradbah ?)kaya va; bakubadedajah; isinikah tharukinik Ah; Ilsakadebajah, lakubadosajab; tatra childty Adayo 'ohtadasa tattaddebodbhavatvena tattannamika jneyah, kubj&dayas tu tisro viseshanabhatab; see Leumann in the glossary to the Aup. 16 Then follows: 3. The mountain (visa harapavval) challa Himavaate, 3. in Hemavde vloe, . mount mahaHimavarite, 5. in Harivase v&ae, . mount Nisaha, 7. in Mahavidehe vlad, 8. mount Nelayamte, in Ramme vel, 10. mount Rappl (Rukmin), 11. in Hirannavde vlee, 13. mount Sihart (Bikharin), 19, in Erdve vaad. 17 24 leaves (751 to 77) in a MS. of the text embracing 95 leaves, of which the fifth section embraces 664 to 75b. A gabA, which summarizes the contenta, forms the introduction. This gfhf is at the head of a sataghayani in 29 Cry composed in very froe Prakrit, by Haribhadras Ori. Soo above, pp. 371, 372.
Page #25
--------------------------------------------------------------------------
________________ JANUARY, 1892.] SACRED LITERATURE OF THE JAINS. 19 closes in treating of the sun: ichchesa Jambuddivapannatti surapannattivatthusamasenam samatta bhavati. Then, in close conjunction with the above, it, in like manner, treats of the moon, and concludes : ichch esa Jaotti chandapannattivatthusamasenam s. bh. The expression vatthu, which occurs here twice, belongs to the puvva sections -- see page 361. It does not occur in the existing texts of upangas 5 and 7, which are divided into pabudas, a term which, it must be confessed, is similar to the purvas. Next follows a discussion in reference to the five different kinds of year (see above p. 409), viz. : -1. The nakk hatta year and by this is meant the revolution of Jupiter through the 28 nakshatras ;18 in up. 5 (see Ind. Stud, 10, 290), this is cited merely as a pakshamtaram. 2. The lunar yuga year. 3. The pamana year with its five groups as in ap. 5. 4. The lakkhana year in five groups. The scholiast says that in the first of the five, the nakshatra year, the commencement is made with Krittika and not with Abhijit! The scholiast on up. 5 at least makes mention of Uttarishadhas - cf. Ind. Stud. 10, 301, note 7. 5. The year of Satorn or its revolution through the 28 nakshatras. Then follow the months, days, hours and the karana, which last was omitted in up. 5. The fourth karanam is here called thiviloana, strivilochana, or tbiloana (80 also in the Ganiviyya v. 42) and not taitila. The names are as usual: - Bavam balave kolavam thiviloanam (415) garai vaoijam vitthi (these 7 are chara) sauni chauppaya na gam kimtthuggham (these 4 are thira). The beginning with Bava is the one which usually occurs elsewhere; but in the quinquennial yugam, contrary to other statements, everything has been changed. Of the two ayanas the summer solstice is in the first place, the rainy season is first among the seasons, Savana (Sravana) first among the months, the bahulap. among the pakkha, the day among the ahoratta, and Abhijit among the nakshatras. Then follows a special discussion of the nakshatras, - their position as regards the moon, their divinities, the number of their stars, their gotta, their form, etc., just as in the Nakshatrakalpa or in upanga 5; and partly in the form of gaha. The names of the nakshatras appear here in their secondary form as in up. 5, in anga 3 -- see Ind. Stud. 10, 296, and above p. 268:- Savana (instead of 'Srona), Dharitha (instead of 'Sravishtha), Bhaddavaya (instead of Proshthapada), Pussa (instead of Tisbya). The conclusion is formed by all sorts of remarkable statements in reference to sun, moon, stars, the extent of their vimana, etc.; Mars (ingalae viyalae lohitamke) and Saturn (sanichhard) are regarded as belonging to the court of the moon; cf. Bhagavati 1, 401. 2, 225. Jupiter was referred to above; but there is no mention of Mercury, Venus, and the zodiac. The commentary is by Santichandra, scholar of Sakalachandra, who lived at the time of the 58th patriarch of the Tapagachha, Hiravijayasuri (+ Samvat 1652), recognized by srt-Akabbarasuratrana (Sultan). This commentaryle is very verbose, but in the introduction it contains numerous matters of interest in reference to the relations of each of the [416] 12 upangas to that one of the angas which had a corresponding position among the series of twelve, and in reference to the commentaries thereupon - Silamkachurya (on angas 1. 2), Abhayadeva (on angas 3-11 and up. 1), Malayagiri (on up. 2 - 7), Chandrasuri (on up. 8 - 12), and finally - see above p. 224 -- in reference to the period of advancement suitable for the study of each of the angas. The full statement in reference to the mutual relation of the angas and upangas is: - tatra 'rgani dvidasa, upamgany api amgaikadesaprapamcharupani priyah pratyamgam ekaikabha vat tavamty eva, tatra 'ringa ny acharamgadini pratitani, tesham upamgani kramena 'muni: acharangasyau "papatikam i, sutrakpidamgasya rajaprasniyam 2 sthanamgasya jivabhigamah 3, samavayangasya prajnapani 4, bhagavatyah suryaprajnaptih 6, jnatadharmakatham. gasya jambudvipaprajnaptih 6, upasakadasamgasya chandraprajnaptih 7, .amtakriddasamgadikanam drishtivadaparyamtanam pamchanam apy amganin nirayavalikasrutaskamdhagatakalpikadipamchavargah pamcho 'pamgani, tatha hi: aritaksiddasaingasya kalpika 8, anuttaropapatika 15 janvi vahassat mahaggahe duvalasahin sarvachharihim savvanakkhattama dalam satchArci se tam nakkhattasamvacbbare. 19 The date of its composition is Sathyat 1661 (A. D. 1595); the work was, however, revised for Vijayasena nine years later
Page #26
--------------------------------------------------------------------------
________________ 20 THE INDIAN ANTIQUARY. (JANUARY, 1892 dasam gasya kalpavatamsika 9, prasnavyakaranasya pushpita 10, vipakafrutasya pushpachulika 11, drishtivadasya Vrishnidasa 12, iti. XIX. The seventh upamgam, chamdapannatti. We have, before, frequently observed that a text of this name is twice cited in anga 3, and in conjunction with texts whose titles belong to upangas 5, 6, or to a portion of up. 3; that the order of succession of the titles in anga 3 (7,5, 6) does not agree with the present position of these texts, viz. the title of the chamdapannatti is there, and, in fact, in both the passages which concern this matter, placed before the others. The chamdapannatti is cited in the text of up. 6, as before remarked. [417] Taking these facts into consideration, it is in the higbest degree remarkable that the existing text is almost completely identical with that of up. 5, differing from it, for example, in about the same way as the two schools of the white Yajus differ from each other. The introduction is, however, quite different. The beginning consists of 4 arya strophes, of which 1 and 2 sing the praises of Vira etc.; v. 3 characterizes the work in the same words as are found in up. 4, introd. v. 3 and 5, 1. e. as pavvasuyasaranisamdam - seo p. 394 - and v. 4 traces back the joisara yapannatti to the questions of Gotama Indabbuti. Then follow upon these four strophes the same 15 verses in an interrogatory tone, which in up. 5, too, state the contents of the 20 separate divisions (pahuda) and subdivisions pahudapahuda. From this we can draw the conclusion that there is complete identity of subject and method of treatment. The legendary introduction, which refers the whole to a conversation between Mahavira and Indrabhuti, follows upon these 15 verses, and displays a few minor differences. From this point on, the text is similar to, and in fact, almost identical with, that of up. 5, with the exception of a few linguistic (e. g. rai, night, for rayani, ratani, rajani) and stylistic differences. Our text is, here and there, somewhat briefer, which is compensated for by references to up. 3 and 6, which are lacking in up. 5. An exact comparison of the text of each will doubtless disclose many matters of difference between the two. Nevertheless, the inter-relation of the two is a fact, the remarkable character of which [418] is enhanced when we consider that Malayagiri composed a special commentary on this upanga also, which was cssentially the same as that composed by him on up. 5, and that in neither of his commentaries does he say anything in reference to the mutual relation of both texts and commentaries. (The statement just made appears to be correct, though I have not made here an examination of Malayagiri's com, ad amussim). Until new facts come to light that will solve this mystery, we must be content to accept the present situation. In the passage in up. 6 in which up, 5 and 7 are citud -- see above, p. 414 - the text reads as if the first had reference solely to the sun, the second solely to the moon. Our texts of up. 5 and 7, however, treat both uniformly and in a completely similar manner. XX.- XXIV. The eighth to the twelfth upamgas, nirayavaliyao, nirayavalikas. Under this collective name are comprised five small texts of legendary contents (vaggas) in one " srutaskandha." The first of these either bas the special title of "srutaskandha," or is called kappiyao, kalpikas. The titles of the others are kappa vadamsiya6, pupphiyao, pupphachuliyad or chalao, Vanhidasad. Each of the first four has 10, the fifth 12 ajjhayanas.20 In the introduction to the first, all these five texts are characterized - see 372, 373 - As uvamganam pamcha vagga. We have seen above that this epithet recurs in the interior of no other one of the texts held to be upangas. [419] It must, therefore, be deemed a probable supposition, if we assert that this epithet at the time of the composition of these five texts was restricted to them alone in their totality since they belonged together from the very beginning. Their present position at the end of the 12 upangas is to be explained by their legendary contents, which shows them to be perfectly adapted to serve as a pendant to the Avi, and Svi.: amtagnadasAdipanchanham amganam niraykvaliy-sunkkhandha uvamgan, tammi pancha vagga : kappiy ko kappavadamsiylo pupphiy do pupphachdliya vanhidasdo, chaugu dasa aijhayans, pamchame berasa.
Page #27
--------------------------------------------------------------------------
________________ JANUARY, 1892.] SACRED LITERATURE OF THE JAINS. 21 legendary texts of angas 7-11;21 and tradition has see pp. 373, 416 brought them into connection with these auga texts and especially with 8-12. They share with these not merely the common form of legendary introduction; they are referred back to Sudharman and Jambu; they have the names ukkheva and nikheva, usual in the customary introductory and concluding formule; they shew the division of each into ten ajjhayanas, and lastly they have the same form of the citation of a text, i. e. the first ajjh. only is quoted entire, and the catch-words suffice for those that follow. We may well call them an appendix bound to angas 7-11 by a very close tie. Their interconnection is, furthermore, attested by external evidence: Their names are placed together in the enumeration of the anangapavittha texts in the Nandi, though the order of succession varies somewhat, the series there being 20, 22, 21, 23, 24, while between 20 and 22, as a separate text, the kappiyao are inserted, which in the Vidhiprapa, [420] as in 'Santichandra on up. 6, see p. 416, appear merely as the name of the first of these 5 upangas. In the scholiast on the Nandi, however, and in the Nandi itself they are regarded as an independent text existing by the side of the other five: narakavasas tadgaminas cha nara yatra varnyamte; kalpikah saudharmadikalpavaktavyatagochara gramthapaddhatayal; evam kalpavatamsika jneyah; yas tu grihavasamukulana (!) tyagena jivah samyamabhavapushpita bhushita bhuyas tattyagato duhkhavaptimukulena mukulitas tattyagatal pushpitah pratipadyamte tal pushpitab; tad viseshapratipadikah pushpachudah; Amdhaka-Vrishnidasanam siddhigamanadila kshaganim pratipadaki gramthapaddhatayal. -- In the account of Raj. Lala Mitra, 1. c. (above, p. 227), there is no mention of the Vanhidasao, nirayavali and kappiya are enumerated as two separate upangas (8 and 9), and Kappavadimsaya, Pupphiya, Pupphachuliya as Nos. 10-12. In Kashinath Kunte's report the order is nirayavalika, Vanhidasa, Kappavadimsiya, Pupphiya, Papphachuliya. It must, furthermore, be noticed that Abhayade va on anga 3, 10 is of the opinion that several of the 10 ajjh. of the dihadasa cited there are especially closely connected with the narakavalisrutaskandha see pp. 273, 423". If this is the case, it supports the probability that the contents is of ancient date, which is indeed great on other grounds. The relation of the five extant texts is as follows: - XX. up. 8, uvamganam padhame vagge, the nirayavaliyad, or kappiyao, treats of the ultimate fortunes of the ten princes Kala etc.,22 sons [421] of the Anga king Seniya of Champa. These princes accompanied their half-brother Kuniya33 in his campaign against his grandfather, Chedaga of Vesili, the Videha king, who refused to deliver up the own brother of Kuniya who had fled to his court. Kuniya on this account had declared war against Chedaga, who, in order to meet the impending danger, summoned nine Mallati (Mallaki) and nine Lechhati (Lichchhavi) kings and all 48 Kasi-Kosalaya ganarayano (cf. Bhagav. 7, 9, p. 301), and opposed 57,000 elephants, etc., to the 33,000 of the eleven princes (3,000 for each). The mothers of the ten princes, Kali, etc. (see anga 8, above, p. 321), each ask in turn of Mahavira whether they are destined to behold their sons alive again. Mahavira in reply not only informs Imdabhuti into what hell each must descend after he has fallen in the battle hence the title of the upamga and his future fate, but also relates the antecedent history of king Kuniya himself, beginning at that point when his mother was three months pregnant. The expulsion of his father Seniya from the throne at his hands is then related and his father's death in prison. We possess in its complete form the text of the first ajjh. alone, the second being finished off in six, the remaining eight in two lines. The reader is referred to Jacobi's introduction to the kalpas. p. 2 for Seniya Bhimbhisara,25 i. e. 21 As regards anga 10 I have mentioned on page 329 my conjecture that from the inter relation of up. 8-12 and angas 7-11 we have additional testimony for the view that anga 10 too originally possessed a legendary character. See, however, p. 334 n.1 22 Kale, Sukale, Mahakale, Kaphe, Sukanhe, Mahakanhe, Virakanhe, Rimakanhe, Piusepakanhe, Mahfaepakanhe. 25 Son of Chellana, wife of Paumaval. Stepmothers, chullamaus, of Kania. 25 See ajjh. 10 of the daaaarutaskandha.
Page #28
--------------------------------------------------------------------------
________________ 22 THE INDIAN ANTIQUARY. (JANUARY, 1892. Srenika Bimbisara, and his son Kuniya Bambhasaraputta, 26 1. e. Ajatasatro, [422 ]contemporaries of Buddha, and also in reference to the synchronistic conclusions which may be drawn in reference to Mahavira. It is placed beyond the shadow of a doubt, that the Bauddhas and the Jainas possess herein a common heritage, and that genuine historical traditions form the foundation of the recital. Whether it is necessary to separate Mahevira from Buddha is another question - cf. Bhagav. 1, "a. The traditional connection of Mahavira with Natiputta, Buddha's opponent, can also be regarded as the result - cf. p. 240 - of an intentional variation caused by'sectarian hatred. The Nirayavali has been edited by S. Warren, Antwerp, 1879, on which see H. Jacobi in Journ. Germ. Orient. Soc. 34, 178 ff. There is a commentary by Chandrasuri The enumeration of the women of non-Aryan peoples, 27 distinguished in the text merely by vahuhin khuyyahim java, is quoted by Chandrasuri in the same form which we meet with in Bhag. 9, s (see p. 302), etc. The citation jaha Chittd tti, points to up. (2), jaha Pabhavati to aiiga 5, 11. XXI. ap. 9. varga 2, kappAvadamsiau, kalpavatamsikah, treats of the ten song of prince Kala, etc., all of whom were converted to asceticism, as 'were their grandmothers Kali etc., and who 5423 reached their respective heavens.29 The account consists almost entirely of mere catchwords or of references. Emphasis is often laid upon the study of the samkia-m-adikim ekkarasa amgaim. XXII. up. 10. varga 3, pupphiau, pushpikah (or oth), treats, with reference to up. 2, of the teri gods or goddesses30 who came from their heavenly world891 to pay reverence to Mahavira, who therenpon tells to Goyama their previous history. They were in a former birth all turned or converted to the study of the samkia-m-adikim ekkarasa amgain, either by the arhant Pasa or by the Ayya Suvvata or by the thera bhagavato (see up. 3). These former births, as mahana, gahavati, satthavaha etc., occurred in Savatthi, Vandrasi (!), Manivaca, Vendayana, Mihila, Hatthinapura, Kakandi. The enumeration of the Brahmanical sciences here is similar to that in the Bhagavati (above, p. 303); and their names are similarly explained by the scholiast. XXIII. up. 11, varga 4, pupphachalad, pushpachadas;" ten other histories of a similar nature. We possess the first alone, the Bhata naman daria, former birth of the Siridevi, 33 is brought by Pisa to believe in the niggamtham pa vayanam. The other histories have entirely disappeared with the exception of the names, [424] which are found in the gaba in the introduction; the goddesses (not gods) who are here mentioned are for the most part mere personifications of ethical qualities. XXIV. up. 12. varga 5, Vanhidasko, Vrishaidabas, in 12 ajjhayanas; 12 similar histories, of which we possess none but the first, the mere dames by which the others were called having been >> See introduction to up. 2. More exact information in reference to his history is found in the scholiast or Avaby. 18, 144, cf. Bhag. 7, 9 (Leumann). 27 kubjik Abhib vakrajaroghAbhih, chilatibhir anaryadekotpannibhib, vamanAbhir hrasvabarirAbhih vadabhabhi madahakoshthAbhih, Varvaribhir Varvarad busarbbavabhih, Vakukikabhih Yonakabhih PaphavikAbhib Isinikabhih Charukinik Abhih Lasikabhih Dravidibhih Rixhhaltbhih Aravibhih Pakvapibhib Vahalibhih Murundibhib Bavarlbhib Parasibhih nanadosAbhir vahuvidhiniryapriyadehotpannibhih; cf. p. 412. 3 Paume, Mahapaume, Bhadde, Subhadde, Mahabhadde, Paumabhadde, Paumasene, Parimagummi, Nallipigomme, Anande, Naradan (but this makes 11 names! Is one to be referred to a son of Kuniya ) * Seated in the Kalpavatangaka Vimina, Kashinath K. * Chazde joisinde, SurA, Sukke, mahagahe (planet Venos), Bahuputtia, Pannabhadde, Mapibhadde, Datte, Sive, Bale, Anadhita; four of these names, see p. 273, among those of the afhadaagu. #1 Seated in the celestial chariot (Pushpaka), Kashinath. 52 Contains an account of the female disciple of Mahavira Svami, named Pashpachhala, and of her female attendant, Kashinath. * See p. 273 n. * siri, hiri, dhiti, kitthi, vuddhi, lajja, il devi, sur& devi, sarussal devl, gardhadevi; - The Siridevi comes to honor Mah&vira .. jab Bahuputti.
Page #29
--------------------------------------------------------------------------
________________ JANUARY, 1892.] FOLKLORE IN SALSETTE; No. 11. 28 preserved.35 The conversion of twelve princes of the race of Vrishni is here treated of as having ensued throngh the influence of the arhan Aritthanemi. The first history deals with Nisadha, son of Baladeve, nephew of king Kanha-Vasudeva in Baravati.36 In his former birth he was converted or turned to the study of the samaia-m-Adiai ekkarasa amgain by the Siddhatthanamam dyariya. A prophecy in reference to his future birth is added to the above recital. At the end the five texts are again called the "avamgani" or the 5 vargas of one srutaskandba: nirayavaliasutakkhandho samatto, samattani a uvamgani, nirayavalid-uvamge nam ego suakkhandho pamcha vagga pamchasu divasesu uddissamti. This last statement in reference to the number of days which are necessary to teach or to recite them, is found (425) in exactly the same form in the corresponding angas - see p. 280. The three samiyaris, contain detailed statements in reference to each. The historical value of these legends is, apart from the traditions contained in ap. 8, without doubt very slight indeed. The largest portion of their contents is as purely fictitions as was the case in anga 6 fg. (see p. 338). Nevertheless, since they contain information (e. g. in respect to the activity of Pasa, which preceded that of Mabavira), we may claim for them a value as regards our estimation of the relations ander which we have to consider the life and works of Mahavira. We have seen above that the uniformity of the contents, and the homogeneous method of treating it in all the five texts, make for the conclusion that they originally formed but one text. Tradition calls them merely the five parts of one srutaskandha. Their enumeration as five separate texts was caused by the desire to have the number of the uvamgas correspond to that of the angas. The fact is that the special limitation of the number of the angas to eleven, which is found in av. 8-12, must be regarded as a strange contradiction of the desire to assimi. late the number of the uvamgas to that of the angas. The title vagga belongs also to angas 6 and 8, as an appendix or supplement to the latter of which two, these five texts may have come into existence. The history of the first vagga here (uv. 8-12) is, to a certain extent, an elucidatory supplement to the last of the vaggas there, i. e. in anga 8. FOLKLORE IN SALSETTE. BY GEO. FA D'PENHA. No. 11. - Francis and his Uncle. There was an old woman who had an only son, called Francis. They were in rather poor circumstances, and lived on what the old woman earned during the day. Francis had a maternal uncle, who was very rich and possessed much land and severdi bullocks and cows. One day, when the boy was old enough, his maternal uncle called on his sister, and asked her to send the lad to take his cattle to graze, promising to give him something as pay. His sister told him that the boy was mischievous, and said he had better ask him himself to agree to the proposal. His uncle, therefore, called the boy, and said to him :-"Francis, will you come and take my cattle to graze every day? I will give you something in return." "Yes, I will come," said Francis. "Will yon give me a cow as pay, uncle ?" His uncle promised to give him a cow, and Francis went daily and took his uncle's cattle to graze. Every day Francis asked for his cow, but his uncle put him off, saying : "I will give you one to-morrow." * Nisadhe, MahAnisadhe, Anigahe, Vede, Pagati, Jutti, Dasarahe, Dadharah, MahAdhapa, Sattadhana, Dasar dhand, Sayadhana, . At the head of 10 DasATA : Samuddavijaya eto., 5 Mahavira Baladera eto., 16,000 kings: Uggasepa eto., 31 koti of kumara : Payyunna eto., 60,000 duddarlita (P) : Sambaya eto., 21,000 vira : Virasina etc., 16,000 devi: Ruppini, sto., and many thousand gani: Apargna A oto. The same court is found according to Leumann in adga 6, D. 526, 1231, and adga 8, 1. 1 The original is Farantia, a familiar local form of Francis.
Page #30
--------------------------------------------------------------------------
________________ 24 THE INDIAN ANTIQUARY. (JANUARY, 1892. After several days, the uncle, finding Francis importunate, one day said to him :- "There are a lot of cows here, you can choose one for yourself." Upon this Francis chose a cow for himself, and every day fed her with half of his own rations, which made her grow plump and fat. Now bis uncle observed that, while his own cattle remained as before, Francis' cow was growing fat and beat them all in beauty. He soon became jealous, and considered how he might deprive the lad of his cow. So one evening he came and said to him:-"Well, Francis, my boy, I'll give you a holiday to-morrow, and I will look after the cattle myself." Bat Francis said :-"No, uncle, I don't care for a holiday. I will be at my usual work." His uncle, however, pressed him much, saying :- "Francis, you are yet a child, and you require some rest. So listen to me and take a holiday." So Francis was at last persuaded to take a holiday, but he asked his uncle to take care of his cow, which, of course, his uncle promised to do. In the morning the uncle took his cattle for grazing, as also Francis' cow. While his cattle were grazing he drove the cow up a high mountain and from there threw her into the river below, and the cow died at once, and the uncle was satisfied, and taking his own cattle he came home in the evening. The following day, as soon as Francis arose, he went as usual to his daily work, but to his astonishment found his cow missing. He ran to his uncle and asked him where his cow was, His uncle said :-"Look in the stalls; she must be somewhere among the other cattle." Francis went to the stalls and searched among all the cattle, but in vain, and therefore suspected foul phy. Instead of taking his uncle's cattle to graze, he left them in the stalls, and went all over the forests in quest of his own cow. He searched and searched, and, at last, found the carcass of his cow in the river. Poor Francis sat down by the poor cow and cried for hours and hours, but he made sure that the death of the cow was due to nothing else than his uncle's envy. Seeing that crying would not bring his cow back to life, he made up his mind to skin the cow, so that the skin might some day be of use to him. So he at once set to work, and, dragging the carcass to the bank of the river, skinned it and dried it in the sun for several days. When the skin was thoroughly dried, he asked his mother one day to bake him three or four hand-cakes, but she said: "There is scarcely flour enough to make one cake ; and how am. I to bake three or fonr for you?" Francis, however, bothered her so often that his mother went and begged some rice-flour, aud baked four cakes, and gave them to him. Francis tied up the cakes in a kerchief, and, taking the cow's skin, went away. He walked on and on, uncertain where to go, or what to do, for a whole day, and when it was dusk he found himself in a large forest, and here he meant to pass the night; but being afraid that some wild beast might see and devour him, he climbed up a high treo, not forgetting to take the skin also with him. At dead of night it happened that some robbers, who had plundered a rich house, came and sat under that very tree, and, having thrown down their booty, began to divide it, and to quarrel between themselves. Said one: -"I deserve the greatest share because I shewed yon the house." "No, no," said a second; "I entered the house first, while you remained outside, and so the biggest share falls to my lot." And so they went on quarrelling, till our hero got so frightened that he let fall the cow's hide from the tree, which made such a noise, and in its turn so frightened the robbers, that they left everything and took to their heels, thinking some evil spirits had seen them and were coming on them.
Page #31
--------------------------------------------------------------------------
________________ JANUARY, 1892.] FOLKLORE IN SALSETTE: No. 11. Our hero, when he saw the robbers had run away, came down, took all the treasure the robbers had left, and went home in high spirits. When he reached his hut, he told his mother to go to her brother's house, and ask for the loan of his phara ani danda (basket and spade). His mother told him to go himself; but Francis pleaded, saying :- "Go, go, mother, and ask for uncle's basket and spade. His mother at last went to her brother's home, and asked for the loan of his basket and spade. Her brother said to her:- "Sister, why do you want the basket and spade P What are you going to do with them ? " She replied: - Francis wants them. The boy is so mischievous. I don't know what he wants to do with them." So his mother took the basket and the spade from her brother and brought them to Francis. Francis took them and measured all the treasure he had got, which made several baskets full. But on returning the basket and the spade, he let two rupees stick to the basket for his uncle to see, and when he saw the two rupees in the basket, he asked his sister how they came there. She told him that Francis had brought a heap of treasure, which he measured it with the basket. When the uncle heard this he immediately came to Francis and asked him how he got all the treasure, upon which Francis said :- "Oh uncle, what shall I tell you ? Shall I say one, or shall I say two?" His uncle then said: - "Go on, my boy, tell me where you got the treasure from." Francis then replied: -"Why, uncle, you remember you killed my cow ? I am so thankful to you for it. I skinned the cow, dried the hide, and cried it for sale: " Jia chabrah, dia cham ; jhia chambranh dia cham. Take hides, give treasure; take hides, give treasure." " There is such a demand for these hideg, that for the hide of one cow I got all this treasure. O uncle, if I had half the number of cattle that you have, I should get a heap of treasure as large as your house." His uncle was so fired with the desire of amassing treasure, that he went and slaughtered all his cattle, believing every word that his nephew had told him. In due time the cattle were skinned, and the hides having been thoroughly dried, he went from village to village and from country to country, crying out: "Jhia chambra, dia dhan; jhia chambrah dia dhan. Take hides, give treasure; take hides, give treasure." But who ever heard of exchanging hides for treasure P The poor man wandered day and nigbt for several weeks, and made himself the laughing-stock of every one. Quite fatigued and disheartened, he returned home. His wife asked him what success he had met with, but he only said: "Oh, you don't understand these affairs ; mind your own basiness." He was so enraged at the trick, that he determined to ruin Francis, and with this determination one night set fire to the boy's hut. His poor mother ran about like one mad, calling the people to help in putting out the fire. Francis, on the contrary, brought more sticks and other combastibles, and put them on the flames, which helped to burn dow hut quickly and surely. When the hut was entirely burnt down, Francis collected all the ashes in two bage. Ho then told his mother again to bake him a few cakes, which his mother did with some reluctanco, saying: -"I can't understand, Francis, where you want to go, or what you are trying do ?" But be bundled the cakes into a kerchief, and, having borrowed a bullook from one o neighbours, put the two bags of ashes on it, and drove it away. This time, too, he was u
Page #32
--------------------------------------------------------------------------
________________ 26 THE INDIAN ANTIQUARY. [JANUARY, 1892. what to do or where to go for a whole day, and at dusk he was again in a forest where he met a great merchant also driving a bullock with two bags on it. They asked each other who they were and where they were going and what they had. The merchant replied first: "I am a merchant, and the bags you see on the ballock are full of gold mohars, which I have earned in my trade." Francis turned this opportunity to his advantage, and said: - "Exactly like myself. I have amassed a large fortune in the shape of gold mohars in the bags which you see on my bullock, and I am now returning home after several months' business." The merchant believed every word he said, and so they agreed to put up together for the night, and arranged between them to watch their property by turns. The merchant had to watch till midnight, and then go to sleep, after which it was Francis' tarn to watch. Meanwhile they removed the bags from the bullocks to give them rest. Having partaken of their meals, Francis went to sleep while the merchant kept watch. About midnight the merchant awoke Francis ind told him it was time for him to keep watch, "Certainly," said Francis ; "we must, however, put our bags on our respective bullocks, for, shonld any robbers come, what can I do alone P While if we have them ready on the bullocks, I can awake you and we can then escape with all haste." The merchant thought the proposal reasonable, and so each put his bags on his bullock, and then the merchant fell fast asleep, being quite tired with the journey and the night-watch. In a little while Francis changed the bags, and drove home in all haste, and when he got home again he asked his mother to go to her brother's house and borrow his phara ani danda. His mother at first refused to go, telling him to go himself; but at last she went, and said to her brother: - "Brother, brother, lend me your basket and spade." "Why do you want the basket and spade P" asked her brother. "The boy wants them," replied she. "I don't know what he is trying to do." So Francis' uncle then gave her the basket and the spade, which she took home and gave to her son. Francis then measured all the gold mohars, which made several baskets full, and in returning the basket and the spade Francis purposely left two mohars in the basket. On seeing them his uncle came in all heste and asked Francis where he got the mohars from. Francis thought this a good opportunity for taking his revenge, and calmly said: - "Why, uncle, didn't you set fire to my hut? I gathered the ashes and sold them for several baskets full of gold mohars. Oh, if I only had a house like yours, what a lot of mohars it would fetch! You have only to say: "Jhia bhuri, did mori; jhia bhuri, dia more. Take ashes, give mohars; take ashes, give mohars." "Hundreds and thousands of people will flock to you bringing their mohars and taking your ashes." His unclo was again duped, and went and set fire to his large house. His wife was, of conrse, alarmed at this action, but her husband said: - "Oh, you don't understand these Affairs; you mind your own business." The whole house was reduced to ashes, which he collected and put into several bags. As he had killed all his cattle, he was obliged to borrow bullocks from others for the conveyance of the ashes. Having put the bags on the bullocks, he drove them from village to village and from town to town, crying at the top of his voice: - " Juia bars, dia mori; luia hu ri, dia mors. Take ashes, give mohars; take ashes, give mohars." Thus he cried and cried his ashes for days and weeks together, with the result, that he tired himself out and was hooted by all as a fool; for what folly is greater than to ask for mohars in
Page #33
--------------------------------------------------------------------------
________________ JANUARY, 1892.] FOLKLORE IN SALSETTE: No. 11. 27 exchange for ashes P At last he went home quite sick and tired. His wife again asked him what success he had had, but he only said: - "Oh, you don't understand these affairs ; you mind your own business." He now thought of how to punish Francis for his mischief, and hit upon the following plan. He called him one day, bound his hands and feet, and tied him in & back with the object of throwing him in the river. As he was going with the sack with Francis in it, he felt a pain in his stomach. Round about him were a lot of cow-herds, so patting the burden down, he went to a long distance to relieve his pain. In the meantime Francis pretended to be cry. ing, and kept saying: "Oh, I do not wish to be married! I am yet young, and the girl is so big ! What a shame, my uncle wants me married by compulsion." One of the cow-herds, who heard what Francis said, asked him to explain what it all meant. So he said: - "Look here, I am so young, and because I do not wish to be married, as the girl is too big for me, my uncle is taking me by force." Upon this the cow-herd said: "If that be the case let me take your place." << Agreed," said our hero ; and he was immediately let out of the sack, and was replaced by the cow-herd. Francis, once out of the bag, took the cattle belonging to the cow-herd, and drove them home in safety. His uncle came after a time, and taking up the sack, marched straight to the mountain, and threw the bag hoadlong from a precipice into the river, highly elated at the thought that he had at last got rid of Francis. That day passed and on the following morning he saw Francis driving a large herd of cows and buffaloes. He was at his wits' ends to understand how Francis escaped, and how he got such a lot of cattle. He, therefore, said to him: - "Hallo, Francis, where did you get all the cattle from P" Francis replied: -"Why, from the river into which you throw me. There are hundreds of thousands of them there. The only misfortune is that, being young, I could not manage more; so I contented myself with these. Oh, if I were as big and strong as you are, what a lot more I could have got." The poor unole for the third time believed what Francis told him, and so he asked him to bind his hands and feet and to throw him in the river. Francis, too glad of the opportunity offered him to get rid of his uncle, at once set to work. Having bound him well and put him in a sack, he carried him away. On the way, Francis now and then dropped his load on the ground, upon which his uncle would say: "Oh, Francis, what are you trying to do? Yon will kill me at this rate." But Francis would reply :-"No, no, uncle; you see I am so small, and you are so heavy! How can I help it?" Thus Francis carried his ancle up the mountain and threw him into the river, where he immediately died. When Francis returned home, his aunt oame and inquired of him what his uncle was doing: Francis replied: - "Uncle is selecting good cattle, and will not come home for a long time." For a whole week his aunt came daily and asked Francis why her husband had not returned yet, and Francis always gave her the same reply; but at last he said to her: - "Tumcha naura atham evache ndhin. Tumi vale ani pot kdra, ani bangria bingria phora. Your husband will never come now. Remove your vale and pot, and break your bangles." Francis now had abundance of money, with which he purchased a large house, and plenty of landed property, and lived with his old mother happily and in andisturbed enjoyment of his wealth. * Vavere anklets and pot is a necklet of gold which is given by the husband to the wife on their wedding day. The breaking of bangles is pre-eminently the sign of widowhood, as also are the removal of the vale and pot, which are onlled the shimgar of married woman.
Page #34
--------------------------------------------------------------------------
________________ 28 THE INDIAN ANTIQUARY. (JANUARY, 1892 NOTES AND QUERIES. OFFERINGS TO GODLINGS IN BENGAL. to Pirs at Sialkot in the PanjAb in token of vows At Raniganj and Bardwin in Bengal I found fulfilled. It would be interesting to note how small rude images of horses and elephants, far the custom is spread in India among the more used as offorings to Satto Pir by Musalmans and civilized peoples. Among the savage Cheros of to Bhoirob (Bhairava) and Mansa Devi by Hindus. the Mirzapur District such images of horses are Images of horses are offered in a similar way common. R. C. TEMPLE. BOOK-NOTICE. THE VEDANTA-SIDIANTAMUKTAVALI OF PRAKASANANDA, edition, is given a clear explanation of some of the with English translation and notes, by ARTHUR most difficult terms of Hindu Logic. VENTS. Benares, 1590. Pp. vi, ii, 186, vi. (Reprint Under the superintendence of Professor Venis is from the Pandit.) published the Vizianagram Sanskrit Series, According to the editor, Prakasananda, the the first number of which is edited by Mabima. author of this work is wedged in between Nri. hopadhyaya Gangadhara Sastri Manavalli and gives sin ha-Arama and Appaya-Dikshita," the former a fair indication of the scholar-like way in which of whom converted the latter "from Saiva heresy the others will be done. It contains the Sansksit to the true Strikara Vedanta," and the latter text of the Siddhintalida, a work on the Vodanta had reachel 11 good old age in 1620 A. D." Philosophy written by Appaya-Dikshita. The More precise information regarding this author 18 editor discusses, in the preface, at considerable not availablo. Consequently his work has pro- length, the date of the author, and arrives at the hably to be assigned to the Inst quarter of the conclusion that he was born about 1550 A. D. 16th century. Prakasinanda's Siddhantamuk- He further adds that Appaya-Dikshita was, ac. tavali belongs to a class of works wbich serve cording to European scholars, the chief Pandit 18 appendages to the second Adlyaya of San at the court of the Vijayanagara king Krislinraraja karu's grunt Bheisly. The object of these works whose other name was Venkatapati and who was "consists in searching through all the so-called the son of Narasimha alias Narasadova. It is Droofs of dunlity (dowite) current in the schools clear from the following verse which is found at (more particularly in that of the Nyiya), in the end of the Kuvalaydnanda, another work of order to close them as just so many cnscs of the same author', that he was a contemporary of "petitio principii twioraya)." The conclusion king Venkatapati :at which the author arrives at the end of his amuNkvlyaanndmkriidppdiikssitH| inquiry is expressed in the following words of the Smriti : niyogAveGkaTapatenirupAdhikRpAnidhaiH / / brahmAtmakatvavijJAnaM zAbdaM dezikapUrvakam / From inscriptions and other trustworthy sources we learn that Krishnaraja, the son of Narasa buddhipUrvakRtaM pApaM kRtsnaM dahati vahivata // or Nrisimha, was not called Venkatapati, and that "The knowledge of self and Brahman as iden. he reigned from about Salka 1430 to 1451 (= A.D. tical, gained through the Voda and attendance on 1508 to 1529). If the date that is established a Guru, consumes like fire every evil deed (though) in the preface of the book under review for the done iutentionally." birth of Appaya-Dikshita is correct, the sovereign Professor Veniz has done invaluable service of whose court he was the chief Pandit, must to the student of the Vedantil Philosophy hy have been Venkata I. of Karrata, whose grants adding an English paraphrase of the whole work, range from Saka 1508 to 1535 (= A.D. 1586 to in which the perplexing terms of the Sastra are 1613). The editor, being a stranger to Dravi. rendered by corresponding ones chosen from dian names of places, makes Tiruvalakudu of European philosophy. The technicalities of the Tiruvalangadu ("the sacred banyan forest ), Tarkasastra make it a somewhat repulsive sub- where some of the descendants of Appaya Dikshita ject to those who have followed the close reason- are still supposed to live. Further, he attempts ing of the European school. But editions, like to Sanskritize such names as Talija var, Kumbha. the present one, of Hindu philosophical works, ghunam and M& yavaram from their Anglo-Indian published by scholars like Mr. Venis, who can forms. Strange irony of fact that these forma sylupathise with the spirit of Hindu metaphysics, shonld gain permanence even in Sanskrit works go a great deal towards removing such repul. | in preference to the vernacular names ! siveness. In the index, which is appended to this V. V. 1 Epigraphia Indica, Vol. 1. p. 332. ante, Vol. XIII. p. 155.
Page #35
--------------------------------------------------------------------------
________________ FEBRUARY, 1892.) DATE OF THE BOWER MANUSCRIPT. A NOTE ON THE DATE OF THE BOWER MANUSCRIPT. BY A. F. RUDOLF HOERNLE, PH.D. [Reprinted with alterations and additions from the Journal of the Asiatic Society of Bengal, Vol. LX, Part I, No. 2, 1891.) THE Bower manuscript was exhibited to the Asiatic Society of Bengal at the two meetings 1 in November, 1890 and April, 1891. I call it the "Bower MS." in order that Lieutenant Bower, to whose enterprise the learned world owes the preservation of the manuscript, may receive the honour due to him. Some account of the locality and circumstances of its finding will be found in the Society's Proceedings for November, 1890; and a preliminary account of the manuscript and its contents was published by me in the Proceedings for April, 1891. Since then I have spent a long summer vacation in carefully examining the whole manuscript, and, with the exception of a few leaves, I have read and transcribed the whole. I have now, moreover, the pleasure of announcing that the Governments of India and Bengal, with their usual liberality in such matters, have decided to publish & complete edition of the manuscript which I am now preparing. This paper had been written in Darjiling, in May), when I received (in July), through the kindness of Professor Buhler in Vienna, an advance copy of his notice of the specimen pages of the Bower MS., which were published in the November Proceedings of the Asiatic Society of Bengal. It was particularly gratifying to me to find that, reading the manuscript, he in Vienna and I in Calcutta, at about the same point of time, we independently arrived at essentially the same conclusions, both with regard to the age and the contents of the manuscript. Such a coincidence most distinctly makes for the truth of our conclusions. The substance of the paper which I now publish on the age of the Bower MS., and which I promised in the April Proceedings, was originally intended by me to form a part of the introduction to my edition of the manuscript. But seeing the interest which the manuscript has already excited in Europe, I pablish it now in anticipation, and hope similarly to publish portions of the manuscript, with translations, from time to time, I may state here briefly the results of my detailed examination of the manuscript. It consists of not less than five distinct portions. The first portion consists of 31 leaves. It contains the medical work of which I have published the commencement in the April Proceedings, and two pages of which are figured in the upper parts of the two plates accompanying the November and April Proceedings. I shall designate it by the letter A. The second portion, to be called B, which immediately follows the first portion, consists of five leaves, and forms a sort of collection of proverbial sayings. A specimen of it is figured in the lower part (No. II) of the plate in the April Proceedings. The third portion, C, consisting of four leaves, contains the story of how a charm against snake bite was given by Buddha to Ananda while he was staying in Jetavana, tlie garden of Anathapinda. A specimen of this portion is figured in the lower part of the plate in the November Proceedings. The fonrth portion, D, consists of six leaves. It is preserved in a rather unsatisfactory condition, and appears to contain a similar collection of proverbial sayings as the second portion, B. The fifth portion, E, which also consists of five leaves, contains another medical treatise. It appears to be -- so far as I can judge at present the commencement of a larger work. 1 It is now published in the Vienna Oriental Journal, Vol. V, p. 103. * The first instalment is published in No. III. of the Journal, 18. Soc. Beng., for 1891. It is the fifth portion (E) of the MS.
Page #36
--------------------------------------------------------------------------
________________ THE INDIAN ANTIQUARY. (FEBRUARY, 1892. Besides these five connected portions, there appear to be a few detached leaves, quite mconnected with one another ard with those larger portions. of the fourth and fifth portions no specimens have been published, but the fifth is writtet in the same style as the first portion. The fourth portion is written in an exceedingly slovenly and hurried hand, much resembling that of the third portion, but the writing is far more slovenly. It may possibly represent the handwriting of a fourth scribe; tbongh, on the whole, I am disposed to believe that there are really only three distinct styles of writing represented in the entire manuscript. The first is that of the first and fifth portions (A and E); they are Bo nearly alike, that I believe them to be of the same scribe. The second is that of the second portion (B), which is a fine, ornamental writing. It must be ascribed to a distinct scribe. The third is that of the third and fourth portions (C and D), which seem to me to differ more in the manner than in the character of writing, and may not improbably be due to one scribe, though a different person from the scribes of A, E and B. I come now to the question of the age of the MS. Here the first points to be settled are the locality and class, to which the characters of the MS. belong. Mr. Fleet has clearly shown, in his Volume III. of the Corpus Inscriptionum Indicarum on the Gupta Inscriptions, that, irrespective of varieties, there existed, at the time of the Gupta period, two very distinct classes of the ancient Nagari alphabet, the North Indian and the South Indian (see Fleet, pp. 3, 4). The test letter for these two great classes is the character for m, which in the Southern alphabete retains its old form rosembling the figure 8, while in the Northern alpbabets that old form has been displaced by a square cursive form 9. Tried by this test, it is at once seen that the alphabet of our MS. belongs to the Northern class. Throngbout the MS, the square formy is used exclusively. It is particularly distinct in the portions Cand D; in A, B and E the left-hand curved line is drawn somewhat straighter. The Northern class of alphabets, however, is again divided into two great sections, which, though their areas overlap to a certain extent, may be broadly, and for practical purposes sufficiently, distinguished as the Eastern and Western sections. The test letter in this case is the cerebral sibilant sha. In the North-Eastern alphabet its form is , while in the North-Western alphabet its form is u. Examples of the former alphabet we have in the posthumous Allababad pillar inscription of Samudra Gupta, of about 400 A. D. (Fleet, pp. 1, 6), the Kahaum pillar inscription of Skanda Gupta, of 460 A. D. (Fleet, p. 65), and others in Mr. Fleet's volume. The same alphabet is shown to perfection in the Nepalese inscriptions, Bhagwanlal Indraji's Nos. 1 to 10 and No. 12, published ante, Vol. IX., p. 163; also in the Nepalese inscriptions Nos. 1 and 2, in Mr. Bendall's Journey in Nepal, pp. 72, 74. To this section also belongs a new copperplate of Dharmaditya (Samudra Gupta ?), lately found in the Faridpur district in Eastern Bengal. On the other hand, the other Nepalese inscriptions, ante, Vol. IX., Nos. 11, 13, 14, 15, and in Mr. Bendall's Journey, Nos. 3 to 6, exhibit the North-Western alphabet. The latter alphabet is also to be seen in all the Nepalese MSS., described in Mr. Bendall's Catalogue of Buddhist Sanskrit MSS., including the two oldest, Nos. 1049 and 1702. Examples of the North-Western alphabet in Mr. Fleet's volume are the Bilsad pillar ingcription of Kumara Gupta I., of 415 A. D., the Indor plate of Skanda Gupta, of 465 A. D., and others. Also the Toramana inscription in the Epigraphia Indica, Vol. I, p. 288, the * All subsequent references to "Fleet" refer to this work. . At the same time the Indian N.-E. alphabet has the form of for the dental sa, the two forms of sha and sa being bat slightly distinct from one another. The Indian N.-W. alphabet has for sa, which is also used by the Nepalese variety of the N.-E. alphabet. The following Nos. in Mr. Fleet's volume belong to the N.-E. class : Nos. 1, 6, 7, 8, 9, 11, 12, 13, 15, 82, 64, 66, 68, 68, 75; occasionally the Western form is used in conjuncts, such as kaha, shta. The following Nos. belong to this class : Nos. 4, 10, 13, 16, 19, 20-31, 88-37, 42, 43, 46-52, 57-59, 63, 67, 7072, 74, 76, 80. See also the classificatory lista at the end of this paper.
Page #37
--------------------------------------------------------------------------
________________ FEBRUARY, 1892.) DATE OF THE BOWER MANUSCRIPT. 31 Kumara Gupta II. seal in tbe Journal, As. Soc. Beng, Vol. LVIII, p. 88, and the Nepalese inscriptions above mentioned. In both the North-Eastern and North-Westerr. sections there are divisions into varieties, some of which Mr. Fleet has noticed. However, for my present parpose, there is no need to enter into any consideration of these. But the distinction of the two great sections is very marked, and can never be missed when once pointed out. There is one point, worthy of notice, with regard to these two great Northern divisions. It is this, that in India proper the North-Eastern alphabet gradually came to be entirely displaced by the North-Western alphabet, in comparatively very early times. This displacement must have taken place about the beginning of the sixth century A. D. For about 525 A. D. we already find an inscription in Jaunpur (of lsvara Varman, Fleef, p. 228) which shows an exclusive North-Western character, and there is not a single inscription known (so far as I am aware) after 500 A. D., which shows the distinctive marks of the old North-Eastern alphabet. Oatsido of India proper, that is in Nepal, the North-Eastern alphabet maintained its ground for about three centuries longer; for the inscription, No. 4, ante, Vol. IX., dated in 854 A. D., still shows the use of that alphabet. This survival is accounted for by the fact that the North-Western alphabet apparently made its way into Nepal about a century and a half later than into Eastern India proper. For the earliest known inscription in that alphabet is No. 11, ante, Vol. IX., which must be dated 655 A. D. For the purposes of manuscript writing, as distinguished from documentary inscription, the NorthWestern alphabet probably made its way into Nepal very much earlier, as shown by Mr. Bendall's old MS. No. 1049, if (as I think it may well be) it is dated in 252 of the Gupta era, that is, in 571 A. D. Now the Bower MS. is distinctly written throughout in the North-Western alphabet. This is an important point and must be kept in view throughout the following enquiry. The age of our MS. must be judged solely by the facts as disclosed by the circumstances of the NorthWestern alphabet. No conclusion that can be drawn from circumstances connected with the South-Indian or the North-Eastern alphabets may be applied to the determination of the age of our MS.. For it stands to reason, that no scribe, who was habituated to write in the NorthWestern alphabet, would in any writing of his habitually introduce any peculiarity of the SouthIndian or North-Eastern alphabets, with which he was not familiar. Having premised this much, I proceed to the consideration of the points that appear to me to afford the means of determining approximately the date of the Bower MS. Among the existing varieties of the North-Western alphabet, there is one which has most nearly retained its ancient character. This is the so-called Sarada alphabet, which is still current in Kasmir and the adjacent Sub-Himalayan provinces, such as the Chamba and Kangra valleys. The most striking point of difference between the Sarada alphabet and its more ancient parent, the original North-Western alphabet, is the sign for the letter ya. The Sarada alphabet uses the modern cursive form 2. while the original North-Western alphabet employed the more ancient tridental form N. This is the test letter by which any inscription or manuscript written in the Sarad& characters may be at once distinguished from any inscription or manuscript written in the more ancient North-Western alphabet. The latter I shall, for the sake of convenience, briefly distinguish as the Gupta alphabet. The oldest MS. in the Sa rada characters of the existence of which we know, is the so-called Horinzi MS., of which Professor Buhler has published an account and illustrative plates, in Volume I. Part III. of the Anecdota Oxoniensia.? According to him," it is certain that this MS. cannot date later than the first half of the sixth century A. D." (ibid., p. 64). It employs throughout the modern cursive form of ya. On the other hand, the Bower MS., though showing in the writing of parts A and E, in many 1 "BaradA" is the name of a small group of alphabets, the varieties of which differ a little according to locality (Kaimir, ChambA, etc.) or period or material of writing, etc. ; but the onsential unity of the group is well known, and it is usual to call it Sarada.
Page #38
--------------------------------------------------------------------------
________________ 32 THE INDIAN ANTIQUARY. (FEBRUARY, 1892. respects, a very decided resemblance to the Sarada characters, employs in the portions B, C, D exclusively, in A, E almost exclusively, the older tridental form of the letter ya. It follows, therefore, that the Bower MS. is not written in the Sarada alphabet, but in the more ancient Gupta alphabet. The general similarity of its letters to the Sarada probably shows that the locality of its writing was somewhere in the extreme North-West of India, but its use of the ancient tridental form of ye shows that its date must be antecedent to the elaboration of the Sarada form of the North-Western alphabet. When this event took place, I shall now attempt to show. The old form (though not quite the oldest, which was 1) of the letter ya was Vor V. It was made by two separate movements of the hand, one for drawing the left-hand perpendicular, the other for drawing the remaining portion of the letter. The next step was an attempt to draw the letter with one movement of the hand. This led to the contrivance of the form V by which the end of the left-hand crook or loop was brought forward to the point of janetion of the perpendicular and horizontal portions of the letter. It was now possible to draw the letter with one stroke of tho pen, beginning with the top of the left-hand perpendicular, downwards; then round the loop, from left to riglit, to the bottom of the perpendicular; then finishing with the right-hand crook or angle. This change was clearly dae to the convenience of cursive writing. But the tendency of cursive writing to quickness and economy of effort very soon led to a further change, which produced the form by severing the point of junction. This form, which was the final result of the process, is still essentially the modern cursive form. The intermediate form of, as I shall presently show, only existed for a comparatively very short time, and is essentially a mere transitional form, It is a well-accepted fact that cursive forms first make their appearance in manuscript writing, and may be, and generally are, in use in MS, writing some time before they are introduced in the inscribing of documents on stone, copper or other material. Such documents are of a conservative nature; they have a tendency to preserve old forms, after these have long disappeared from ordinary MS. writing. The common or exclusive use, in an ordinary MS., of a distinctly archaic form is, therefore, a safe means of determining its age. The old form of the letter ya was once current in all the alphabets of India. In all of them it gradually became displaced by some cursive form. But this displacement did not take place in all of them at the same point of time. In the South Indian alphabet it survived, at least in inscriptions, down to the twelfth century A. D9 The North-Eastern alphabet, As I have alreadly remarkel, was, in India, proper, as early as the beginning of the sixth century, superseded by the North-Western alphabet; but in Nepal it survived about three centuries longer, and there, with it, the old form of ya survived, at least in inscriptions, down to the middle of the ninth century A. D. It should be noted, however, that the old form of ya, in the shape in which it survived in Nepal, is somewhat different from the old form in its original shape, as it was once current in the North Indian alphabets. Its original shape is that of a sort of trident, of which the left-hand prong makes a carve or even a loop, thus N or N. In the Nepalese shape, the curve or loop, is replaced by & ringlet which is poised on the top of the left-hand prong, thus W. The difference is marked, and the two shapes can be easily distinguished from cach other. The North-Western alphabet was the first to discard the use of the old form of ya. From it, as I shall presently show, the old form disappeared, even in inscriptions, as early as the end of the sixth century A. D.; and from cursive writing in that alphabet, according to the well. known rule, above stated, it must have disappeared much earlier. There is an obvious conclu $ In the old Kavarese, where it much resembles the later Nepalese form with the ringlet attached to the left prong. See, e. 9.. the Easteru Chalukya inscription of 1134 A. D., ante, Vol. XIV., p. 50, or the Kakatiya inscription of 1162 A. D., ante, Vol. XI., p. 9. It has now passed into the various modern cursive forms of the South-Indian alphabets. * See, e.g., the inscription No. 8, ante, Vol. IX., p. 171.
Page #39
--------------------------------------------------------------------------
________________ FEBRUARY, 1892.] DATE OF THE BOWER MANUSCRIPT. 33 sion, which is suggested by these facts; it is, that the invention, so to speak, of the cursive form of ya took place in the North-West of India, somewhere within the area in which the North-Western alphabet was current. The first document known to us, from which the use of the old form lias entirely lisappeared is the long Bollgaya inscription of Malinamnu of 588 A.D. (F'lect, 1.274). It incs exclusively the transitional form, with one or two exceptions, in which the modern form itself is used.10 In another short Bodhgayi inscription of Maluinimun, of toont the same into (Fleet, p. 278), the modern form is used exclusively. In fact, after 600 A. D., there is no inscription known, which shows any trace of the survival of the old form. In all of them the cursive form of yu is fully established in exclusive use, thus in the Mouthi (Lakkhun Manlal) inscription of bont 600 A. D. (Epigraphin India, Vol. I, p. 10),11 the Madhaban inscription of lar'sha, of 031 A D. (ibil. p. 67), the Aplisad and Shahpur inscriptions of Adityasenn, of about 672 A. 1). (l'loot, pp. 200, 208), the Dao Baranark inscription of Jiviti Gupta, of about 7:25 A. D. (Fleet, p. 213), the Sarnath inscription of Prakatiditya of somewhere in the seventh century (Floet, p. 281). To these muy be addol the evidence of those Nopalese inscriptions, which are not written in the NorthEastern or proper Nepalese alphabet, bnt in the North-Western characters; thus the Patan inscription of 687 A. D. (see Mr. Bendall's Journey in Nepul, p. 77), the Jaist (Katmandu) inscription of 750 A. D. ibid. p. 79), the inscription of Siva Deva, of 748 A, D.. another of 750 A. D., and the inscription of Jayadeva, of 758 A. D. (sce ante, Vol. IX, pp. 176-78). In nil these inscriptions the modern cursive form is used exclusively. Another piece of evidence, in the same direction, is the Tibetan tradition respecting the introduction of the Northern Indian alphabet into Tibet (see Journal, Asiutic Society of Bengal, Vol. LVII, pp. 41 ff.). It is said that these characters were introduced into Tibet by the snge Sambhuta, who brought them from Magadha, where he had rosidled from A. D. 030-050. These characters are known in Tibet as the "Wartn" characters of Mngadha; their forms, as tradi. tionally preserved in Tibet, may be seen in Plate I of the Journal (ibid ), and it will be seen that among these the letter ya has the cursive form. This shows that at the time of Sambhoti's visit to Magadha, in the second quarter of the seventh centary A. D., the cursive form of ya was in current use in North-India, 12 I am not aware of the existence of a single dated inscription in North-Indie, written in the North-Western alphabet, which indubitably proves any use, still less the exclusive, or almost exclusive, use of the old form of ya, after 600 A. D. It follows from this evidence that, sinco the old form of a huu ontirely disapponred from inscriptions, from the end of the sixth century (say from aboat 590 A. D.), it must have disappeared from the cursive writing of ordinary manuscripts long before. Accordingly, a manuscript, like the Bower MS, in which the old form is still used almost exclusively, must be placed long before the end of the sixth century, and much nearer the beginning of it. This conclusion is fully sapported by the evidence of all the ancient dated (or practically dated) MSS. that are, as yet, known to exist. The oldest is the Horiuzi MS. The date of its writing has been shown by Professor Buhler to be somewhere in the middle of the sixth century, that is, between 520 and 577 A.D. (see Anec. O.con., p. 63 ff.). It exhibits tlironghout tho exclusive use of the cursive form of ya, thus showing that this cursive form was fully 20 The transitional form is here used in a somewhat modified and more ornate shape. 11 The transitional form occurs twice in this inscription, in yana, 11. 6 and 11, curiously enough, with the vowel EUR, on which seo page 35. 19 Tbo "Wartu " characters exhibit in all test points the characteristics of the North-Western alphabet. This shows, what I have already observed (ante, p. 81), that the North-Eastern alphabet, which was once current in Magadba, was there in very early times displaced by the North-Western alphabet. It is said, however, that Sambhuta oniy "partly" adopted the "Warta" characters for his Tibetan alphabet (Journal, ibid. p. 41). This explains the fact that the "Warta" or cursive form of ya does not appear in that alphabet. For the letter ya that sage appears to have drawn on the North-Eastern alphabet, which he must have known from Nepal, where (as I have shown) it maintained its ground about three centuries longer than in Magadba.
Page #40
--------------------------------------------------------------------------
________________ 34 THE INDIAN ANTIQUARY. (FEBRUARY, 1892. established for MS. writing in the middle of the sixth century A. D. The next oldest MSS. are two, described as Nos. 1049 and 1702 by Mr. Bendall in his Catalogue of Buddhist MSS. in the Cambridge Library, p. xxxix. One of them is dated Samvat 252, which Mr. Bendall takes to be in terms of the Harsla era and to be equal to 857 A. D. For my part, I can see no valid objection, on palaeographic grounds, to understanding the date in terms of the Gapta era, and as equal to 571 A. D. I do not notice any such material difference between the writing of the Horiazi MS. and the two Cambridge MSS., as to account for a sopposed interval of three centuries. Anyhow, both Cambridge MSS. exhibit the exclusive use of the cursive form of ya. The conclusion appears to me inevitable, that any MS. which shows, as the Bower MS. does, the exclusive use of the old form, or which shows an uniform absence of the use of the cursiva form, cannot be possibly placed leter than 550 A.D., and in all probability is very much older. The only question is, whether there are any indications in the Bower MIS. that render it possible to fix its date somewhat more detinitely. Here the following facts are to be observed. The first appearance of the modern cursivo form of ya in any inscription is met with in the Bijayagadh inscription of Vishnu Vardhana, of 371 A. D. (Fleet, p. 252), in sreyo, line 4 (if the plate can be trusted); and it is to be noted that it is used in junction with the vowel 8. The old form, however, is more usual, as in ndmadhe. yena, 1. 3, and abhivriddhaye, 1.4, in both cases with the vowell. The first appearance of the transitional cursive form is met with about thirty years later (see below), but there can be no doubt that, though in the existing inscriptions, the first appearance of the modern form happens to be earlier, that form, as compared with the transitional form of the letter, is of later dovelopment.13 Probably there was no great interval between the development of the two forms. In any case, the invention (so to speak) of the transitional form and, with it, the first beginnings of the modern form of ya may, thus far, be placed at about 350 A. D. The actual first appearance of the transitional form is found in the Tusam inscription (Fleet, p. 269). It occurs in the word yogacharyya, 1. 3, again with the vowel 8, and side by side with the old form in upayojyam.14 This is a very clear instance; but, unfortunately, the inscription is not dated, though on palaeographic grounds it may be referred to about 400 A. D. The first occurrence of the transitional form in a dated inscription is in the Indor copper-plate of Skanda Gupta, of 465 A. D. (Fleet, p. 68), in the words abhivriddhaye, l. 4, and upaye jyam, 1. 7, in both cases with the vowels e and o. Side by side, the old form occurs in yogam, 1. 9, yo, 1. 11, abhivriddhaye, 1. 8. Other instances occur in the Karitalii inscription of Jayanatha, of 493 A. D. (Fleet, p. 117), in abhivsiddhaye, 1. 7, and chhreyo, 1. 15, here also with the vowels e and 6; and side by side with the old form in ye, 1. 10, lopayet, 1.12, pruyena, 1. 16, yi, 1. 20. Another instance occurs in the Khoh inscription of Jayantha, of 496 A. D. (Fleet, p. 121), in the word abhivsiddhaye, 1. 8, again with the vowel e, and side by side with the older form in pratyayopanayan, 1. 11, and prayena, 1, 17. A very clear instance occurs in the Jaunpur inscription of Isvaravarman, of about 525 A. D. (Fleet, p. 228), in anvavaye, 1.2, again with the vowel e. So again in the Mandasor inscription of Yabodharman of about 530 A. D. (Fleet, p. 149), in yo, 1. 4, again with the vowel 8, and side by side with the old form in padayor, l. 5. Similarly in the Mandasor inscription of Yasodharman as Vishsuvardhana, of 533 A. D. (Fleet, p. 150), in yena, 1. 8, again with the vowell, and side by side with the old form in bhurayo, 1. 8,16 yena, 1. 8, 13, yo, 1. 17, 18. Likewise in the Khoh inscription of Sarvanatha, of 533 A. D. (Fleet, p. 135), in nyayena, 1. 13, 1. ye, 16, and pra 15 A similar case, with regard to the development of the letter m, is noted by Mr. Fleet in his volume on the Gupta inscriptions, p. 3, footnote. 1. This instance was also noticed by Mr. Fleet (p. 270, footnote 4). It is the identical form that occurs in the Bower MS. 16 This is a very good instance for comparison, because in bharayo yena the two forms stand in immediate juxtaposition.
Page #41
--------------------------------------------------------------------------
________________ FEBRUARY, 1892.) DATE OF THE BOWER MANUSCRIPT. 35 tyayotpannaka, l. 9, again with the vowels & and 8, and side by side with the old form in lapayet, 1. 18, gramayor, 1. 27, yo, 1. 25, ye, 1. 27, etc. These are all the instances of the occurrence of the transitional form that I have been able to discover among the 35 inscriptions in the North-Western (Gupta) alphabet, published by Mr. Fleet. Contemporary with them are the following instances of the use of the modern cursive form. In the Majhgawam inscription of Hastin, of 510 A.D. (Fleet, p. 166), it occurs in the words chhreye, l. 14, yo, 1. 16, puniyeshu, 1. 17, ye, 1. 18, again with the vowels, e and 6, and side by side with the old form in the words anvayopablogyas, 1. 10, yo, 1. 11, ahayo, 1. 18.16 The transitional form also occurs in the word abhivriddhaye, 1. 7. Now as to the conclusione that follow from the above statistics, note, in the first place, the extreme rarity of the transitional and modern cursive forms, as well as the peculiar circumstances under which alone they occur. And here mark the following four points: (1) They occur only in a small proportion of inscriptions. Of course, the only inscriptions with which we are here concerned are those that ase more or less exclusively the old form. Those that already use the transitional or modern cursive forms exclusively are outside the question; so are, of course, all those that are not written in some variety or other of the NorthWestern alphabet. Now there are 35 inscriptions of the former description in Mr. Fleet's Volume III. of the Corpus Inscriptionum Indicarum. To these may be added a few others, such as the Toramana inscription in the Epigraphia Indica, Vol. I, p. 238, and the Kumara Gupta seal in the Journal, Asiatic Society of Bengal, Vol. LVIII. p. 88. Among these there are only ten inscriptions, a little more than one-fourth, that exhibit the occasional use of the transitional and modern cursive forms at all. The rest use exclusively the old form. (2) The transitional and modern cursive forms occur, in that one-fourth of inscriptions, exclusively in connection with the vowels & or 0.17 With all other vowels, i, e., in every other case, the old form is used. (3) Even in connection with the vowels and o, the transitional and modern cursive forms are not obligatory, but optional. In fact, even with those vowels, the old form is used more commonly than the transitional and modern cursive forms. On the whole the former is used twice as often as the latter. (4) of the two cursive forms, the transitional and the modern, the former is used much more frequently than the latter (viz., transitional: modern = 13:4). In the second place, note that the period during which the sporadic use of the transitional and modern cursive forms occurs, is a comparatively well defined one. Its termini, so far as the evidence of the available inscriptions goes, are from 371 A. D. to 533 A. D., or in round numbers from 370 to 540 A. D., i. e., 170 years. Or, if we omit the very early case of the Bijayagadh inscription, of 371 A. D., as perhaps of a doubtful character, the transition period extends from about 400 to 540 A.D., that is, 140 years. Antecedent to this period, we find the old form of ye in undisputed possession of the field, and subsequent to it, the cursive form of ya is in equally undisputed possession.18 Now it appears to me that from these facts there is but one conclasion, to which one is irresistibly driven. It is this, that there is here disclosed to us evidence of the actual point in time, when the invention, so to speak, of the cursive form of ya was made, or, to speak more precisely, the application of it to the non-conjunet ya. For to suit the case of the conjunct or under-written ya, the cursive form had been long before invented and exclusively employed. But to the non-conjunct ya, it only began to be applied about 400 A. D. At first it was only 16 In these cases the peculiarity of the form is also noted by Mr. Fleet, p. 106. 1. Probably it would also be used with the vowels ai and au ; though no instance happens to occur in the existing inscriptions. 18 The single cicoption is the Asirgadh seal, of about 565 A. D.; and here there are probably peculiar reasons to account for it.
Page #42
--------------------------------------------------------------------------
________________ 36 THE INDIAN ANTIQUARY. (FEBRUARY, 1892. applied tentatively and hesitatingly in those cases in which the non-conjunct ya carried the vowels e or 8 (or ai or au). But the convenience of the cursive form gradually carried everything before it, and displaced the old form entirely about 510 A. D. In all probability this process commenced, in the case of manuscript writing, earlier than in that of documentary inscription, perhaps already about 350 A. D., and terminated proportionately earlier, perhaps about 500 A. D. On the other hand, in documentary inscription the process began later and ended later. Here the use of the old form may have lingered on to about 600 A.D.; but from that date, as already shown from the evidence of existing dated inscriptions, the use of the cursive form of ya enjoyed an undisputed possession of the field. Accordingly, for practical purposes, the role may be laid down, that any inscription in the North-Western Indian Alphabet which shows the more or less exclusive use of the old form of ya must date from before 600 A. D. With regard to manuscripts the same rule must hold good, with this modification, that the termini must be put back by about 50 (or it may be 100) years; that is, & MS. showing the exclusive use of the cursive from of ya must date from after 550 or 500 A.D., while & MS. showing the more or less exclusive use of the old form of ya must date from before 550 or 500 A. D., and may date back as far as 350 A, D. That this rule, as deduced from the above collected facts, is correct is proved by the Horiazi MS. This MS. uses the cursive form of yi exclusively, and, as shown by Professor Buhler, it certainly dates from some time between 520 and 577 A. D. This rule further proves that the elaboration of the so-called Sarada alphabet may be placed abont 500 A. D. For it possesses the cursive form of ya. Hence it follows that any manuscript and a fortiori any inscription, written in the Sarada characters must certainly be later than 500 A. D. ; though as the Sarada characters, with slight modifications, are used up to the present day in Kasmir and the adjacent regions, a mere consideration of the form of the cursive ya is insufficient to fix with any approximation the date of such a manuscript or inscription in any particular year after that epoch. Now let us see the bearing of the results of the above enquiry on the question of the age of the Bower MS. It is to be noticed that, (1) The old form of ya is used almost exclusively throughout the MS. Indeed, in the second, third and fourth portions it is used exclusively, and it is only in the first and fifth portions, that the cursive (transitional or modern) form occasionally occurs. (2) This cursive (transitional or modern) form is never used, except when carrying the vowels e or ai or o or au. (3) Even with those vowels, the use of the cursive (transitional or modern) form is optional; though on the whole, it is more usual than that of the old form. (4) of the two forms of the cursive ya, the transitional and the modern, the former is used almost exclusively; the modern cursive form occurring only in a few isolated cases. The following examples are all taken from the two published plates: and I have only to remark, that the pages, figured on the two plates, are very fair specimens of the whole manuscript. The transitional cursive form is to be seen on Plate I, No. 1,19 in yoga 1. 1, yoga 1.2 twice yoganai 1. 3, trayodasam 1.5, kalpavet 1. 9,; again on Plate III, upper page, in jivaniye 1. 2, payo 1..4, jivaniyais=cha 1. 4, lepayet 1. 4, vimiarayet 1. 6, prayojayet 1. 6, avagahayet 1. 6, yo... 1. 6, lehayet 1. 8, prayojayet 1. 11. Note that it is always used with the vowels e or ai or o. 19 Plate I is in the April Proceedings 1891, and Plate III in the November Proceedings, 1890.
Page #43
--------------------------------------------------------------------------
________________ FEBRUARY, 1892.) DATE OF THE BOWER MANUSCRIPT. 37 There is only one instance of the modern cursive form; it occurs in the akshara yet of prayojayet in Plate III, npper page, in line 11. Here we have the transitional and the modern cursive forms side by side in one word, the former form being used in the akshara yo, the latter in the akshara yet. A similar instructive example of the use, side by side, of the old and the transitional forms, we have ibidem in prayjayet, in line 6, where the old form is seen in the akshara yet, while the transitional form occurs in the akshara yo. of the old form there are the following instances. On Plate I, No I, we have it in chirnnayet 1. 10, and on Plate III, upper page, in upakalpayet 1. 2, *. yet I. 3, pray jayet 1. 6, lehayet 1. 8, pdyayet 1. 9. Note here again, that all these instances are with the vowel e. Of the old form with the vowel 8 there is no instance in the figured pages; but I have noticed a few cases in other parts of the manuscript. Of course, I exclude here, as being beside the precise point in question, all instances of the use of the old form in combination with any other vowel, only remarking, that it is used uniformly with all other vowels. To sum up, the examination of the two specimen pages shows : ad Nos. 1 and 2, that the old form is used exclusively, except with the vowels e, ai, o and au20; ad No. 3, that out of 23 instances, in which the letter y is combined with the vowels e or ai or , the cursive (transitional and modern) form is used in 17, while the old form is used in 6; that is, the former is used about three times as often as the latter ; ad No. 4, that ont of 17 instances of the use of the transitional and modern cursive forms, the former is used 16 times, while the latter occurs only once; i. e., that the transitional form is used alinost exclusively. Now comparing the case of the Bower MS. with that of the Gupta inscriptions, the resnlt is this, that the two cases, while fully agreeing in the main points, differ only in one particular, namely, that the cursive (transitional or modern) form is used in the manuscript rather more frequently than the old form (viz., cursive: old = 3: 1), while in the inscriptions the old form is used rather more frequently than the cursive form (viz., cursive: old = 1 : 2). This, how ever, is nothing more than may be expected, if we consider that on the one side we have a case of ordinary manuscript writing, on the other one of documentary inscription, and remember thnt (as Professor Buhler says, in Epigraphia Indica, p. 68) "everywhere in India the epigraphic alphabets are in many details retrograde and lag behind the literary ones." One thing, however, is clearly brought out by the evidence above set ont, that the writing of the Bower MS. must be placed within that period, which, as we have seen, is marked out by that evidence as the period of transition from the use of the old rigid form of ya to the use of the (still existing) cursive form; that is, for manuscript writing, within the period from about 350 to 500 A. D. It is true that in the second, third and fourth portions of the Bower MS., the old form is used exclusively. There is no trace whatsoever of either the transitional or the modern cursivo forms. Judging by this circumstance only, we should have to place the MS. still earlier, somewhere before the fifth century A. D. But this would certainly seem to be wrong with regard to the second portion. For the fact, that this portion was written after the first, seems to be clearly proved by the circumstance that it commences on the reverse of a leaf, on the obverse of which we have the ending of the first portion. Properly considered, however, that circumstance only tends to confirm the conclusion that the main portion (A, B, E) of the Bower MS. was written during the transitional period. For it is only natural to suppose that during that period, some scribes had already more or less adopted the new fashion of cursive writing, while others, more conversative, adhered to the older fashion, On the whole, therefore, considering that the portions A and of the MS, appear to manifest a decided tendency to a free use of the transitional form, it will probably be safer to place the date of the main portion of the MS. nearer to the end than the beginning of the transition period, that 20 Of au there is no instance in the figured pages, but I hare met with a few in other pages of the manuscript.
Page #44
--------------------------------------------------------------------------
________________ THE INDIAN ANTIQUARY (FEBRUARY, 1892. is to say, in the middle of the fifth century (say, about 450 A. D.). The portions C and D, however, may be referred to an earlier part of that period (say 400 A. D.). This result will probably be startling to most of my readers. There exists - and I admit, hitherto not without reason - a general disposition to discredit any claim to grent age on the part of any Indian manuscript. I used to incline to the same opinion, and the present result was an unexpected one to myself. But I do not see how the force of the evidence can be gainsaid. Let us see what the objections are. In the first place it is said, that the material of the MS. - birch bark - is of a nature too weak and flimsy to permit us to believe that it could endure for such a length of time. This argument has been already well answered by Mr. Bendall in his Catalogue of Buddhists Sanskrit M88., p. XVII. ff., and by Professor Buhler in the Anecdota O.zoniensia, Vol. I, part III, p. 63ff. No a priori role will apply; all depends on the circumstances under which a MS. may have been preserved; and the argument, from the nature of the material, will not stand for one moment against positive arguments from epigraphic history. According to Lieut. Bower's account, the MS." had been dug out of the foot of one of the curious old eructions just outside a subterranean city near Kachar." These erections are described as being generally about 50 or 60 feet high, in shape like a huge cottage loaf; built solid of sun-dried bricks with layers of beams now crumbling away." I suppose it cannot be doubted that these erections are Buddhist stupas. Such stupas often contain a chamber enclosing relies and other objects; these chambers are generally near the level of the ground or "at the foot" (as it is said) of the erection, and they are often dug into by persons who search for hidden treasures. In this way the MS. was probably dug out, perhaps not long before it was made over to Lieut, Bower. In such a practically air-tight chamber there is no reason why a birch bark MS. should not endore for any length of time. Another objection is that the characters used in a MS. are no guide to its age. It is said that " characters of the Gupta type have been used in very late times, and indeed are in uso to the present day all along the region from which the Bower MS. comes." The characters which are here meant are those used in the Kasmir, ChambA and Kangra valleys. They are those which are commonly known by the name "Sarada characters." These, as already remarked, are a variety of the North-Western alphabet, and are that variety which has more than any other, preserved the shapes of its ancient parent, the North Western Gupta alphabet. Now it is not quite correct to say, that the Sarada alphabet. has not changed; it is quite possible to distinguish the modern form of the SaradA from its more ancient form. But what is really important is this, that the Sarada alphabet, so far as we have any dated evidence, never possessed, at any period of its existence, the old (Gupta) form of the consonant ya, It always possessed exclusively the modern cursive form of that letter. I maintain, that there exists not a single dated MS. or inscription, written in any variety of the SArada alphabet, which does not show the exclusive use of the cursive form. This being so, it follows that any conclusions, drawn from facts connected with the Sarada alphabet, have no application to a MS. which shows the almost exclusive use of the old (Gupta) form of ya, and which, therefore, is not written in the 'Sirada characters. Now, what conclusions can be drawn from the facts connected with the Sarada alphabet ? Its exclusive use of the cursive ya shows that its elaboration is to be dated on this side of 500 A. D. But as it has but little changed the shape of its letters since the date of its inception, it follows, that any andated MS. or inscription written in the Sarada alphabet must be placed after 500 A. D., but may be placed almost at any time after that epoch. That is really all that can be intended by the principle that the Sarada characters are no guide as to age. More the principle will not bear, and it clearly is not applicable to a MS, which is not written in the Sarada characters, but in a form of alphabet more archaio and very possibly the parent of the Sarada. With the proviso, now explained, I fully agree with Professor Kielhorn's remark, made with reference to a Chamba Grant (ante, Vol. XVII., p. 7) that "it would be impossible to determine the age, even approximately, from its characters,"
Page #45
--------------------------------------------------------------------------
________________ FEBRUARY, 1892] DATE OF THE BOWER MANUSCRIPT. these characters being, as Professor Kielhorn explains, the well-known (Sarada. Judging from these characters, all that one could say would be that the grant may date from any time after 500 A, D., which, of course, would be a futilo proposition. The main argument for the age of the Bower MS. is the preservation in it of the old form of ya. No objection can be raised on the ground that the old form was preserved much longer in the South Indian and the North-Eastern Indian (Nepalese) alphabets. As these alpbabets differ from the North-Western Indian, which is used in our MS., any conclusions, drawn from the circumstances of those alphabets, have no applicability to our MS. It stands to reason that no scribe, used to his own North-Western Indian alphabet, would, in writing a MS., think of introducing the old form of a letter, which did not exist any more in his own alphabet, from another alphabet, unfamiliar to him, in which it did still exist. POSTSCRIPT. Since writing most of the above remarks I have, as already stated, read and transcribed nearly the whole of the manuscript. I have carefully noted every occurrence of the akshara yo, yo, yai, and yau. In the portions B, C, D, I have found the cursive form (either transitional or modern) used not once. The aksbaras yai and yau never occur; the akshara ye occurs 19 times (B 4,13, D 2), always with the old form of ya. The akshara yo occurs 9 times (B 7, D 2), again always with the old form. In the portions A and E, the case stands thus: there are altogether 333 cases of the occur. rence of those aksharas, viz., 202 of ye, 125 of yo, 4 of yai and 2 of yau. In every case of yai and yau the transitional form J is used. With ye and yo the transitional form is used 227 times, and the modern form a, 16 times. The transitional form occurs 117 times with ye, 110 times with yo, 4 times with yai, and twice with yau. The modern form occurs 12 times with ye, and 4 times with yo. Altogether the cursive form occurs 249 times. The old form occurs 73 times with ye and 11 times with yo. The following table exhibits this : Aksharas: Totals. yai 0 yau 0 Old ........................ Transitional ............ Modern ....................... yo 11 1, 110 : 84 233249 >> 0 16445 Total ... ye 202 yo 125 yai 4 yau 2 333 Now with regard to point No. 3 (see p. 35), there being 249 cursive forms to 84 old ones among a total of 333 cases, the proportion of cursire to old forms is as 3 to 1. With regard to the point No. 4, there being 233 transitional to 16 modern forms among a total of 249 cases, the proportion of transitional to modern forms is as (about) 15 to 1. In both cases, it will be seen, the evidence of the entire manuscript most accurately bears out the evidence of the specimen pages (see p. 37) and thus confirms my conclusions based on the latter. I may add with regard to the points Nos. 1 and 2, that in the portions A and E, the cursive (transitional or modern) form never occurs in any other akshara but those four: ye, yo, yai, yau. With the aksharas ya, ya, yi, yi, yu, yu, in every case, without any exception, the old form N. is used. The occurrence of these six aksharas, especially of ya and ya is very frequent, and this fact all the more accentuates the striking circumstance that the cursive form is only employed with the vowels e, e, ai, and au. There must have been some reason for this peculiarity, - perhaps one of mere convenience of writing, though I cannot suggest any satisfactory one. I should note, that the vowels e, 6, ai, and au are drawn, both with the old and the tursive forms, in every possible variety : entirely side-marked, marked half op side and half on top, and entirely top
Page #46
--------------------------------------------------------------------------
________________ 40 THE INDIAN ANTIQUARY. [FEBRUARY, 1892. marked. The cause of the peculiarity, therefore, cannot well have had any connection with the form of the vowels. I would suggest that similar statistical enquiries should be made with reference to some other leading letters; e. g., m, sh, the sub-scribed y, the super-scribed r; also with regard to the numeral symbols. I have little doubt but that from such statistics may result some further useful land-marks for the determination of dates of writing. I hope to pursue the enquiry myself, so far as leisure from official duties will permit me. ADDENDUM Since the publication of the foregoing paper in the Journal of the Asiatic Society of Bengal, I have drawn up a sketch map of the distribution, and classifactory lists, of the inscriptions on which my conclusions are based. As they may be found useful, I add them here. I classify (following herein Mr. Fleet) the early Indian alphabets into the South Indian and the North-Indian, distinguished by their forms of the letter m. Inscriptions which show the form are South Indian ; those which have y are North Indian. The North Indian alphabet I divide into the North-Eastern and North-Western varieties distinguished by their forms of the letter sh (cerebral sibilant). Inscriptions which show the form (bi-partite square) U are North-Western, while those which have the form (looped square) are North-Eastern. In the North-Western alphabet I distinguish the earlier Gupta and the later Post-Gupta varieties, which are distinguished by their forms of the letter y. Inscriptions which show the form N are written in the Gupta, those which have I are written in the Post-Gupta alphabet. In India proper the North-Western alphabet displaced the North-Eastern about the end of the fifth century. The year 500 A.D. may be taken as a convenient epoch of this occurrence. Not long afterwards the Post-Gupta began to displace the Gupta variety of the NorthWestern alphabet in India proper. The year 600 A.D. may be taken as a convenient epoch of the final displacement of the Gupta variety. Any inscription showing the old Gupta form of y may be placed before that date. In the following lists the inscriptions are arranged in chronological order. Where the exact date is not known, an average date has been assigned, 1. e., some year within the reign of the king named in the inscription. For these reigns I have used my synchronistic table, published in the Journal, As. Soc., Bengal, Vol. LVIII. The average dates may be easily recognised by their having no equivalents in the column of Indian dates. In a few cases, viz., Nos, 5 16, 19, 20, 21 in List I, No. 11 in List II., and Nos. 11, 12 in List III., there is nothing, at present, available to fix their dates, except the test-letters themselves. These inscriptions, therefore, do not help to support my argument, and I have only included them in the lists for the sake of completeness, and moreover distinguished them by italic type. At the same time, seeing that the lists without them amply sustain my argument, they add some weight to the latter post factum. With regard to Nos. 10, 11, 12 in List III. (marked by asterisks) I should explain, that in No. 10 (Kosam inscription) no instance of the letter sh occurs. So far, therefore, the test fails. But it should bo noted, that in the North-Eastern alphabet, the dental and the cerebral sibilants are formed very nearly alike, with a looped square; see, e. 9., No. 13 (Kabium inscription). This looped or ringleted form of the dental s occurs frequently in the Kosam inscription, Accordingly, I have classified it with the North-Eastern list. For the same reason, I have included in that list the two Nos. 11 and 12; for though these inscriptions exhibit one or two cases of the cerebral sh, these are, in the first place, not very distinct, and in the second place, they all occur in ligatures. The latter are not trustworthy tests, for the North-Eastern form of
Page #47
--------------------------------------------------------------------------
________________ 500 Bailari 2 NORTH WESTERN GUPTA. Avirgadh .865 Barabar Bhumara........508 Bijayagadha....... Bilad....... Bran....... 484,500 Gwaliyar Indor. Karitalai Khoa NA..... Majhganun Mandagor Mathurd. Nagarjuni Nirmand. Pahlddpur Udnigiri NORTH. WESTERN Pobt-GUPTA. Aphead ..660 Bodhgay...... 388 Deobaranark.....723 Kasia Katmandu 687-758 Madhe... 000 Madhuban...630 Mandar Rohtragadh Shahpur ......672 Sowpat 620 NORTH-BASTERN Allahaand ...400 Bhatanos........695 Bihor .......... hbo Deoriya........460 Faridpur - 990 Gadhwa 107, 467 Kahawn... Katmandu 635-8.54 Koshw. Mokunar 448 Mikrouli Patan Sarwath Udaigiri Jaunpur Micmand Zwem Toim Nahub patay. Bhdtgaan Kaham. THE PARL plasur, Ens. Majhgentot darger Calcutta Tamu . Bambayo Bu showing THE DISTRIBUTION OF THE NORTH-INDIAN ALPHABETSM 300-800 A. D. 1 Full No. Ind. . - Liths., 8.1. 0. Chuu
Page #48
--------------------------------------------------------------------------
Page #49
--------------------------------------------------------------------------
________________ FEBRUARY, 1892.) DATE OF THE BOWER MANUSCRIPT. sh is not always used in them. Thus in the thoroughly North-Eastern inscription of Kahaum (No. 13), we have the North-Western form of sh in the ligature ksh of kshitipa (line 3), while the North-Eastern form is used in the ligatures rsh and shth of varshe and jyeshtha respectively (line 4). I may add, that in the new Faridpur inscription, in which both the dental and cerebral sibilants are of very frequent occurrence, they can only be distinguished with great difficulty. Similar remarks apply to No. 4 of List I. No instance of the letter sh is preserved in it, but the characteristic form of the dental s helps to assign it to the North-Western variety. In the first List I have indicated, by means of a cross (+), those inscriptions which shew instances of the transitional or modern cursive forms of ya ; these are Nos. 3, 5, 10, 14, 15, 23, 28, 33, 34, 35. LIST I. - Inscriptions in the Gupta variety of the North-Western Alphabet. Serial No. Publication. Name of Inscription. Name of King, etc. Sams. A.D. 370 370 428 | 371 400 400 415 96 106 135 ....... No. 21 Hastin .. 146 156 163 45+ 460 465 475 482 484 493 496 500 300 508 510 510 510 ........ Fleet's No. 58 Bijayagadh ............ Yaudheyas ...................... No. 57 Pahl&dpur Sisupala ......................... +Bijayagadh Vishnu Vardhana ......... Mathura ............. Chandra Gupta II (395-414) ...... No. 67 ....... Tusdm .............. Bilsad ............ Kumara Gupta I ............ No. 61 ...... Udayagiri ......... (Kum&ra Gupta I) No. 63 Mathura .. (Skanda Gupta) ................. No. 18 Bhitart..... Skanda Gupta (455-468) ..... No. 16 +Indor Skanda Gupta Khoh...............................: No. 22 do. ...**. do. ...................... No. 19 Eran ............ Budhagupta No. 26 ...... +Kerdtaldi Jayanstha +Khoh do. ..... Nirmand... Samudra Sena ......... No. 36 ......... Eran ......... .... Toramana (494-510)" No. 24 Bhumara ............... Sarvanatha .................. Bardbar ............... Ananta Varman............... No. 49 Nagdrjunt do. . ....... No. 50 ........ do. ............ do. No. 20 ........ Eran.. Goparaja ................ No. 23 ........ Majhgawam ......... Hastin ................. . Epigr. Ind. I, p. 238..... Kurd ...... . Toramana ................. Fleet's No. 28 ...... Khoh........................... Sarvanatha .......................... No. 30 .... do. .......... do. ......................... No. 29 .. do. ** do. ............ No. 51 .. Jaunpur............ Isvara Varman (520-540) ......... No. 25 Khoi... ................................. Sarokshobha ............. No. 37 Gwaliyer ........... Mihirakula (515-540).............. Journ. A.S.B.,LVIII., 88. Bhitari (seal) KumAra Gupta II. Fleet's No. 33 ......... Mandasor ....... Yasodbarman ................. No. 36 + do. ...... do. ................. No. 31 Khoh Sarvapatha................. No. 35 + Mandasor............ Yasodharman .......... No. 70 Mathura ............... No. 47 Asirgadh (seal) ...... Sarva Varman (565-570) .......... No. No. 48 510 198 197 510 510 512 516 516 525 209 528 530 530 5.30 330 533 533 230 549 565 11 See Journal, A. S. Beng., Vol. LVIII. p. 98.
Page #50
--------------------------------------------------------------------------
________________ THE INDIAN ANTIQUARY. [FEBRUARY, 1892. None of the above inscriptions goes beyond the year 600 A. D.; hardly beyond the middle of the sixth century. The year 600 may, therefore, be taken as the extreme final limit of the use of the Gupta alphabet. LIST II. - Inscriptions in the Post-Gupta variety of the North-Western alphabet. Serial No Publication. Name of Inscription. Name of King, etc. Sanhv. A.D. 269 588 do. ..... 588 590 600 610 681 . 655 660 do. Fleet's No. 71. Bodhgaya ............ Mahanaman .. . . No. 72 ...... do. ... .. . No. 76 ...... do. ...... .. Epigr. Ind, I, p. 10 ... Madha ................ Fleet's No. 52 ...... Sonpat (seal) ......... Harsha Vardhana (606-648) Epigr. Ind., I, p. 67 ... Madhuban .... do. Bhagwanlal's No. 11... Katmandu ... Jishnu Gupta ............ Fleet's No. 42 Aphsad................ Adityasena (640-675) , No. 43 ...... Shahpur ............. Bendall's No. 3 ...... Patan ....******* (Udayadeva) ........................... Fleet's No. 79 ...... Sarndth Prakatdditya ............................. No. 46 ......... Debaranark ......... Jivita Gupta II... Bhagwanlal's No. 13 .... Katmandu ........... Sivadeva II. ....................... No. 14 ...... (Jayadeva II.) ................. Bendall's No. 4 do. ******** Bhagwanlal's No. 15.... do. ............ Jayadeva II. .......... Ada. Horiuzi MS. ........ Add................ Cambridge MS., No. 1049. 690 725 748 do. 750 151 756 153 758 530 252 571 None of the above inscriptions goes back much beyond the year 600 A. D.; the earliest is of 588 A. D. The year 550, may, therefore, be taken as the extreme initial limit of the PostGupta alphabet. The latest inscription of the Gupta variety is of about 565 A.D. This shows that in the middle of the sixth century the Gupta and Post-Gupta alphabets were used simultaneously, the Post-Gupta coming into fashion, the Gupta going out of fashion. The process of displacement of the Gapta alphabet was going on through the sixth century. Although, therefore, an inscription, showing the Gupta variety, may not be placed after 600 A. D., one showing the Post-Gupta variety need not necessarily be placed after that date, but it may not be placed before 550 A. D. To these remarks there is a double proviso. Firstly, they only apply to inscriptions; for manuscript writing the two limits should be placed probably about 100 years earlier. This is shown by the Horiuzi MS, which is written in a Post-Gupta variety and dates from abont 530 A. D. Secondly, they only apply to India proper, not to Nepal. With regard to India proper, the following list shows that the North-Eastern alphabet ceases to occur towards the end of the fifth century; the latest inscription is of 467 A. D. (No. 15). At the same time, List I. shows the occurrence of the North-Western alphabet within the North. Eastern aren in the early part of the sixth century; the earliest is the Jaunpur inscription of about 525 A. D. (No. 28). The year 500 A. D., therefore, may be taken as the epoch of the displacement of the North-Eastern alphabet in India proper. It was the Gupta variety of the North-Western alphabet that displaced it. Soon afterwards, however, about the middle of the sixth century (cf. No. 28 of List I. with Nos. 1, 2, 3 of List II.) the Gupta variety itself was displaced by the Post-Gupta variety. This shows that there never was a Post-Gupta variety The Bhitart inscription of about 160 A. D. (No. 9, List I.) would be a still earlier instance, but it is too badly preserved to be safely used.
Page #51
--------------------------------------------------------------------------
________________ FEBRUARY, 1892.] DATE OF THE BOWER MANUSCRIPT. 43 of the North-Eastern alphabet ; and as a matter of fact, no inscription has ever been discovered in India proper exhibiting both the North-Eastern form of sh H and the Post-Gupta form of y A. LIST III. - Inscriptions in the North-Eastern alphabet (only Gupta variety). Serial No. Publication. Name of Inscription. Name of King, etc. Saliv. A.D. Fleet's 390 400 407 No. 1 No. 7 No. 6 No. 32 No. 9 410 410 417 No. 8 417 No. No. 11 No. 65 do. 420 418 454 460 460 No. 12 Faridpur .............. Dharmaditya ............. Allahabad ........... Chandra Gupta II (395-414) .... Gachwa do. Udayagiri .......... do. Mihrauli. do. Gadhwa ............... Kumara Gupta I (414-454) Gadhwa ............... do. Gadhwa do. Mankuwar ............ *Kosam .................. Bhima Varman ..... * Deoriyd ............... Sarnath ........... Kah&um ............... Skanda Gupta (455-408) Bihar ................ do. Gadhwa ........... do. Bhatgaon................ Sivadeva I ............ Katmandu ............. do. Patan ............... Arhsuvarnan ............... Katmandu ............ do. do. do. do. Jishnu Gupta do. Manadeva......... Sivadeva II ................... Manadeva ................. Vasantasena No. 66 .. Bendall's No. 1 ... Bhagwanlal's No. 5 Bendall's No. 2 ...... Bhagwanlal's No. 6 No. 7 460 467 635 635 639 639 644 649 653 633 705 119 725 413 435 535 No. 4 85+ With regard to Nepal, List III. shows that the North-Eastern alphabet survived down to the middle of the ninth century; the latest inscription is dated 854 A. D. At the same time it also shows that the North-Western alphabet in the Post-Gupta variety was introduced in the middle of the seventh century. Its first appearance is in the Jishna Gupta inscription of about 655 A. D. (No. 7 in List II.). This is an instructive instance. Of Jishnu Gupta we have three inscriptions, viz., Bhagwanlal's Nos. 9, 10 and 11. Of these Nos. 9 and 10 (see Nos. 22, 23 in List III.) are exclusively in the North-Eastern characters; moreover, No. 9 is dated in 653 A. D. This fixes very approximately the date of No.11. But this No. 11, exhibits the curious fact of a mixture of North-Western Post-Gupta and North-Eastern forms. In line 2 (kshobhayitve) and l. 16 (parshadi) we have the North-Western form of sh; moreover, through. out the inscription we find the Post-Gupta form of y. But in line 9 (jishnu) there is used the North-Eastern form of sh. It seems to me, that we have here an indication of the exact time when the North-Western Post-Gupta alphabet was first introduced into Nepil. It must have been during the reign of Jishnu Gupta, in the middle of the seventh century. This alphabet did not, however, at once entirely supersede the older North-Eastern variety. The latter continued to exist by the side of the newer N.-W. Post-Gupta variety, for about two centuries
Page #52
--------------------------------------------------------------------------
________________ 44 THE INDIAN ANTIQUARY. (FEBRUARY, 1892. longer, being used by the Lichchhavi family in their inscriptions, while the Thakuri family adopted the newer variety. The sketch-map of the distribution of the two Northern varieties throws some farther light on the subject. It will be observed that, with two exceptions, all the inscriptions in the North-Eastern alphabet lie from Kosam or Allahabad east-ward. Those in the North-Western variety lie to the West and South-West of the North-Eastern area. This is the case up to about the year 500 A. D. After this date (as will be seen by the dates noted with the place-names) the North-Western inscriptions spread over the whole of the North-Eastern area. The only exception is the Pahladpur inscription, with its very early date of about 370 A. D. (No. 2 in List I.). Another noteworthy point is, that the North-Eastern inscriptions are nearly all crowded together, just south of Nepal, and in (what I may call) the home-provinces of the Gupta empire. Add to this, that, in India proper at least, they are confined entirely to the period of the height of the Gupta rule, 1. e., to the reigns of Chandra Gupta IL, Kumara Gupta I, and Skanda Gupta. The earliest is the Allahabad inscription under Chandra Gupta II, about 400 A. D., the latest is the Gadhwa inscription, under Skanda Gupta, in 467 A. D. (see List III). Their period is just about a hundred years, from the end of the 4th to the end of the 5th century. The Pahladpar inscription certainly falls before that period; for it shows the very ancient Indo-scythic angular form of m. The exact epoch when this angular form of in was superseded by the square form y is not yet known; and it is very desirable that this point should be statistically worked out. But the Bijayagadh inscriptions of the year 371 A. D. shows the same angular m, and the gold coins of Chandra Gupta I and Samudra Gupta already show the first beginnings of the use of the square form of m. The Pahladpur inscription may, therefore, safely be placed about 370 A. D. or earlier, that is, in the reign of Chandra Gupta I. It seems clear from this fact, that the North-Eastern alphabet has some peculiar connection with the imperial Gupta family. If we remember that this alphabet was also current in Nepal and that the Guptas entertained intimate relations with the ruling Lichchhavi family of Nepal, it becomes probable that the North-Eastern alphabet was introduced into India proper under the Lichchbavi influence. Chandra Gapta I married a Lichchhavi princess and founded the Gupta empire. Samudra Gupta and Chandra Gupta II gave it its widest extension, and they left their landmarks in the Faridpur inscription in the east, and the Mihrauli and Udaigiri inscriptions in the West and South-West (Nos. 1, 4, 5, in list III). As the Lichchhavis themselves originally came from North-Eastern India (Patalipatra = Patna), their alphabet possibly may, after all, claim an indigenous Indian origin, I see that Professor Buhler suggests, that the dates of Dr. Bhagwanlal's Nos. 1-3 are not to be interpreted (as done by Mr. Fleet and myself) as Gupta, bat as Vikrams dates (see Vienna Oriental Journal, Vol. V. p. 219). If this suggestion should prove correct, some of the details in the foregoing observations will require re-adjustment; but the main points of my argument are not affected by this question. Nor, so far as I can see, does it affect Prof. Bubler's own view regarding the origin of the Gupta era. That view does seem to me probably true. We must avait Prof. Buhler's promised full statement of his objections to Mr. Fleet's interpretion of the dates. In the meantime the probabilities seem to me greatly in favour of the latter. It seems difficult to understand how the Malaya pra - for that is really the Vikrama ere - should have got into Nepal at so early a period, With regard to the Faridpur inscription, referred to several times in the foregoing remarks, I may give the following preliminary information. It was found, not long ago, in the Faridpur district of Eastern Bengal. It is written in the early Gupta characters of the NorthEastern class. It shows throughout the old form W of y; the transitional W and modern forms never occur. It furthers shows throughout the North-Eastern form af of sh, which is very difficult to distinguish from the dental 8. The inscription refers itself to the reign of
Page #53
--------------------------------------------------------------------------
________________ FEBRUARY, 1892.1 FOLKLORE IN SALSETTE. a king Dharmaditya, but is not dated. It records the gift of a piece of land to a Brahman Somasvamin of the Lauhitya gotra and the Vajasineya bakha, by & person called Vasudeva Svamin, apparently for the erection of a dharnasala. The inscription commences as follows: Svasty - asyam - prithivydm - apratirathe - Nriga-Naghusha - Yayaty - Ambarisha - sami. dhtita - Maharajathirdja - Sri Dharmmdditya - bhaftaraka - rajye tad - anumodan - alabdh - dspade (nadhyana ?) Kabikayari mahapratihar - oparika - Nagadevasy = dddhyasana-kale. This commencement strikingly resembles that in the well-known Gupta inscriptions. The term apratiratha, moreover, is one peculiar to Samudra Gupta (see Fleet, p. 14, footnote 4); and there are other indications, pointing to him as being referred to here as the Dharmaditya. All the great Gapta rulers, Chandragapta II., Kamara Gapta I., Skanda Gupta, have honorific titlus formed with Aditya (Vikramaditya, Mahendraditya, Kramaditya, respectively). In all probability, Samudra Gupta, who was the first great ruler of the family, also had such a title ; and I would suggest, that Dharmaditya was his title. Soldered on to the plate is a seal, show. ing in the upper portion the standing figure of Lakshmi, entwined by lotus stalks and flowers, and on each side , very small elephant besprinkling her with water. The scene shews a very close resemblance to one represented on a tympanum in the Ananta cave, and figured in Fergusson and Bargess's Cave Temples of India, plate I, fig. 1. Similar, though not quite so closely resembling, is the representation on the back of the uppermost beam of the southern gateway of the Sanchi stupa, figured in Fergusson's Tree and Serpent Worship, plate VIII; also that on the Raypur copper-plate seal, figured in Fleet's Gupta Inscriptions, plate XXVII. In the lower compartment, almost effaced, there seems to be the legend Sri Maharajadhiraja-Dharmmadityasya. This, no doubt, is not the usual seal of the Guptas; but there is nothing to show, when the more usual Garuda seal was adopted. However, the question of the ascription of the plate may better be reserved till I shall be in a position to publish the whole inscription. Unfortunately the plate has suffered in some places so much from corrosion and inexperienced cleaning that I have not yet sacceeded in fully reading it, FOLKLORE IN SALSETTE, BY GEO. FR. D'PENHA. No. 12. - The Fortune-teller's Daughter. Once upon a time there was a woman whose vocation was to tell the fortunes of people. She was one day invited by the patal of her village to tell the fortone of his new-born child. The patel had also invited the prince of that villagel to witness the ceremony. Late in the evening the fortune-teller went to the pajel's house, but as she was entering the house she was stopped by the prince, who told her to see him on her way home. She promised to do so and entered the house, the prince remaining outside as a sentry to prevent any stranger entering the house during the fortane-telling. The fortane-teller, having performed many ceremonies and read out of many books, told the pacel what would be the fate of his child. After she had finished her business and received her dues, and was going away, she was again stopped by the prince who asked her what was in the fortune of the patel's child. The fortune-teller replied: --"What the child's fortune is I have told the patel: why do you want to know ?" But the prince alternately begged and threatened, and said he would not let her go till she had told him the child's fortune. So at last she told him what it was. The prince next 1 [This in intereyting as shewing what ideas the words "king, prince, quoon, princess," &c., convey to the minds of the "folk." The prose rendering of "king" should no doubt be "looal magnate." - ED.]
Page #54
--------------------------------------------------------------------------
________________ 46 THE INDIAN ANTIQUARY. [FEBRUARY, 1892. asked her to tell him his own fate. She was at first reluctant to do so, but after much pressure, she said : "Your fate, O prince, is this. To whatever age you may attain; whenever you may die, - now or a hundred years hence, -- it is written in your luck, that your head will be pounded by a strange queen! This, O prince, is in store for you !" 'When the prince heard this, lie thought to himself: - "Surely not! I will not wait to be killed by a strange queen, or have my head pounded." Thas thinking, he drew his sword and cut off his own head, which flew off and fell into a jam, al close by ! Now it happened that the king of a neighbouring country passed that way on the following morning, and seeing the head of the prince, took it up, carefully wrapped it in a handkerchief, and, carrying it home, put it in a drawer. Every day, before he left the house and as soon as he came home, the king used to open the drawer and look at it. The key of this drawer he kept in his own pocket, while the rest of the keys were in the custody of the queen, who was never told a word about the head. The fact of giving her all the keys but one aroused the curiosity of the queen. So one day she slyly took the key from the king's pocket, and when he was gone, she opened the drawer, and there saw the head. The face being beardless, it looked like that of a woman. She suspected, therefore, that the head must be that of a concubine of the king; and thought that the concubine having died, and the king being very much attached to her, he must have brought home her head and kept it in memoriam, that he might at least have the satisfaction of looking at her head! This naturally aroused a spirit of jealousy in her breast; so she took the head, and putting it in a mortar, pounded it into fine powder with a rice-pounder. Thus was fulfilled what was told by the fortuneteller to the prince ! When the fortune-teller got home it was later than she expected, for she had had to tell the fortunes of two persons. Her daughter asked her why she was so late, and she replied she was late becanse she had had to find out and tell the fortunes of two persons, the palel's child and the prince. The girl then asked her mother to tell her her own fate, and after much entreaty and pressure, the old woman said: - "In your fortune, daughter, it is written that you will marry a Ming, by whom you will have a son, and later on you will marry your own son. So it is written in yoar fortune !" * Surely not," thought the daughter to herself. "I marry a Mang! That will never do. I would rather go to a desort and lead a solitary life than remain here and eventually marry a Mang!! So saying, she left the house then and there, and went into a desert, where she lived on what leaves and fruit she could get. She lived in this state for some time, when one day she saw a person coming towards her on horse-back. The cavalier asked her who she was, and what she was doing there. She told him that she was a person living in retirement. He, too, said he was also living in retirement, and asked her if she would accompany him and live with him. Not knowing who the speaker was, and thinking he was a great personage, the fortune teller's daughter willingly agreed to go with him. Now this man's house was several days' journey from there, and on the way she ate and drank with him. When they reached his house, the fortune-teller's daughter found in it the flesh of dead cattle and date-palm brooms, which are the sure signs of a Mang. She cursed herself for agreeing to accompany the man; but she was reminded of what her mother had told her, and which had proved true, despite her living in retirement ! She left the Mang's house immediately, and again took to the desert, but this time to another one. She, however, became pregnant, and in due time brought forth a son. She took the child, tore a piece of her own sari, and, wrapping ? A Mang is a low caste person ; he is considered even lower than a Mahar. Euphemism for sexual intercourse,
Page #55
--------------------------------------------------------------------------
________________ FEBRUARY, 1892.] MISCELLANEA. 42 the child up in it, threw it in a bush, and went to a strange country, where she took employment in the king's house as a washer-woman. The child was picked up by the king of another country, who had happened to pass through the forest, and taken home and well cared for. As the king had no children of his own, he adopted this child as a son, and it was everywhere known as the prince of that country. One day this prince (for so we must call him), when he had grown up, happened, in company of a friend, to pass through the country where his mother was, and saw her at the tank wasbing clothes. He was so enamoured of her beauty that he asked her whence she came. She told him that she was a servant to the king of that country. He then went home and said to his foster-father : "Father, there is a young woman at the palace of a certain king, and unless you get me married to her, I will never rest satisfied, and starve myself to death." The king, who loved him exceedingly, did not like to refuse his request, and at once wrote to the other king and made arrangements for the marriage. Both parties made preparations on a grand scale to celebrate the occasion with befitting pomp, and in due time, on an appointed day, the son was married to his mother unawares. The wedding over, the bride was taken to the bridegroom's house. In the evening when they retired to bed, the bride chanced to see a rag hanging on the bedstead. On close examination she found it to be the very same rag, which she had torn from her sari, and in which she had wrapped her child before throwing it in the bush. She at once concluded that she had married her own son! But, there being no help for it, she lived with him happily as his wife! She was, however, convinced of the truth of what her mother had told her; and had learnt that no one can ever escape from the fate that is written on the forehead. MISCELLANEA. MISCELLANEOUS DATES FROM INSCRIPTIONS patau Tavure KrittikAyam: i.e., in the Saka year AND MSS. 548, on the first day of Vaisakha, the moon being 1.- Mr. Fleet's examinations of Hindu dates in the sign) Taurus (and) in (the nakehatra) have led to the conclusion that even in South Krittika. ern India, or at least in some parts of it, the This date does not furnish sufficient particulars amunta southern arrangement of the lunar fort- for exact identification, but the fact that the for exact identification hnt nights was not coupled with the Saka years until moon is stated to have been in the nakshatra a comparatively late period," in fact, not before Krittika (No. 3) proves all the same that the first A. D. 804. Compared with this, it may be in. of Vaisakha spoken of was the first of the bright teresting to learn from soine dates in M. A. half, and the month therefore the amanta VaisaBarth's Inscriptions Sanscrites du Cambodge, ikha. For had it been the first of the dark halt, that, in Cambodia, the amanta scheme was or, in other words, the first of the parnimanta used in connection with the Saka era at least Vaisakha, which follows immediately upon the as early as A.D. 626. full-moon day of Chaitra, the moon would have On p. 41 of M. Barth's volume is a date of a been in Chitra (No. 14) or Svati (No. 15). And the stone insoription from Vat Chakret, the chief possible equivalents of Vaisakha-eudi 1, i..., the items of which are first of the amanta Vaisakha, actually are : Pindibhute sak-abda vagu-jaladhi-sarair= for Saka 548 current, the 13th April, A. D. 625, vvasard Madhav-Adau ....... kumudavana. when the first tithi of the bright half ended 16 h. . (This story is interesting for three reasons. It introduces us to a novel and very quaint version of our old friend Blue Beard. It gives us an insight into a queer state of morality, in which it is a more dreadful thing for a woman to marry into a casto beneath her than to marry her own son. It is to be observed that the heroin endures the latter evil, but cannot bear the former. And the moral of the tale apparently is that it is no sin to follow your fate, whatever it may be. This is a tale among Christians, be it observed. -ED. 1 Seo Gupta Inscriptions, Introduction, p. 79, note 2; and ante, Vol. XVII. pp. 141 and 149. ? I quote the words, as corrected by the Editor.
Page #56
--------------------------------------------------------------------------
________________ THE INDIAN ANTIQUARY, [FEBRUARY, 1892. 18 m., and the moon was in Krittika up to about 807, when the 10th tithi of the bright half ended 23h. after mean sunrise ; and about 17 h. 26 m. after mean sunrise, and when, for Saka 548 expired, the 3rd April, A. D. 626, at sunrise, the moon was in the eleventh degree when the first tithi of the bright half ended 4 h. of Simha. 45 m., and the moon entered Kritika about 6 h. 2.- On p. 54 of the late Dr. Burnell's Elements 34 m. after mean sunrise. of South Indian Palaeography we find the remark that the Javanese Baka era begins in A. D. 74; In a short inscription from Vat Prey Vier, on and this remark has ante, Vol. X. p. 214, note 7, p. 74 of the samo volume, we find an even more been quoted by another distinguished scholar, interesting date, of which it will be sufficient to apparently in support of the statement that "in quote the words - ancient times the initial dates from which the Yate kale Sakanar nava-tanu-vishayair = different Indian eras were counted were subject Mmadhave shodas-ahe Jivas-chape=fa-suryyo to fluctuations of several years." Whatever may . . . . . . . .. maitram indur; be the practice of quite modern times, it is certain i. e., when the Saka year 589 had expired, on the that down to nearly the end of the 14th sixteenth day of Vaisakha, Jupiter being in the century A. D. the Baka reckoning in Java did sign) Chapa (or Dhanub), the sun in Monha, not differ from the pustomary Indian reckon, and the moon in (the nakshatra) Anuradha. ing. This may be seen from the following Here again the Vaisakha of the date was clearly Javanese Saka dates, which all work out properly the amanta Vaisakha, and the 16th day, spoken with the ordinary epoch A. D. 77-78. of, was Vaisakha-badi 1, and the true equivalent Profesgor Kern has published a Sanskrit in, of the date undoubtedly is the 18th April, A.D. scription from Jave of the Saka year 654. the 687, as may be seen from the following data. The date of which he reads thus: - new-moon which introduced the bright half of SAkendre=tigate srut-Andriya-rasair = angl. Vaibakba of Saka 589 expired was 9 h. after mean (nkf)krite vatsare sunrise of the 30th March, A.D. 667. Counted var - indau dhavala-trayodasi-tithau from that day, the 16th day was the 15th April, Bha. drottard KArttikel ; i. e., in the Saka year 654, A.D. 667, when the first tithi of the dark half expired, on Monday, the 13th lunar day of the (of the amanta Vaisakha) ended 4 h. 28 m., and bright half of Karttika, the moon being in the when the moon was in Anuradha up to about nakshatra) Uttarabhadrapada. - The corres. 22 h. 20 m. after mean sunrise. On the same ponding day, for Saka 654 expired, and with the 15th April the sun was in the sign Mepha, which ordinary epoch of the Saka era, is Monday, the it had entered on the 20th March; and Jupiter, 6th October, A. D. 732, when the 13th tithi of as required, was in Dhanun, having entered that the bright half ended 18 h. 17 m., and the moon sign, by the Saryasiddhanta rule without olja, on the 20th January, A.D. 667, and remaining in it was in Uttarabhadrapada up to about 15 h. 6 m. after mean sunrise. till the 16th January, A.D. 668. And in a paper of Professor Kern's "over eene The statement that Jupiter was in the 9th Oudjavaansche Oorkonde van Saka 782" there sign) Dhanuh in this case is really equivalent to saying that the current Jovian year was Kro. are two other Javanese dates, one of which is - dhana, the (12 + 12 +9=) 33rd year, counted Sakavarshatita 782, KarttikamAsa, tithi trayofrom Vijays as the first; and the special interest dasi suklapaksha,.. Vri-vara, ... Auvini of this date lies in this that, while the Boheme nakshatra, ... Vyatipatayoga,.... of its lunar month is the amanta, so-called Taithilakarana ; i. e., Saka 782, Btihaspati-vera southern scheme, the system followed in or Thursday, the 13th lunar day of the bright regard to the Jovian year is the northern half of Karttika, the nakshatra Asvini, the yoga mean-sign system. Vyatipata, and the karana Taitila; and the On p. 68 of M. Barth's volume the 10th day of otherVaisakha of the same Saka year 589 is mentioned Sakavarshatita 1295, Asujim&sa, tithi trayodas with, amongst others, the remark that the moon ksishnapaksha,... Bu-vara...; i. e., had reached the middle of the sign Simha. This Saka 1295, Sukra-vara or Friday, the 13th lunar date would correspond to the 9th April, A. D. day of the dark half of Asvina. From the copy which I owo to the kindness of Pro. In Verslagen en Mededeelingen der Kon. Akad. van fannor Kern I see that the inscription was originally Wetenschappen, Letterkunde, 2 R., 10 D.. Amatardam edited by him in the Bijdragen tot de Taal-, Land- en 1881, pp. 94 and 102. Volkenkunde van Nederlandsch-Indo, de volgt. DI. X.
Page #57
--------------------------------------------------------------------------
________________ FEBRUARY, 1892.] MISCELLANEA. 49 Here the proper equivalents, with the ordinary Sake van-ichala-tithi-mito bhaskare Karkataepoch of the Saka era, are: - for the first date, sthe and Saka 782 expired, Thursday, the 31st vinbaty-emed Vidhusuts-dino sukla-pakshe October, A. D. 860, when the 13th tithi of the cha shashthyam 1; bright half and the karana Taitila ended 10 h. i. e.. in Saka 1575, when the sun was in the sign 29 m., and when the nakshatra was Asvini up to Karkata, in the 20th degree, on Wednes11 h. 10 m., and the yoga Vyatipata up to 5 h. day, the sixth lunar day of the bright balt. In 16 m. after mean sunrise; and for the second Saka 1575 expired the Karkata-sam kranti took date, and the amanta Asvina of Saka 1295 expired, ka 1205 expired, place 16 b. 52 m. after mean sunrise of the 30th Friday, the 14th October, A. D. 1373, when the June, A. D. 1653; and the sun entered the 20th 13th tithi of the dark half ended 20 h. 49 m. after degree of the sign some time on Wodnesday, mean sunrise. the 20th July, A. D. 1653. This Wednesday 3.- Ante, Vol. XVIII. p. 162, and Vol. XIX. was the 6th of the bright half of Sravana, for pp. 129 and 426, Mr. Fleet has treated of some the 6th tithi of the bright half ended on it, about Saka dates which, instead of quoting a lunar 15 h. 18 m. after mean sunrise. month, give us the sign of the zodiac in which These are clearly luni-solar dates. But in some the sun happened to be on the day intended by Bengali MSS. we also find purely solar dates. the date. An early Vikrama date, which is very Thus, according to Professor Eggeling's Cata. similar to Mr. Fleet's Saka date in Vol. XIX. p. 129, occurs in line 32 of the Shekhavati (or logue, p. 211, a MS. of the Sarasvati Prakriya is dated - Harsha) stone inscription of the reign of the ChAhamana Vigraharaja, first published in the Sako sapta-dvi-sapt-aika-sankhye Mesham=ite Journal Beng. 48. Soc., Vol. IV. pp. 370-384. ravau 1 According to the rubbings and impressions sup. Tritiye=hni Raver=vare lipya partim=agid= plied to me by Mr. Fleet and Dr. Burgess, the iyam || Sak=ubdah 1727 11; date, which is given incorrectly in the published i. e., in Saka 1727, when the sun had entered the version, runs really thus: - sign Mesha, on the third day, & Sunday:Jato=vdA(bda)nar sahasre triguna-nava-yute The Mesha-samkranti at the end of Saka 1727 Sim ha-rassu gate=rkke current took place 1 b. 29 m. after mean sunrise sukla yksit=tristi*](ya] Subha-Kara-sahita of Thursday, the 11th April, A. D. 1805; and the Soma-varena tasyauml; day of the date is clearly Sunday, the 14th i. e., when 1027 years were completed, and when April, A. D. 1805, which by the lunar calendar the sun was in the sign Simha, on the third was the first of the dark half of the amunta Chaitra. bright lunar day which was attended by the nakshatra) Kara (or Hasta) and (the yuga) And according to the same Catalogue, p. 35, a Subha, on a Monday.-In northern V. 1027 ex. Bengali MS. of Suresvaracharya's Brihadaranyapired the sun entered the sign Simha 9 h. 49.8 m. ka-bhushyaveirttika is dated-- after mean sunrise of the 26th July, A. D. 970, navanavaty-adhika-chaturdasa-sata-mita-Sakabd8 which was the 6th of the dark half of the pur. Chaitrasya dvadas-amse Su(su)kravare; nimanta Bhadrapada. The third of the following i. e., in the Saka year 1499, in the 12th degree bright half of the same Bhadrapada was Monday, the 8th August, A. D. 970, when the third tithi of Chaitra, on Friday.-By the result of my calculations the year of this date is the current of the bright half ended 4 h. 15 m., and when solar year Saka 1499. In that year, the solar the nakshatra was Hasta up to 12 h. 29 m. and month Chaitra commenced 17 h. 256 m. after the yoga Subha up to 13 h. 26 m. after mean mean sunrise of Monday, the 25th February, sunrise. A.D. 1577, and the sun was in the 12th degree Dates of this kind are common enough in from some time on Friday, the 8th March, Bengali MSS. And some of these dates again *A.D. 1577, which was the 4th of the dark are peculiar in specifying the degree in which half of the purnimanta Chaitra of Saka 1499, the sun happened to be on the day of the date. current. Thus, according to the late Dr. Rajendralal Mitra's Notices, Vol. VI. p. 238, a MS. of the 4.-Dates are sometimes recorded in days Sanskdra-paddhati-rahasya, which is written in of the Kaliyuga. A very interesting date of Bengali characters, is dated - this description is contained in the following . Compare e.g. Dr. Rajandral Al Mitra's Notices, Vol. II. p. 310; Vol. III. p. 171; eto.
Page #58
--------------------------------------------------------------------------
________________ 50 THE INDIAN ANTIQUARY. verses of Shadgurusishya's Vedarthadipikd, in which the author tells us that he completed his work, when the number of days of the Kaliyuga was 1 565 132: Kaly-ahar Sarvanukramani-vrittir jata Vedarthadipikall Lakshani panchadasa vai pafichashashti Kha-go-tya-nme-shu-ma-y-eti ganane sati I Expressed in the days of the Julian period, the epoch of the Kaliyuga is 588 465 75 days; +1565 132 days; krishna sahasrakam i.e., in the Yavana or Hijra year 1197, on the Sa-dvatribsach-chhatam ch=eti dina-vaky- fourth lunar day of the dark half of the second Artha iritah II summer-month (Ashadha), on Thursday. As the Hijra year 1197 commenced on the 7th December, A. D. 1782, the date should fall in A. D. 1783 or Saka 1705 expired. And for Saka 1705 expired the 4th of the dark half of the amanta Ashadha corresponds to Thursday, the 17th July, A. D. 1783, when the fourth tithi of the dark half ended 21 h. 10 m. after mean sunrise. sum 2153 597-75 days of the Julian period the 24th March, A D. 1184, 18 h. after mean sunrise. Accordingly, the day actually given us by Shadgurusishya would correspond to the 24th March, A. D. 1184. But since this is the day of the Mesha-sankrantis at the end of the solar year Kaliyuga 4285 Saka 1106 current, it appears highly probable that, what Shadgurusishya meant to intimate, is merely, that he finished his work in Kaliyuga 4285 Saka 1106 expired, and that he has simply copied the number of days, given by him, from the calendar. That the day put down in the date was the day of the Mesha-samkranti, Shadgurusishya indeed has plainly suggested himself. For there can be no doubt whatever that the true reading of the first half of the first of the above verses is Khago-ntyan-Mesham-ap-eti kaly-ahargapane sati, i. e., when the number of days of the Kaliyuga was the number denoted by khago-ntyan Mesham-apa "the sun passed from the last sign on to the sign Mesha;" (kh=2, g=3, y=1, m=5, sh=6, m=5, and p=1). 5. In the Veraval inscription of the reign of the Vaghela Arjunadeva, the Mahammada samvat or Hijra year 662 is put down along with the Vikrama, Valabhi, and Simha years to which the day of the date belonged. And in MSS. I have sometimes found Hijra years quoted by the side of the corresponding Saka years. The Hijra year, described as the Yavana year, 6 See Professor Macdonell's Edition, p. 168; Indische Studien, Vol. VIII. p. 160; and Professor Aufrecht's Oxford Catalogue, p. 378. [FEBRUARY, 1892. is quoted alone in the following date of a MS. of a commentary on the Suryasiddhanta, written in Maithili characters (apparently) in Oudh:10 Such is the reading of the published texts, but it ields no sense. I shall show presently what I consider to be the right reading. Turaga-nava-himamsu-kshm-ankite Yavane= bde charama Suchi chaturthyam pakshe hni Jaive; 6. Ante, Vol. XIX. p. 6, I have attempted to prove that the Lakshmanasena era commenced in A. D. 1119, and I have shown that, assuming my epoch to be correct, the difference between a year of that era and the corresponding expired Saka year must always be 1040, or 1041, or 1042. In support of my views, I would now draw attention to two dates in the late Dr. Rajendralal Mitra's Notices, which I had formerly overlooked. According to Vol. VII. p. 169, a MS. of Bhavadatta's commentary on the Sisupalavadha is dated La-sam 512 Sakabdah 1552. Here the difference between the two years is 1040; and, in accordance with what I have previously stated, the Lakshmapasena year must have been the current year 512, and the date written in one of the months from Karttika to Phalguna. According to Vol. V. p. 84. a MS. of Madhu. sudan's Kantakoddhara which is written in Maithili characters, contains the lines - chakre Ramakaniyaso Svanipateh eitameu. nand-ambudhav= anke Phalguna-saptami-Ravidine Ganga. Ganes-archakah, which give us for calculation the (Lakshmanasena) year 491, and the seventh lunar day (of either the bright or the dark half) of Phalguna, joined with a Sunday. Here, the month being Phalguna, the date should fall either in Saka (491+ 1040 =) 1531 expired, or in Saka (491 + 1041) 1532 expired; but calculations for Saka 1531 yield no s It took place 8 h. 58-6 m. after mean sunrise. Three of Professor Macdonell's MSS. actually read misham (not meshum), and they have the sign of anusvara above the akshara preceding ty. 10 Dr. RajendralAl Mitra's N Vol. V. p. 119.
Page #59
--------------------------------------------------------------------------
________________ FEBRUARY, 1892.) MISCELLANEA. satisfactory result. In Saka 1532 expired, the seventh tithi of the bright half of Phalguna ended about 18 h. after mean sunrise of Saturday, the 9th February, A.D. 1611, which also does not suit the requirements of the case. On the other hand, in the dark half of the amdnta Phalguna of Saka 1532 expired - the 6th tithi ended 1 h. 38 m. before mean sunrise of Saturday, 23 February, A.D. 1611; the 7th tithi ended 0 h. 17 m. before mean sunrise of Sunday, 24 February, A. D. 1611; and the 8th tithi ended 1 h. 25 m. after mean sunrise of Monday, 25 February, A.D. 1611. It is true that by this result no tithi would have ended on the Sunday, and that the Sunday would have been put down in the calendar, like the Monday, as the 8th. But the tithis have here been calculated according to Ujjain time, and consider ing that the date undoubtedly was written far to the east of Ujjain, the seventh tithi would for the writer of the date really have ended some time after sunrise of the Sunday;" and Sunday, the 24th February A.D. 1611, therefore is the proper equivalent of the date,-deduced from the epoch of the Lakshmanasena era A.D. 1118-19. * 7. - A date of the Ashadhadi Vikrama year 1574, which does not admit of verification, is given in Professor Macdonell's edition of Katyayana's Sarvdnukramant, preface, p. xiii. And another Ashadhadi date, according to Professor Eggel. ing's Catalogue; p. 409, occurs in a MS. of part of HemAdri's Chaturvarga-chintamani, written in Western India, and is worded thus : Sarvat 15 Ashadhadi 81 varshe 5 Srivana. sudi panchami aparan shashthi Budhe. As might have been expected, the date falls in the northern Vikrama year 1581, expired, and the corresponding date, for that year, is Wednesday, the 8th July, A. D. 1524, when the fifth tithi of the bright half ended 1 h. 25 m. after mean sunrise. In addition to quoting the 5th tithi which ended on the Wednesday, and from which the Wednes. day received its number 5, this date algo quotes the following sixth tithi, and it is in this respect similar to No. 49 of my Vikrama dates, ante, Vol. XIX. p. 33; but what makes this Ashadhadi date more interesting, is the fact that the 6th tithi also ended on the Wednesday, 1 h. 17 m. before sunrise of the Thursday, and was therefore, in fact, a kshaya-tithi. 8. - In dates like the preceding the ordinals panchami, shashthi, etc., clearly denote the time occupied by the tithi itself, not the civil day on which the tithi ended; and those dates thus help to explain other dates in which the writers un. doubtedly have quoted actually current tithis, with the week days on which they commenced. According to my Report on Sanskrit MSS. for 1880-81, p. 22, a palm-leaf MS. of Amarasitha's Ndmalinganususana is dated :Srimad- Ramachandradeva - vija ya rajye Kumkuna-vishaye gata-Kali 4398 Hemalambba-samvatsare Jyeshtha-vadi ashtamyayam" Vrihaspati-dine By the southern luni-solar system the year Hemalamba corresponds to Kaliynga 4398 expired, and the 8th tithi of the dark half of the amanta Jyeshtha of that year commenced on Thursday, the 13th Juno, A. D. 1297, 1 h. 37 m. after mean sunrise, and ended at mean sunrise of the following day. Here the Thursday, quoted in the date, was civilly badi 7, and the 8th tithi was either a kshaya-tithi or ended after true sunrise of the Friday. And the meaning of the date clearly is, that the writing was finished on the Thursday, during the 8th tithi. In Professor Bhandarkar's Report for 1883-84, p. 357, the date of the composition of Mahesvara's commentary on Purushottama's Vishnubhaktikalpalatd is given thus ; - Srimad-bhavalayanuramjana-lasat-kirter = ntip&d=Vikramajjate-sch(ev)-Ambudhi-raga-bhami -ganit e= bde MArgasirshe=rjune pakshe mukhyajaya-tithau Suraguru. (ror)=yAre Virupaksha-bhure nirmatisma Maheavara guru-ksipash= tik&m=imam sumdardm 11 Here, again, the third (or mukhyajaya) tithi of the bright half of Margasirsha of V. 1647 expired commenced on Thursday, the 19th November, A. D. 1680, 1 h. 38 m. after mean sunrise, and ended 0 h.51 m. after mean sunrise of the following day. And according to Professor Bendall's Catalogue, 11 I now find that by Prof. Jacobi's Special Tables for the Saryasiddhanta with bija, published in Epi. graphia Indica, Pt. VIJI., the seventh tithi, even at Ujjain, onded 8 ghafikas after mean sparise of this Sunday. 11 Another date of this description oooars in . M8. of the Saptapadarth, of which a page is photographed in Dr. Rajendralal Mitra's Notices, Vol. II. : Samvat 1458 varsha Magha-vadi 6 anarhtara[th] saptamyath than Guruddind; corresponding, for the pfirnimanta Magha of V. 1458, current, to Thursday, the 6th January, A.D. 1401. 18 Read ashfamydih.
Page #60
--------------------------------------------------------------------------
________________ 52 THE INDIAN ANTIQUARY. (FEBRUARY, 1892. p. 32, a palm-leaf MS. of Chandragomin's Sishyalekha-dharmakuvya is dated : - Samvat 200.4. Vaisakha-sukl-Ashtamyam 8oma-dine. And here, again, the 8th tithi of the bright half of Vaisakha of the expired Newar year 204 commenced on Monday, the 15th April, A. D. 2084, 8 h. 43 m. after mean sunrise, and ended 9 h. 59 m. after mean sunrise of the .following day," and I here, too, take the meaning of the date to be, that the writer finished his work on the Monday, after the commencement of the 8th tithi. Gottingen. F. KIELHO'RN. NOTES AND QUERIES. AN ENGLISH INSCRIPTION AT. MAULMAIN. the great heell and unable to coming out. This At Maulmain, on the platform of the chief bell is made by Koona Lingahyah the Priest and pagoda, is a large bell of the usual Burmese type weight 600 viss. No one body design to destroy with a quaint inscription cut in English thereon, this bell. Maulmain, March 30th, 1855." which is worth preserving: - "He who destroyed to this bell they must be in R. O. TEMPLE. BOOK-NOTICE. The PRACHINA GUJARATI SAHITYA RATNAMALA, or manuscript has vanditvA and not vandayitvA, and the Garland of Gems of Old Gujarati Literature. The correct form here is of course trecut. The First Gom, the MUGDAAVABODHAMAUKTIKA, or Grammar for Beginners, of the Gujarati Language causal form would be meaningless or absurd in (V.-S. 1650). Edited by H. H. Dhruva, B.A., LL.B. this instance. Printed and published at the Subodha-Prakash At the end of page 10 Mr. Dhruva gives some Press, Bombay. 1889. Pp. vii., 28, 55. Karikas on samuisa. In the last verse of tbe 1st This work, edited by Mr. H. H. Dhruva, Kurika Mr. Dhruva gives YTCU, while the B.A., LL.B., is one of a series proposed by manuscript has TT. This wrong grammar him to be issued with a view to rescue the may be the result of a mere misprint; but being old vernacular literature of India from the oblivion in which it is at present lying. Evidently only one of many such instances, it indicates Mr. Dhruva believes this work to be a grammar careless editing. The 3rd verge of the 2nd of the Gujarati language of the time to which f the time to which Karike has the expletive fe inserted superfluously. it belongs (V.-S. 1450 = A. D. 1394). I It does not exist in the original, and it makes the shall presently examine how far this assumption verse scan wrongly. on his part is based on a correct appreciation of the These are some of the minor errors into which subject-matter of the work. But I propose first the editor has run. There are, however, instances to point out some of the many mistakes and in which the results of hurry and want errors which have resulted from the evidently careful study have been more serious. To cite superficial manner in which Mr. Dhruva has some of these :studied the work, and the very careless way in Page 16, col. 1. - About the beginning of the which it has been edited. vocabulary Mr. Dhruva has -- 311gi afe. Mr. Dhruva has based his edition on a single The original manuscript has here and not a The manuscript, -the one belonging to the Gujarat and the similarity in sound of * Vernacular Society of Ahmedabad. I have had the has betrayed advantage of a look at this manuscript, and I shall the editor into putting of where the real word point out some of the results of Mr. Dhruva's is a. This point owes its importance to the facts hurry and carelessness, by instances of disagree that is the intermediate form from which the ment between his manuscript and his edition. I modern Gujarati word at is derived, and that the At the end of page 4 of Mr. Dhruva's edition we broad pronunciation of it in this at (as in " awe" find the expression 15 y ear. The original is attributable to the pre-existent 8 in 3.2 14 Compare No. 168 of my Vikrams dates, ante, Vol. XIX. p. 361. 1 One viss = 100 tickals=3.65 lbs. avoirdupois. 1 [A curious instance of this carelessness stares one in the face on the very title-page, where the name of the work is given in Roman characters as "Mugdha bodha Auktika," but in Dovan Agar charactersus Mugo dhavabodhamauktika." The latter form occurs also at the end of the work; while three lines above there is again " Auktika." As the title-page declares this book to be "prathamah mauktikam," the real name seems to be Mugdhduab8dhamauktika.-EDITOR.] | It would be well to indicate here that in Gujarati and ST have each of them two distinct pronunciations, broad and narrow, or short and long ; broad or short
Page #61
--------------------------------------------------------------------------
________________ FEBRUARY, 1892.] a At page 6 and also page 7 Mr. Dhruva has ukti and karmi ukti for what is rightly given in the original instance as kartA ukti and karmi ukti. The anuseara is not trifling or superfluous. It represents the locative case, a being the forms for kartari, karmaNi. These may be mere misprints, but as such they are none the less the results of great carelessness. BOOK-NOTICE. But a still more serious blunder appears at page 7, col. 1, when Mr. Dhruva puts:anai jihAM kartA karmapaNaI bolAi te kammaikatAM ukti kahiyai / [ Mr. Dhruva's edition has kartA karmapaNahUM separated wrongly into kartA karma paNa iM which makes no sense. This by the way.] Here the blunder consists in inverting the order of the words and kartA in the expression kartA karmapaNa. The original has karma kartApaNaI. The sense is anyat yatra karma kartRtvena ucyate sA karmakartari uktiH kathyate; "this division of af (voice) represents cases in which the is used as the ar." Mr. Dhruva's reading would make it " is used as which is not intended. See the instance given e graMtha sukhiI paDhAyai / bhayaM graMthaH sukhena paJcate. Here graMtha, which is the karma, is used as the kartA. The object in sense is used as the subject in form. The name given to this ukti is karmakatA and not kartAkaoNma. This also indicates the sense above described. In the opening portion of his edition Mr. Dhruva gives what he calls an analysis of the work. Here he has - "(5) Cases -seven," and then adds the remark "vocative not given." Here Mr. Dhruva forgets that the vocative is not known to Sanskrit grammar as a separate case by itself. It is only the nominative case used when addressing another person. This very work, at page 14, col. 1, under the chapter of the Cases, says AmaMtraNe * "the nominative is used in addressing another." Mr. Dhruva seems to have been misled by the facts that in English grammars, as also in Gujarati grammars, the vocative is regarded as a separate case, and that the Sanskrit Rupavali gives vocative forms after the locative. But the The Analysis is then concluded with "(21) Prepositions" [more correctly, he should have said Prefixes']"twenty." But Mr. Dhruva strangely omits to notice the concluding chapter of the book which gives a few rules of Prosody. His Analysis should have concluded: -- "(22) "Rudiments of Prosody." 53 as in "care " and "awe;" and narrow or long as in "ache" and "buat." When a Gujarati word having or s has in its antecedent Prakrit or Deeya form or intermediate stage aD or bhaya, or au or aba the pronunciation of the or in the Gujarat! word is broad. When the antecedent Prakrit (or Deeya) form or intermediate stage has q and a, the pronunciation (in the Gujarl word for a is narrow; e. g. Deaya main cause of this error of his is his theory that this work is a grammar of the vernacular of the period, -a theory which I shall explode below. Then the Analysis gives" (19) Rules of Syntax." This appears to refer to the Karikas, beginning from the end of page 17 to very nearly the end of page 20 in the body of the work. A glance at these will shew that they give no rules of "Syntax." The only rules in these Karikas which may present an appearance of rules of Syntax, are those which deal with several Karakas, viz., kartA, karma, karaNa, saMpradAna, apAdAna, adhikaraNa, and the saMbandha sense of the Genitive. But these meanings or significations of the Vibhaktis (Cases) cannot, in strict propriety, be regarded as falling within the scope of "Syntax." I hope I have cited a sufficient number of instances to shew how superficially the work has been studied, and how carelessly it has been edited by Mr. Dhruva. But the superficiality of this study (if it can be called by the name of study) comes out boldly and strongly in his fundamentally erroneous theory about the nature of the work, which he has sadly failed to appprehend. He seems to regard this work as a Grammar of the Gujarati language of the period (A. D. 1394). It is nothing of the kind at all, as will appear from a little careful examination of the text, which clearly shews that it is merely a mArgopadezikA, a hand-book for the help of the beginner (gr), to teach Sanskrit Grammar through the medium of the vernacular of the period. Along with hurry and superficial observation, this error may be attributed to the feeling of over flowing patriotism which seems to have taken possession of Mr. Dhruva's mind, and has led him to imagine that so far back as 500 years ago his mother-tongue had a grammar of its own. In examining Mr. Dhruva's theory I shall first point out the errors and wrong conclusions badalI = belai Guj.; Sanskrit malinaM = maddalaM Prlk, maeNlaM Guj: Sans., Prak. Toft, Guj. T. Sans,, Prak. caTakkai, Guj. vaoNka. PrAk. kavaNa (for Sans. ka); Guj. kaoNna; while Sans. kadalI, Prak. kelI, Guj* keLa; Sans. badaraM, Prak. boraM, Guj. bora. Instances might be multiplied. and are used to show the broad and T.
Page #62
--------------------------------------------------------------------------
________________ 54 THE INDIAN ANTIQUARY. [FEBRUARY, 1892. into which he has fallen in consequence of hold. ing that theory, and then state our grounds for holding that the work is merely a hand-book of Sanskrit Grammar. First, then, - in his Analysis Mr. Dhruva says, " Vocative not given." This remark, as has been already hinted above, proceeds from an assumption that this is a Gujarati Grammar, and the fact that Gujarati Grammars regard the Vocative as a separate case. In his . Analysis' Mr. Dhruva says: "(9) Kridanta forms like a, carta, it. Pa, &c." Looking at the corresponding chapter in the book we find that this refers to the forms i, a tar, artaz, used incidentally to explain the Sanskrit participial and other forms ending in tum, tR, and zaTa. But even supposing for a moment that this work is a grammar of the vernacular of the period, Mr. Dhruva should have given the forms , TTEIT, A (the forms of the vernacular of the period), and not car, chitat (the forms of modern Guja. rati). He has in this instance been run away with by his patriotic hobby, so far as to uncon. sciously represent modern Gujarati forms as treated of in the text. Finally, Mr. Dhruva is forced to resort to a rather amusing shift in order to support bis totter. ing theory, whenever at erery turn it meets with some shock or other. The work gives + and other non-Prakrit vowels; this, Mr. Dhruva explains away, as a "Sanskritism." There are tbree numbers given (Prakrit has only two, liaving no dual); this Mr. Dhruva says, is a San. skritisin. The case terminationsgiven are Sanskrit and not Prakrit; this again, says Mr. Dhruva, is a Sanskritiem. The rules of Sandhi (which are unknown to Prakrit) are again a Sanskritism, a Scording to Mr. Dhruva Sandsas giving forms confined to Sanskrit Gramniar, the mention of Atmanepada forms of verbs (as Prakrit has only Parasmai pada forms even in the Passive Voice), the Sanskrit terminations for roots, - all these are " Sanskritisms." For Mr. Dhrusa must maintain his theory at any cost. Where, then, we ask, is the Prakritism of the work to be found ? Is it in the incidentally used Praksit terminations which Mr. Dhruva parades in all the importance of a bold black capital type? Mr. Dhruva is in the amusing position of a man who, looking at a peacock, would persistently swear it was a dog, and asked, whence the deep blue colour, whence the thick mass of rainbow-coloured feathers, whence the crest, the wings, the beak ?, would reply "Oh! that much only is a peculiarity of the peacock"! The fact of the matter is that Mr. Dhruva has started on a wrong line from the out. set, with also a wrong foundation, and is therefore compelled to put up a prop here and a prop there to support the tottering superstructure. I shall now proceed to indicate the grounds on which I base my contention that the work is a hand-book of Sanskrit Grammer and not of Gujarati Grammar. To begin, the very Mangaldcharana (the open. ing verse) shews the purport of the work : ahaM praNamya mugdhAnAM bodhahetIvidhIyate / prAyaHprAkRta uktInAM kiMcidAmnAyasaMgrahaH / / "After bowing to the Arbat, I proceed to make, for the instruction of beginners, a collection of some of the rules of grammar, mostly in the Prakriti. e, using for the greater part the Prakrit language in the treatment of my subject)." The author uses the word 94: (mostly), because in the latter part of the text be has occasionally treated the whole subject in Sanskrit and not in Prakrit. K arkrai is a +3anitai(9), and hence it cannot mean "a collection of Prakrit Uktis." K is connected with fy and not with mig. Even if the locative form is allowed, by a strain, to represent the genitive sense, it would conflict with the word , which will not tben give a satisfactory meaning. The author must, therefore, be taken, even from this passage, to propose a collection of rules of Sanskrit Grammar, treated through the medium of Prakrit. The facts that the work gives letters like , &c., peculiar to Sanskrit only, the dual number, Sanskritcase-terminations, Sanskrit Pratipadikas, the rules of Sandhi and Samusa peculiar to Sanskrit, and Atmanepada forms, clearly indicates that the book treats of Sanskrit Grammar and not of Praksit Grammar. It is very easy, but not safe, to explain all these facts away by calling them "Sansksitisms." But it involves on the face of it a circumlocutory and inverted way of arguing. It has never struck Mr. Dhruva as peculiar, that so large a fund of peculiarities of Sanskrit Grammar should have crept into a Gujarati Grammar with propriety, and without jarring on the sense of proportion. The author, probably holding that the title of Vyakarana can be claimed only by an exhaustive work treated in Sanskrit, gave his work a far more modest name. Mr. Dhruva may possibly have been misled by the facts that the whole treatment in the large portion of the work is carried on in Prikrit, that the Sansksit terminations are first preceded by the mention of Prakrit terminations, and that Sanskrit instances are preceded by the citation
Page #63
--------------------------------------------------------------------------
________________ FEBRUARY, 1892.] BOOK-NOTICE. 55 of instances in Prakrit. But the whole tenor This exposition of the mode of the author's of the treatment shews that the Praksit termina treatment should shew clearly that he is simply tions and instances are intended only to afford teaching Sanskrit Grammar through his verna. facility of understanding by the citation of things cular. The same method of treatment has been familiar for the teaching of things unfamiliar. observed by the author almost throughout this work. And in some places (as in the case of the To cite an instance or two: - At page 4, col. 2 - (kridantas) we find the following: 94 termination, at p. 5) only Sanskrit instances are given. What does this shew? If the work karI leI deI ityAdi bolivaI eka uktisAMhi pUvilI | were a Prakrit Grammar, what need was there kriyA Agali IkAra jihAM kahIMi tihAM tavA pratyaya tvA to give Sanskrit instances at all, along with the isiu AvaDa / , - "in using such words as karI Prakpit instances P And certainly, Prakrit in(doing), (taking) ** (giving), where in one stanoes could not be properly altogether omitted sentence & appears at the end of the first verb, as they are occasionally), and only Sansksit the termination 79, i.e. r, should be applied." instances given, if this was a Prakrit Grammar, What does this shew P The author, in order to | The author has thrown Praksit into the backshew where and how a Sanskrit termination is to ground to such an extent that, as the work proceeds, be applied, shews it by appealing in a practical way the treatment in Prakrit is abandoned in a great to an instance in the familiar Prakrit, and points measure, as in the Samusa chapter, and finally out the corresponding place of the termination. altogether, as in the Karikas on Kuraka. Could Thus the Praksit terminations, &c., being only this ever be a feature of a Prakrit Grammar P a means to an end, sink into a secondary place, After the beginner has gradually acquired familiar. and prominence is clearly given to the Sanskrit ity with Sanskrit by the Prakrit treatment in terminations and forms. Yet Mr. Dhruva prints the first portion of the book, the author prethe in large type and puts 1 and r in sumes the learner to be able to give up Praksit small type. But we are consoled by the thought and understand the treatment in Sanskrit itself that the mere printing of big or small type will This is undoubtedly the explanation of the change not affect the inherent tenor of the text. in the language of treatment. In fact the The author goes on :- 37542 FTTT author has put the qualifying word 94: in his Fery opening verse. dvitIyA / ziSya zAstra paDhI artha pUchai / pUcha isI kriyA | I think I may, after all this explanation, hope that / kauNa pUchA ziSya / ja pUchai su kartA tihAM prathamA / it will be regarded as clear that this work is a Banski suMpUchaha artha je pUchaitaM karma tihAM dvitIyA / kisuM karI | krit Grammar taught through the vernacular; or at faei FIT TOUT 5 qar yra fast and that it will be hardly necessary to point out as a falar fator: Tre giocar set that the Prakpit and Sanskpit equivalent words at quial,-"The indeclinable TFT takes (governs) pages 16, 17 are but a vocabulary teaching Sanskrit frater in the A sense. [Then a Prakpit sentence words, and that the Karikas at pages 17-20, the Ganas and Anubandhas of roots at page 20, the is given by way of instance]. ziSya zAstra paDhI artha Padas of roots at page 21, and such other 158,-'the pupil, after reading the Sastra, asks features, go entirely against the hasty theory of its sense.' pUchai is the kiyA. Who asksP; ziSya. Mr. Dhruva, and support my contention about He who asks is the piaf. There put the no- the nature of the work. ininative (termination). What does he ask P; The only part of the work hich would lend pt. What he asks is.the . There put the plausible support to Mr. Dhruva's theory is the accusative (termination). After doing what, does chapter on af (Voices) at pages 6, 7. art he ask P After reading the Trat). There put the (Straight, Direct) and ist (Crooked, Indirect) accusative termination in the sense. (Thus Voices are names unknown to Sansksit Grammar. you have) PETZT: Tref l 721 geura." This The author also refrains from giving the corre. process indicates the steps through which the sponding Sanskrit names for the several Voices, treatment passes. A Prakrit sentence is given wat ik r. art is quite a for a basis to start with, then each word is novel division. And immediately after that, tie examined in its relation, and the terminations author gives some forms peculiar to Praksit. are shewn, which are to be put on according to the These facts might for a moment lead one to sup. rules, till at length the final structure is built up pose this work to be a Prakrit treatise, and not in the resulting Sanskrit sentence. This is the one on Sanskpit Grammar. But against this synthetic manner, in which the author teaches up to single short chapter are to be put all the other the final instances. parts of the book which, as shewn above, clearly
Page #64
--------------------------------------------------------------------------
________________ 56 THE INDIAN ANTIQUARY. (FEBRUARY, 1892. indicate the work to be a Sanskrit Grammar. office" he "now occupies" to examine the work The probable explanation of this chapter may be with care, diligence, and patience? He could that the author took the liberty of allotting a then have secured several Manuscripts and have separate chapter to the Voices, which is not collated them; - a course the propriety of which done in Sanskrit Grammars, and, therefore, he ought to have suggested itself, for, although did not give Sanskrit names at all for the divi. he speaks at one place of the Manuscript he sions of the Uktis; and, having for once spoken in secured as "correct throughout with rare this manner, he incidentally, by way of a note als exceptions," he himself at another placet com. it were, gave some peculiarities of the Prakrit plains of the mislections in which some parts of language. This view is strengthened by the fact the work abound. that in giving these peculiarities the author ex. It is to be hoped that, when Mr. Dhruva bringe pressly uses the words haar," in the Prakpit out the second edition of the work which he has language," which he would not have done were promised at the end of his Preface, he will this not an exoeptional case in a work which, for exercise greater care, eliminate all errors, minor the rest, is a Sanskrit Grammar. Further support and fundamental, give up his untenable theory, is to be found in the fact that the author states and present the work in a creditable form. Till in this very chapter that in the aft af verbs then, his publication can hardly succeed in com. take the Parasmaipada terminations ordinarily manding any perceptible circulation or patronage. (Th, i. e. :), from which it is to be implied NARSINGRAO BH. DIVATIA. that Atman padi roots will take Atmanepada Bijapur District, 10th May 1891. terminations, and also in the fact that the P.S. - I subjoin a few additional points for anther states that in the for and 17 Uktis consideration by Mr. Dhruva when he takes the the verbs take Atmanepada terminations, -a second edition in hand :feature confined to Sansksit, for in Prakrit there (1) At page 5, col. 1, 1.2, the word TTT seems is no such thing as Atmanepada, verbs taking to be misplaced for Para maipada terminations even in the for . The Gujarat Vernacular and tra forms. This is a very strong point, and Society Manuscript also has 3 . But it conwe must conclude that this chapter, although flicts with the sense. Hence the difficulty. giving the original divisions and names of the For 4 is applied in a sentence to the preceding, Uktis, has after all for its main subject matter and not to the succeeding verb. : qt qz. the rules of Sanskpit Grammar and nothing else, Pre s afet; in this instance, given by and is, therefore, in general harmony with the the author, payituM is a verb precedent to Anayati. other portions of the work. Mr. Dhruva will see the necessity here of collat. I have now surveyed the whole scope of the ing several Manuscripte. book, and shewn how and where Mr. Dhruva has (2) Page 12, col. 1. Among the instances of allowed himself to run into error. It is clear rafare the author gives et c : this has been the result of, among other causes, sa ArUvAnarI kSaH This is a curious and an undue baste, which is unaccountable and sur. evidently ungrammatical instance of dissolving a prising. Mr. Dhruva has not had the patience Bahuvrihi. to wait till he could secure more than one Manu. for would have been correct. script for his work. The collation of Manuscripts But the author seems to give instances of gaitf is out of question in that ease. Mr. Dhruva in all the infleotions, even including the nominahimself speaks of another copy in the Jaintive (which is surely ungrammatical). This reBhandar at Ahmedabad, which he did not succeed quires careful consideration. in securing. But he can have had only his own (3) In the chapter on (Voices), **impatience to thank for this. What hurry was par after is a puzzling and peculiar division. there P What reason was there for him to rush si : U qe; here, merely because the this work through the Press before he returned object, su, is in the nominative case and the from the International Congress of Orientalists, to which he he had proceeded as a delegate of H.H. subject that the doer of 9EUR) is not intended to the Gaikwar P Could he not have waited till he be expressed, how does the nature of the for had returned and had had time enough amidst form disappear P This requires more light. " the arduous and multifarious work of an N. BH. D. * See Preface, p. vi. col. 2, para. 1. * See footnote at page 30. - Mr. Dhruva should know, or, will perhaps recognise now, that a single Manuscript cannot be safely rushed through the Press, even if he could rightly call . single Manuscript "M88.", who too often amusingly does.
Page #65
--------------------------------------------------------------------------
________________ MARCH, 1892.] PATTAVALIS OF THE DIGAMBARAS. 57 TIREE FURTHER PATTAVALIS OF THE DIGAMBARAS. BY PROFESSOR A. F. RUDOLF HOERNLE. SOME months ago (see ante, Vol. XX. page 341 ff.) I published two pattavalis of the Digam baras, which were kindly made over to me by Mr. Cecil Bendall for publication. I now publish three more pattavalis of the same Jain section, which I owe to the kindness of Pandit Hari Das Sbastri, who has now been for several years in Jaipur as Director of Public Instruction in that Principality. The originals of these three pattavalis I have been obliged to return to their owners. My account of them is prepared from copies which I got made for me. For reasons of convenience I shall designate them by the letters C, D, E; while the two patta valis published previously I shall refer to as A and B, and Peterson's pattavali as P. The main interest of these new pattavalfs is that they seem clearly to show that there exist two distinct traditions as to the exact course of pontifical succession, differing not inconsiderably from one another. It is true that the pattavali E is so slovenly written as to raise one's suspicions as to its trustworthiness. Thus, in the introduction (see below), among the Ten-Purvins, Prosthila is omitted; but that this is a mere clerical error is shown by the total number 9, at the end of the 3rd paragraph. Again in the Vamsavall proper (see below) three names are omitted between Yasahkirtti and Gunanandin ; viz., No. 9 Yasonandin, No. 10 Devanandin, No. 11 Jayanandin. Here, too, the fact of its being a mere clerical error is shown by the remarki after the entry of Santikirtti (No. 21 of the MS., but really No. 25), that till then there had been 26 pontiffs, thus clearly counting the omitted numbers. But these and other similar marks of error are not sufficient to account for the remarkable difference of pontifical succession, disclosed in the introductory portion of Eas compared with A and C. The first point of difference is, that while both traditions agree in making the length of the introductory period to be 683 years (after Vira), they entirely disagree as to the sub-divisions of that period and the number and identity of the persons composing them. There is no disagreement with respect to the two first sub-divisions ; both gire the same 3 Kevalins for 62 years and the same 5 'Srutakevalins for 100 years. But while A and E enumerate 11 Ten-Purvins for 183 years, E allows only 9 Ten-Purvins, also for 183 years. The names are the same, but E closes the Srutake valins with the ninth on the list of A and C, Buddhilinga, whom it calls Bahudhuli; and it transfers the tenth and eleventh of the list of A and C, to the next sub-division of Eleven-Angins. In the latter sub-division A and C enumerate 5 members with a total of 123 years, while E has in it 6 members with a total of 220 years. The list of names also differs greatly. Further A and C have a sub-division of 4 Minor-Angins for 97 years, and another of 5 One-Angins for 118 years; but E allows no Minor-Angins at all, and has only one sub-division of 6 One-Angins for 118 years. The list of names again differs entirely: in fact, the Minor-Angins of A and Care identical with the One-Angins of E, with the addition of one new name, quite unknown to A and C. On the other hand, all the names of the One-Angins of A and C are unknown to E. The subjoined table will best exhibit these differences, Tradition in A and O. Tradition in E. 1 Gotama 1 62 years, 3 Kevalins 3 2 Sudharman 2 3 Kevalins for 62 years. 3 Jambu 1 Vishaupandin 1 2 Nandimitra 2 100 years, 5 Sratakevalin. 3 Aparajita 3 5 'Srutakevalins, 100 years. 4 Govardhana 4 5 Bhadrabhahu 1.5 1 There is here another piece of slovenliness. The remark is misplaced; it should really come after No. 26 (or No. 22 of the MS.) Meruktrtti.
Page #66
--------------------------------------------------------------------------
________________ 58 Tradition in A and C 183 years, 11 TenPurvins 123 years 97 years 220 THE INDIAN ANTIQUARY. 5 Eleven-Angins 118 years, 5 One-Angins 4 Minor-Angins 1 1 1 Visakha 2 Proshthila 2 3 Kshatriya 3 4 Jayasena 4 5 Nagasena 5 6 Siddhartha 6 7 Dhritisena 7 8 Vijayasena 8 9 Buddhilinga Bahudhuli 9 10 Deva Gangadeva 1 11 Dharmasena 2 1 Nakshatra 3 2 Jayapala 4 3 Pandava 5 4 Dhruvasena 6 5 Kamsa 1 Subhadra. 2 2 Yasobhadra 3 3 Bhadrabahu II. 4 .4 Lohacharya 5 Vinayadhara 6 1 Arhadbalin 2 Maghanandin 3 Dharasena 1 4 Pushpadanta 5 Bhutavali [MARCH, 1892. Tradition in E. 9 Ten-Purvins, 183 years. 6 Eleven-Angins, 220 years. 6 One-Angins, 118 years. Total 683 years. 683 years. The new name is Vinayadhara, the last of the One-Angins according to E, which makes the initial period of 683 years to close with him. A and C know him not; on the other hand, E knows nothing of the five last names of the list of A and C. But there is still another point of difference. Both traditions agree in making the pattavali proper commence with a Bhadrabahu. Who is this Bhadrabahu? From the dates assigned to him by A and C it is quite clear that, for them, he is identical with Bhadrabahu II., who is mentioned as one of the Minor-Angins (or as one of the One-Angins in E) in the introduction and as having ascended the pontifical chair in 492 (or 490) A. V. and 4 Samvat. In E, however, he is said to have ascended the chair exactly 100 years later, i. e., in 104 Samvat. Three distinct names, vis., Sri-Dattasena, Sivadatta and Aradatta, are interposed between him and Vinayadhara, the last of the One-Angins, and he is expressly enumerated as the 30th from Mahavira (counting the latter as the first of the series), while Bhadrabahu, the One-Angin, is placed as the 25th. Undoubtedly their numbers are wrong; the MS. is very carelessly written: they should be the 27th and 33rd respectively; but anyhow they must occupy different places. It is clear, therefore, that in E there are three Bhadrabahus, and that in it Bhadrabahu III. is the beginner of the pattavall proper. I may here add, that the difference of 100 years is carried on in pattavali E down to its No. 7, Yasahkirtti. With its No. 8, Gunananda, that difference has disappeared. But between its Nos. 7 and 8, three names are wanting, which (as I have already
Page #67
--------------------------------------------------------------------------
________________ MARCH, 1892.] PATTAVALIS OF THE DIGAMBARAS. 59 pointed out) should really be in it, for they are counted later on among the 26 pontiffs, who resided in Malwa (sce No. 25, or its own No 21). Now it is a pity that these three names should be missing; for they would show how that difference of 100 years was recovered. One cannot help suspecting, that there must have been some design in the ouission; the object may have been to evade the difficulty of making up the difference. I believe the difference, in this particular point, between the two traditions may be accounted for. It will be noticed, that if the beginner of the pattavali proper of the Sarasvati Gachchha is, as A and C will have it, Bhadrababu II., that Gachchha is only a branch of the main-line that began with Mahavira. The main-line runs on for, at least, 6 further members, throngh Lohacharya, Ahivalli, Maghanandin, Dharasena, Pushpadanta to Bhutavali, with whom it appears (according to the representation of A and C) to have become extinct. Now it is quite possible to identify Ahivalli with Arhadbalin or Guptigupia of No. 2 of the patta vali, and Maghanandin with Maghanandin of No. 3 of the pattavali; and we may assume that Bhadrabahu II. was first succeeded by his disciple Lohacharya, and afterwards by his other disciple Abivalli. Guptigupta (Arbadbalin), who in his turn was succeeded by Maghanandin. But this supposition does not remove the difficulty ; for Maghanandin, the One-Angin, was succeeded by Dharasena in the main-line ; while Maghnnandin, No. 3 of the pattavali, was succeeded by Jinachandra in the pattavali. The difficulty still remains, that the Saraswati Gachchha, after all, is only a side-branch of the main-line, which became extinct with Bhutavali. This difficulty, it seems to me, cannot help having been felt as derogatory to the dignity and claims of the Digambaras ; and the object of the tradition, represented in E, appears to have been to meet the difficulty. By that tradition the main-line is carried on from Bhadra bihu II., through Lobilcharya, Vinayadhara, 'Sridatta, Sivadatta and Aradatta (the last four taking the place of the five One-Angins of A and C) to Bhadrabahu III., who then founds the Sarasvati Gachchha. The latter is thus shown to be the direct continuation of the main-line. And yet, in all probability, the tradition preserved in A and C is the genuine one, that the Sarasvati Gachchha, as well as the three other Gachchhas of the Digambaras, are merely side-branches of the main-line. There is a curious short notice in patlavali E, which quite undesignedly supports this view. After noticing Bhadrabahu, the founder of the Gachchha, E adds that "from him the 'Svetambaras separated and initiated a pattavali of their own." This shows, at all events, that according to E, the Digambaras and Svetam baras separated from the time of Bhadrabahu. Now, if it appeared that the Digambaras were not the main-line but a branch, the presumption would naturally be that it was they who were the schismatics or heretics. Hence the necessity to show that they were the main line, and therefore that the Svetambaras were a branch and schismatics. Hence the fiction of a Bhadrabahu III. But if the tradition of A and C is the genuine one, and the Sarasvati Gachchha, i. e., the Digambaras, was founded by Bhadrabahu II., and if, as tradition E says, the Sretam baras separated in his time, it follows that the Svetambaras were the main-line, while the Digambaras were the branch or seceders. It follows further that that famous separation took place between 490 and 513 A. V. (or 61 and 38 B. C., adjusted, see ante, Vol. XX. p. 360), the period of Bhadrababu's pontificate. And this leads on to another point. All pattavalis agree in representing Maghanandin as the actual founder of the Sarasvati Gachchha, whence it is also called the Amnaya, or Line of Nandin. At the same time they also all agree in making the pattavali proper of the Gachchha to begin with Bhadrabahu, two steps before Maghanandin. This, it appears to me, can have but one meaning: before Bhadrabahu the Jain community was undivided; with him the Digambaras separated from the Svetambaras, but remained united themselves; with Maghanandin the Digambaras themselves separated into four divisions, the most important ? I may here note, that Guptigupta, the successor of Bhadrabahu III and No. 9 of the pattevall, is not really omitted in E, for he is counted among the 26 pontiffs, who resided in Malwa. His omission, in his proper place, is only Another of the many errors of the MS.
Page #68
--------------------------------------------------------------------------
________________ 60 THE INDIAN ANTIQUARY. [MARCH, 1892. of which would seem to have been that named after Maghanandin. This view is distinctly borne out by that curious notice in E, that the 'Sretambaras separated from the time of Bhadrabahu. It is also indirectly borne out by the notice of patravali (in $16, see below), that "the Sitapata or white-robed Sangha arose from the Melasangha." For whether the Malasangha be taken to mean the undivided Jains or only the andivided Digambaras, in any case the notice refers the origin of the 'Svetambaras to a time prior to the Digambara division under Maghanandin. Now, it is well-known that the Diganbaras place the great separation of themselves and the Svetambaras in Sam. 136 (or A, D. 79). This tradition of theirs is not borne out by their own pattavalis, as represented in A, B, C, D. For they place Bhadrabahu in Sam. 4 (or B. C. 53). and even Maghapandin is placed in Sam. 36 (or B. C. 21). Therefore one of two things: either the tradition about the separation in Sam. 136 is false, or the separation took place long after Maghanandin. In the latter case, the Svetambaras separated not from the Mulasangha (or the undivided Digambaras), but only from one of its subdivisional Gachchhas. This latter case is negatived, as already pointed out, by the statements of the pattavalss themselves. It follows that the pattavalis, such as A, B, C, D, contradict the tradition of the great separation in Sam. 136. Now, it seems to me, that the object of pattavali E is to harmonise the two traditions : that the great separation took place under Bhadrabahu, or at least under Maghanandin, and that it took place in Sam. 136. It was apparently thought that this could be done most easily by simply adding one hundred years to Maghanandin's usual traditional date. According to A, B, C, D he succeeded in San. 36; pattavali E turns the year into Sam. 136. It is a clumsy expedient; for, in the first place, it necessitated other changes and even interpolations to account for the additional centary : hence the fiction of a Bhadrabahu III. In the second place, it was only a half-measure; for it placed the great separation under Maghanandin, whereas the patta valis really required it to be placed under Bhadrabhu II. But to have altered the latter's date from Sam. 4 to Sam. 136 would seem to have been considered too violent a measure. We have undoubtedly here two contradictory traditions of the Digambaras disclosed to 09; that of their pattivalis places the great separation considerably earlier than Sam. 136, in the time of Bhadrabahu. The question is who this Bhadrabahu was. The Svetambaras pattavalis know only one Bhadrabahu, who, from the dates assigned to him by the 'Svetambaras and Digambaras alike, must be identical with the Bhadrabahu I. of the Digambaras. Considering the varying and contradictory character of the Digambara traditions, the probability is that the inception of the great separation took place under Bhadrabahu I, who died 162 A. V. according to the Digambaras, or 170 A. V. according to the Svetambaras. The final and definite schism may then have occurred later in Sam. 136 or, according to the 'Svetambaras, Sam. 139. Further, there is another divergence of tradition disclosed in the five pattavalis, now published. This refers not to the succession so much as to the residences or migrations of the pontiffs, and, therefore, of the Digambara sect. On this point, the partivalis A, B, D altogether agree; pattavali E also agrees in the main; bat pattarali presents a considerably different tradition. This may be seen at a glance from the subjoined table. One point of general agreement comes out clearly and is noteworthy, namely, the general direction of the Digambara migration. It was from the South to the North, from Bhadalpur to Dilli and Jaipur. This agrees with the opinion that the Digambara separation originally took place as a result of the migration southwards under Bhadrababu in consequence of a severe famine in Bihar, the original home of the undivided Jaina community. I have not boon & The vetAmbaras place it three years later, in 82 A. D. See my edition of the Uvdeagadaado (Bibliotheon Indion) Vol. II. p. IX. * Or with the adjustment of 8 years (noe ante, Vol. XX. p. 860), 61 B. C. and 44 B. O. respectively. Soo Introduction to my edition of the Uvasagadaado (Bibl. Ind.), Vol. II. p. viii.
Page #69
--------------------------------------------------------------------------
________________ MARCH, 1892.) PATTAVALIS OF THE DIGAMBARAS. 61 to identify Bhadalpur. It is variously spelt. Espells it with the cerebral ( Y), but the others with the dental d, either single (my) or double ( ga). C places it in Southern India (Dakhina), but the others in Central India (Malava). Table of Pontifical Residences, Period. Pattavalla A, B, D. Paltavalt E. PartAvalt C. Bhadalpur (in Malava) 26 pont., No. 1-26 Bhaddalpur (in Malava) 26 pont., Nos. 1-26 Ujjain 25 pont., Nos. 27-51 II and III. Vara (Vadoda) 37 pont., Nos. 27-63 II Malava 26 pont., Nog. 27-52. Bhaddalpuri (in Dakhina) 26 pont. ; No. 1-26 Ujjaint 18 p., Nos. 27-44 Chanderi 4 p., Nos. 45-48 Bhei 3 p., Nos. 49-51 Kundalpur (1 pont., Nos. 52 Vara. 12 pont., Nos. 53-64 I Va Chitor 10 pont., Nos. 65-74 IVb Vigher 4 pont., Nos. 75-78. Ajmero 5 pont., Nos. 79-83 Vara (or Varo) 12 pont., Nos. 52-63 Gvaler 14 pont., Nos. 64-77 Gvaler 15 pont., Nos. 64-78 V Ajmer 5 pont., Nos. 79-83 VI Ajmer 6 pont., Nos. 78-83 Dillt 3 pont., Nos. 84-86 Chitoc, No. 87 Vagvar (in Gujarat) 3 pont., Nos. 84-86 VII Chitor, No. 89 VIII IX Saganer No. 91 Avairi 4 pont., Nos. 92-95 (D) Smerskir (P), No. 90. (D) Chatasa, No. 91 a (D) Saganer, No. 92 b (D) Avor 3 pont., Nos. 93-95 (D) Dilli, No. 96 (D) Jaipur 4 pont., Nos. 97-100 4 XI Dilli, No. 96 XII Jaipur pont., Nos. 97-100 * M8. roada 6 pont., bat gives only o namor.
Page #70
--------------------------------------------------------------------------
________________ 62 THE INDIAN ANTIQUARY. [MARCH, 1892. There is still a third point of interest in the three new pattavalis, now published. They shew that the Digambara tradition of the pontifical succession exists in two different recensions. The two recensions differ, in the main, in a certain number of names and dates. From this point of view the whole of the pattavalis, hitherto published, distribute themselves thus: A, B, D represent one recension (I) and C, E, P represent the other (II). The following two tables exhibit the differences: 1. Table of Differences in Names. Serial Number. 11 Pujyapada............. 19 Harinandin 22 Ratnakirtti 23 Manikanandin (also E) 30 Srichandra (also C)....... 31 Nandikirtti Virachandra I. Recension A, B, D. 35 46 Gunanandin.... 53 Vrishabhanandin 54 Sivanandin 55 Vasuchandra 56 Sishanandin (B, D)........... Sanghanandin (A) 62 Jnanakirtti 66 Sundarakirtti 67 Nemichandra 72 Varaddhachandra 80 Santikirtti......... Serial Number. 5 pontificate 20 25 43 As the full particulars of the dates are given only in the pattavalis A, D and E, the second table will stand thus: 51-10-10, 6- 2-22, 39 intercalary 20, 26 pontificate 44- 3-16, 27 monkhood 12- 0-0, 28 intercalary 15, 33 5, 35 8, 41 householder 8- 0-0, 42 8, intercalary pontificate 16- 6- 0, I. Recension A, D. 2. Table of Differences in Dates. 23 dw 33 39 total 95-10-15 pontificate 41-10-10, 6- 7-22, 25, 46-3-1 32-1-15 intercalary 63-3-29 pontificate 44 3-13, 22-0-0, 33 II. Recension C, E, P. Jayanandin. Simhanandin (E, P). Nayananandin (C). Ratnanandin. 22 Manikyanandin (C, P). Silachandra (E, P). 'Srinandin. dr Vidyanandin. Gunakirtti. Brahmanandin. Devanandin (C, E). Visvachandra (C, P). Siyachandra (PE). Harinandin. Jnananandin (C, P). Gunayananandin (? E). Charunandin. Neminandin. Vardhamana. Visalakirtti. 35-11-20 monkhood 42-4-15 intercalary 43-10-0 II. Recension C. 31, 10, 4, 70-0-12 26-9-20 householder 9- 0-0, 49-1-16 intercalary 41- 5-6 9, pontificate 16-0- 0, total 85-10-15 46-8-1 32- 1-20 63-3-26 45-00 42-5- 1 43-10- 5 70-0-8 27-9-20 49-1-17 40-11- 5 33 39 33 33
Page #71
--------------------------------------------------------------------------
________________ MARCH, 1892.] PATTAVALIS OF THE DIGAMBARAS. 63 Serial Number. I. Recension A, D. II. Recension c. 0. cios householder 11. 0. 0, Total 50. 4-14 | householder 21- 0-0, Total 60. 4-14 monkhood 25- 0-0, 58- 0.0 monkhood 15- 0-0, 48- 0-0 pontificate 3- 4.1, 47. 4. 5 pontificate 2. 4.1, 46- 4- 5 householder 39-0-0, etc. >> 55- 7- 1 householder 7.0.0, 23- 6-24 monkhood 40. (- 0, 51. 8- 1 monkhood 240. O, 35. 8. 1 pontificate 5. 5. 5, etc., 57- 5. 9 pontificate 5. 4-29, etc., 49. 5. 9 householder 10.0.0, 53- 2- 1 householder 14. 0-0, pontificate 4. 1-16, etc. 50- 6-21 pontificate 4. 1. 0, monkhood 37- 0-0, 47- 3-1 monkhood 27- 0-0, 37- 3. 1 intercalary 9, 35- 9- 8 intercalary 7, 35- 9. 6 monkhood 25- 0.0, 38. 4- 1 monkhood 22. 0-0, 35. 4.1 pontificate 2-11-28, 26- 0.1 pontificate 2-11 25-11-21 intercalary 45- 6-21 intercalary 45-6-20 householder 13. 0-0, 47. 3- 9 householder 12- 0-0, 46- 3- 9 monkhood 20- 0-0, >> 33- 5.0 monkhood 2. 0. 0, 15. 5.0 pontificate 2-13-19, 28. 3-23 pontificate 2- 3-16, 28-3-20 monkhood 24. 0. 0, 96-3-15 monkhood 14. 0-0, 86. 3-15 To the above tables I may add that both P and E insert an additional name between Nos. 47 and 48 ; viz., Vasavachandra (E) or Vasavendu (P). In this point C agrees with the other recension of A, B, D), which omits that name. Further E omits No. 79 Prakshantikirtti (or as B, D have it Prakshata kirtti), so that its total number of pontiffs is the same as that in the other lists. This pontiff is also omitted in P, for the "prakhyatakirtti" of the latter is not a name, but a title of No. 78, Vasantakirtti. In this point, too, C agrees with A,B,D. Though I suspect that E, P are correct, as against A, B, C, D, I am unable to account for the divergence. There is a similar discrepancy between the pattavalt C and all others (see below) with respect to the successor of No. 85, Subhachandra. One further point I may note. Pattavalt A is the only one which gives what I have called the Nagor section. All others, B, D, E, P, give the Chitor section. The two sections separated after No. 87. Pattavali C only goes down to No. 85 (or rather No. 86), and stops short just before the schism. From the remark in pattavali D (see below), referring to this schism, it would seem that the two sections took up their residences in Gwaler and Nagor respectively. But patta vali E mentions No. 89, Lalitakirtti, as still resident in Chitor, and with this the passage on the schism in pattavali A agrees. See the passages which are quoted below. This matter of the schism still requires further clearing up.? I now proceed to describe the three pattavalis separately. PATTAVALI C. This pattavali is drawn up on the plan of pattavalt A, i.e. it begins with an introduction detailing the antecedent history of the Gachchha, after which it gives the list of pontiffs, with all the dates of each life in addition to the year of accession. A peculiar feature are the concluding remarks after the introduction (see below SS 16-19) as well as after the pattavalt proper (SS 23-26), which give some curious information regarding the three other orthodox Sanghas, vis., the Deva, Simba and Sena, as well as regarding some (apparently five) heretical or In his Jainamata Vriksha, or Genealogical Table of the Jains, Muni Atmaramji makes the following remark: In Sam. 1572 Rupa Chand Sorana, of his own accord, put on the monk's garb and originated the Negori Lumpaka sect.' This appears to refer to the above-mentioned schiam, though the name of the founder differs.
Page #72
--------------------------------------------------------------------------
________________ 64 THE INDIAN ANTIQUARY. [MARCH, 1892. schismatic Sanghas, viz., the Sitapatta or Svetambara, the Kashtha, the Dravida, the Yapullya or Yapaniya, and the Kekipichchha or Nilpichchha. Paragraphs 16 and 17 appear to me a little confused; it is not clear whether the same or different sects are spoken of; the names are so similar, that the former seems the more probable view. Another peculiarity of pattavali C are the numerous extracts it quotes in support of its statements. Some of them are identical with those quoted also in pattavali A, and these, it now appears, are quoted from the Vikrama Prabandha, a work which I see is mentioned in the Deccan College collection, No. 172. The other extracts are taken from the Nitisara, a work ascribed to Indranandin, a copy of which (No. 371) also exists in the Deccan College collection (see its Catalogue, p. 145). To judge from the name of its author, he should be a member of the Sarasvati Gachchha, to which the surname Nandin is peculiar; but it does not occur, at least, among the names of the pontiffs. In the Gathas, giving the dates of Vikrama's life (see below SS 15), there again occurs the puzzling word rasapana. In my previous paper (see ante, Vol. XX. p. 360) I have suggested that it should be read panarasa, 'fifteen.' From the comment on the gatha in pattavali C, however, it is clear that the reading rasapana is, at least, so far genuine that it already existed for the writer of the pattavali. For he interprets it as meaning "fifty-six." He, evidently, must have taken it as a compound of the two nouns rasa and pana. The former, rasa, is the well-known symbolical expression for 6, while the latter would seem to be a name for 5, though I am not aware of the fact. According to the usual rule of interpreting such symbolic names inversely, the word rasapana would mean 56. It is also to be noted that in pattavali C the line, in which rasapana occurs, reads rajjam kunanti "he reigned," instead of the jajjam kunanti "he performed sacrifices" of pattivali A. If the periods are taken to be consecutive as one would naturally do, the verses, as interpreted in pattavali C, would give king Vikrama a life of 118 years (i. e., 6 + 16 +56 +40)! But possibly 56 years are understood to be the total period of his reign, during the latter portion of which, comprising 40 years, Vikrama was a Jain. If so, there would be a curious coincidence in the fact, that the suggested reading panarasa 'fifteen' would give him a reign of 55 years (ie., 15+40). The line in question would then have to be translated: "for 56 years he carried on his rule being at first attached to heretical doctrines." Here, however, the most significant words "at first" would have to be supplied, not being expressed in any way by the verse itself. I may also note, that instead of the terms viraha or antara, pattavali C occasionally uses the synonymous term antarala; see, e.g., No. 62. The list of pontiffs in this pattavali closes with Subhachandra, who reigned up to Sam. 150, or A.D. 1440, some time before the separation into the Chitor and Nagor lines took place. In the concluding remarks of the pattavali (see SS 23) it is stated that Subhachandra was followed by Sakalakirtti, and from the form of the remark it would seem that he must have been the reigning pontiff, at the time the pattavali was written. This would give it a date somewhere about 1450 A. D., and would make it the oldest at present known; the next oldest being the pattavali P, the date of which must be about 1650 A.D., as it comes down to the pontiff Narendrakirtti (of the Chitor line, see ante, Vol. XX. p. 355). There is a difficulty, however, in the names. Instead of Sakalakirtti, all the other pattavalis (A, B, D, E) give either Jinachandra or Prabhachandra as the successor of Subhachandra. Moreover pattavalt C gives Vagvar in Gujarat as the residence of Sakalakirtti as well as of Padmanandin and Subhachandra, while the other pattavalis (A, B, D, E) give Dilli as the residence of the two last mentioned pontiffs, as well as of 'Subhachandra's successor (see the list above). I am unable to clear up this difficulty; but it may be noted that there are in pattavalf C itself indications that a pontiff may have borne two quite distinct names. In the same SS 23, there is mentioned a pontiff Naren Catalogue of the Collections of Manuscripts deposited in the Deccan College, by Prof. Bhandarkar, p. 50, (Bombay 1888).
Page #73
--------------------------------------------------------------------------
________________ MARCH, 1892.] PATTAVALIS OF THE DIGAMBARAS. 65 drakirtti, who, from the connection in which his name appears, must have been the immediate successor of Jnanakirtti, Maghachandra and Surachandra (i.e., Nos. 60, 61, 62). Accordingly he must be No. 63, who in the nominal list of C, no less than in all others, is known as Gangakirtti. Similarly, we have in $23a Kanakakirtti and a Proshthilakirtti, who would clearly seem to be identical with Nos. 65 Hemakirtti and No. 79 Prakshintikirtti. There is, however, another difficulty in the account given in $ 23, which I am unable to solve. That account of the ponti. fical succession does not agree with the pattavali which precedes it. The four pontiffs Surachandra, Mahachandra, Jnanakirtti, and Narendrakirtti are made to follow Vasantakirtti, whereas in the pattavali they preceded him by a long interval. Again in SS 23 Vasantakirtti is made to be the 9th after Kanakakirtti, whereas in the pattivali (if Kanaka is the same as Hema, No.65) he is the 13th after him. The table of residences, however, should be compared. The introductory and concluding portions I again give in extenso, but the pattavali proper, as before, in abstract tabular form. The bracketed remarks in the last column of the tables are again my own. TEXT. Introduction of Pattavalt c. (1) oM namaH siddhebhyaH / / avAra paJcamA kAla virSe zrImahAvIra svAmI ke mukti hue pIche vA kI hINatA kAladoSa te bhaI hai| jA te yA ke pAra giNatI ke AcArya bhae hai, so anukrama se prasaGga kari kiJcita varNana kariye hai| (2) anta ke tIrthakara mahAvIra svAmI kU~ mukti bhae pachai bAsaThi 62 varSa tAI kevalajJAna rahyA, so kahiye hai| jaba zrIvardhamAna svAmI. mukti bhaI, tisa pIchai zrIgautama gaNadhara * kevalajJAna upanyA / so vAraha varaSa 12 paryanta rahyA / / vahari tA ke pIche sudharma svAmI kU~ kevalajJAna upajyA / so bhI vAraha varSa tAI kevala rahyA / / bahuri tA ke pIche jambU svAmI kU kevalajJAna utpanna bhayA / so varSa 38 aDatIsa tAI rahyA / aisai bAsaThi varSa tAI kevala - jJAnI tIna pazcama kAla virSe pravartyA / / (3) vahari tA ke pIche gyAraha aGga caradaha pUrva ke dhAraka anukrama sai pA~ca zrutajJAna ke pAThI zrutakevalI huvaa|| tA meM prathama viSNukumAra varSa 14 caudaha / vahari nandimitra varSa 16 solaha / vahuri aparAjita varSa 21 / vahuri govarddhana varSa 19 ugaNIsa / bahuri bhadravAha varSa 29 guNatIsa // aiseM 100 eka sau varSa paryanta yA kA kAla anukrama te rahyA / / ihA~ tA~I zrImahAvIra svAmI kU~ mukti gayeM eka so vAsaThi 162 varSa jaannaa| (4) bahuri tA ke pIche gyAraha aGga daza pUrva ke dhAraka gyAraha muni bhayA / tA ko kAla varSa 183 eka so tirAsI ko anukrama te hai| tA maiM vizAkhAcArya varSa daza 10, proSThilAcArya varSa 15 pandraha, nakSatrAcArya varSa 17 sataraha, nAgasenAcArya varSa 18 avAraha, javasenAcArya varSa ikavIsa 21, siddhArthAcArya varSa 17 saptadaza, dhRtisenAcArya varSa 18, vijayAcArya varSa teraha 13, buddhilikAcArya varSa 20, devAcArya varSa 14 caudaha, dharmasanAcArya varSa se laha 16 / / aise yA~ kA 1eka so tiyAMsI varSa kA anukrama te kAla kA vartamAna hai|ihaaN tA~I zrImahAvIra ku~ mukti gaye varSa 345 tIna se patAlIsa bhae jAnanA // (5) vahuri tA ke pIche gyAraha aGga ke pAThI pA~ca muni bhae / / tA maiM nakSatrAcArya tau zrImahAvIra te tIna sai paMtAlIsa varSa pAchai huvA, varSa 18 aThAraha tAI rahyA // bahuri mahAvIra te tIna sai taresaThi varSa pI. jayapAla nAma AcArya bhayA / tina kA vartamAna kAla varSa vIsa 20 kA hai| vahuritA ke pIche tathA zrImahAvIra nAtha te tIna sai tiyA~sI varSa 383 pIche pANDavAcArya bhayA / tA kA vartamAna kAla varSa guNatAlIsa 39 kA rahyA / / bahuri tA ke pIDai tathA zrIvarddhamAna tIrthaGkara te 522 cyAra se bAIsa varSa pIche dhruvasenAcArya huvA / tA kA vartamAna kAla varSa caudaha kA hai / / bahuri tA ke pIche zrIsanmati pIDai 436 cyAra se chatIsa varSa gaye kaisAcArya bhae / tA kA vartamAna varSa vattIsa 32 kA hai / aiseM pA~cU AcAryani kA anukrama se varSa eka sau teIsa 123 jAnanA / / e sarva kevala ekAdazAkadhArI hai| (6) vahuri zrImahAvIra svAmI pIche cyAra sA bhaDasaThi 168 varSa gaye subhadrAcArya bhae / tA kA vartamAna kAla ke varSa chaha 6 // vahuri tA ke pIche tathA zrImahAvIra svAmI pIche cyAra se cahauttara 474 varSa gaye yazobhadrAcArya bhae / tA kA vartamAna kAla ke varSa 18 agaraha hai / vahuri tA ke pIche tathA zrIvIra nAtha kU~ mukti huvA pIche 492 cyA. ra sau vANavai varSa gaye dUsarA bhadravAha nAmA bhAcArya bhae / yA kA vartamAna kAla varSa 23 teIsa kA hai / / bahuritA ke
Page #74
--------------------------------------------------------------------------
________________ 66 THE INDIAN ANTIQUARY. [MARCH, 1892 pIche tathA vIra svAmI pIDai 515 pA~ca sai pandaraha varSa garthe lohAcArya bhyeN| tA kA vartamAna kAla paccAsa varSa kA hai| aisa cyArUM hI AcArya kA varSa satthAnavai 97 kA hai| yaha cyAhI bhAcArya anukrama saiM eka eka bhAkai ghATi pAThI huye hai / dasa-nava-ATha-sAtamA bhaGga ke pAThI tAI huye| (7) vahari tA ke pIche eka aMgake pAThI pA~ca munivara hote bhae / tA kA vistAra // zrIvarddhamAna svAmI * muktidaye pIche pAMca se pasaThi 565 varSa gaye ahahali AcArya bhae | tA kA vartamAna kAla varSa 28 bhaSTAviMzati kA hai| vahari sA kaipIcha tathA vIra jinezvara pIche pA~ca sai tirANavai 593 varSa gae~ mAghanandi bhAcArya bhye|taa kA vartamAna varSa 21 ikkIsa kA hai / vahari tA ke pIche tathA zrIsanamati nAtha pIche chaha saikIdaha 614 varSa gaye dharasenAcArya bhye| tA kA vartamAna kAla gunnIsa varSa kA hai / vahuritA ke pIche tathA zrIvIra bhagavAna ku~nirvANa bhayeM pIche chaha se tetIsa 63 varSa bhukte puSpadantAcArya bhaye |taa kA vartamAna kAla varSa 30 tIsa kA bhyaa| vahari sA ke pIche tathA zrI. mahAvIra pIche chaha sai tiresaThi 663 gaye bhUtavalyAcArya bhaye / tA kA vartamAna kAla 20 vIsa varSa kA bhayA / aise anukrama te bhaye / vahari zrImahAvIra svAmI ku~ mukti gaye pIche chaha se tIyAsI 65 varSa tAI pUrva bhaGgakI paripAThI calI / phira anukrama kari ghaTatI rhii| aura pUrvokta bhailyAcAryAdi pA~ca bhAcArya kA vartamAna kAla eka sI aThAraha 118 varSa kA hai / / ihA~ tAI ekAga ke dhArI muni bhaye haiN| (8) vahari tA ke pIche zrutajJAnI muni bhaye / bhaGga ke pAThI nAhI bhae / aise bhAcAryani kI paripAThI hai / (9) taduktaM gAthA // antimajiNivvANe kevalaNANI ya goyama munnindo| vAraha vAse gaye sudhamma sAmI ya saMjAdI // 1 // taha vAraha vAse ya puNu saMjAdo jambusAmi munniraao| aDatIsa vAsa paThio kevalaNANI ya ukkiho // 2 // vAsaThi kevalavAse tiNha muNi goyama mudhamma jambU ya / vAraha bAraha vacchara tiya jugahINaM ca cAlIsaM // 3 // sabakevali paJca jaNA vAsaThi vAse gaye musaMjAdA / paDhamaM caudaha vAsaM viNhukuvAraM muNeyadhvaM // 4 // nadimitta vAsa solaha taya aparAjiya paraM huvAvIsaM / igahINavIsa vAsaM govaNa bhahavAhu guNatIsaM // 5 // sada suya kevalaNANI paJca jaNA viNhu nandimittI ya / avarAjiya govaddhaNa [ya] bhavavAhUya saMjAdA / / 6 / / 1"antimajiNaNivvANe tayasaya paNacAla vAsa jAde / ekAdahanadhAriya paNNa jaNA muNivarA jAdA / / 7 // Nakkhatto jayapAlaga paNDava dhuvaseNa kaMsa aayriyaa| ahAra vIsa vAsa guNacAla ya coda vattIsaM // 8 // sada tevIsa ya vAse eyAdaha aGgadhAriNI jAdA / vAsaM sattANavadi ya saGga-nava-aThadhaga jAdA // 9 // loka prAkRta // subhadaM ca jasobhaI bhahavAI kameNa ya / lohAcajja muNIsaM ca kahiyaM ca jiNAgame // 10 // chaha bhahAraha vAse tevIsa bAvaNa varasa muNiNAhA | daha-nava-ahadharA vAsa dusada vIsa majjhesa // 11 // 9 Read vdee metri causa, 10 MS. 'vaaso| 11 Forrar 12 MS. TI 18 Not in MS., but some such addition is required by the metre. are omitted in the Ms. MMS. tara saya paNNaThi, which fita neither sense nor metro. MMS, priv| 83. IBMS. sttaannivdi| Here three verses MS. tAyAsi
Page #75
--------------------------------------------------------------------------
________________ MARCH, 1892.] PATTAVALIS OF THE DIGAMBARAS. 67 paJca saye paNNa antimajiNasamaya jAde su| uppaNNA paJca jaNA iyaGgadhArI muNeyadhvA / / 12 // bhavalimAhaNandi ya dharasaNaM pupphayanta bhuudvlii| aDavIsaM igavIsaM ugaNIsaM tIsa vIsa puNa vAsA / / 13 / / igasaya aThAra vAse igadhArI ya muNivarA jArA / cha saya tirAsi ya vAse NivANA aGgachitti kahiya jiNe // 14 // aise vikrama prabandha vi likhA hai| yaha pUrvokta prakAra zrImahAvIra svAmI se leya kari jinamata virSe anukrama se AcAryani kI paripAThI hai| (10) vahari zrIvIra svAmI kU~ mukti gaye pIDai cyAra se sattara 70 varSa gaye pIche zrImanmahArAja vikrama rAjA kA janma bhayA / / vahari pUrvokta subhadrAcArya te 20 vikrama rAja ko janma hai / vahari vikrama ke rAjapada maiM varSa catvAri 4pIche pUrvokta dUsarA bhadravAhu * AcArya kA paha huvA // bahuri bhadravADDa kA siSya gupti nAma / tA ke nAma tIna / guptagupti 1 ahavali 2 vizAkhAcArya 3 // bahuri jA ke cyAra 4 siSya / nandi nAma jAti ke vRkSa ke adhobhAga ke vikheM cAturmAsa kA varSA yoga dhArayA aisA mAghanandi AcArya jI nai nandisaGka sthApita kIyA // 1 // bahuri jA meM tRNatala viSai varSA yoga sthApita kIyA, so jinasena nAma senasaGga sthApita kiiyaa||2|| vahari siMha kI guphA virSe varSA yoga dhAracA, jA te siMhasaGga sthApyA ||3||vhri jAnai devadattA nAmA vezyA ke gRha ke viSa varSA yAMga dhArapA, so vasaGka bhayA / aiseM jinamata maiM pA~camA~ kAla viSa AcAryani ke cyAra saGgha bhae / / (11) bahuri pUrvokta nandisaGgha ke viSai nandisaGgha 1, pArijAta gaccha eka 1, valAtkAragaNa, cyAra muni ke nAma kahiye nandi candra 2 kAtti 3 bhUSaNa 4, aise sthApita bhaye / / tathA zrImUlasaGkananyAnAya 1 sarasvatI gaccha 1 balArakAragaNa 1, aise cyAra 4 / vahari pUrvokta nandi 1 candra 2 kIrti 3 bhUSaNa 4, aise cyAra muni ke nAma sthApe / / (12) taduktaM zrIindranandi siddhAnto kRta nItisAre / / zloka / / arhadalI guruzcakre saDasaDanaM paraM // 1 // siMhaso nandisaH senasaDI mahAprabhaH / devasaddha iti spaSTaH sthAnasthitivizeSataH // 2 // (13) vahari zrImahAvIra svAmI pIche 492 cyAri se vANavai varSa gaye subhadrAcArya kA vartamAna va 24 cauIsa, so vikrama janma te vAvIsa varSa / / vahari tA kA rAjya te varSa 4 cyAra dusarA bhadravAha huvA jAnanA // (14) vahari zrImahAvIra nai cyAra se sattara 470 varSa pachi vikrama rAjA bhyo|taa ke pIche ATha varSa paryanta vAlAkrIDA kari / tA ke pIche solaha varSa tAI dezAntara viSai bhramaNa kari / tA ke pIche chappana 26 varSa tA~I rAja kIyo nAnAprakAra mithyAtva ke upadeza kari saMyukta rahyo / vahuri tA ke pIche cAlIsa varSa tA~I pUrvamithyAtva . choDi jinavara dharma kU~ pAla kari devapadavI pAI / / aise vikrama rAjA kI utpatti Adi hai| (15) taduktaM vikramaprabandhe / gAthA / / sattari cadusarajutto tiNa kAle vikkamo havaha jammA / aTha varasa vAlalIlA soDasa vAse hi bhammie dese // 1 // rasapaNa vAsA rajja kuNanti micchaavdessNjutto| cAlIsa vAsa jiNavaradhamma pAle ya murapayaM lahiyaM // 2 // (16) aise zrImUlasA ke virSe gaNa-gaccha-sakha-Adi nAnA prakAra kI bhaI hai / / taduktaM nItisAre kAvyaM / / pUrva zrImUlasaGgAttadanu sitapaTaH kASThasazastato hi / tatrAbhUdAvirAkhyaH punarajani tato yApulI saja ekH|| tasmin zrImUlasa munijanavimale sena nandI ca sjii| sthAtAM siMhANyasako 'bhavadurumahimA devasaGgazcaturthaH // 2 // W Ms. bhuutvlii| 2. Here the date is wanting in the MS. 1 Ms. valAtkAraguNa / 22 Metre: Sragdhard.
Page #76
--------------------------------------------------------------------------
________________ 68 THE INDIAN ANTIQUARY. [MARCH, 1892. bahuri aise hI pUrvazrImUlasaha virSe prathama dUsarA svetapahI gaccha bhayA / / bahuri tA ke pIche kASThasaka bhayA / bahuri tA ke pIche drAviDa gaccha bhayA / vahuri tA ke pI yApulIya gaccha bhayA / (17) bahuri ityAdika gaccha pIche ketaka kAla pIDai svetAmbara bhayA / bahuri yApanIya gaccha, kekipiccha, svetavAsa, ni:piccha, drAviDa, yaha paJca saja jainAbhAsa kayA hai / jaina kA sA cihAbhAsa dIse hai / so yA nai apaNI apaNI buddhi ke anusAra kari siddhAntA~ kA vyabhicAravarNana kahyA hai| zrIjinendra kA mArga . vyabhicArarUpa kiiyaa| naduktaM nItisAre / loka / / kiyatyapi tato'tIte kAle zvetAmbaro'bhavat / drAviDo yApanIyazca kekIsaGgazca maantH||1|| kekIpicchaH zvetavAso drAviDo yaapuliiykH| ni:picchazceti pacaite jainAbhAsAH prkiirtitaaH||2|| svasvamatyanusAreNa siddhaantvybhicaarnnN| viracayya jinendrasya mArga nirbhedayanti te // 3 // aise jAnanA // (18) ihA~ koI pUche / pUrva nandi-candra-kItti-bhUSaNa-Adi, nandisaddha bahuri senasana bahuri devasaGga bahuri siMhasana Adika lyA, so inake AcArya jude jude bhae ? tA kI mAnya kaise hai? yA maiM paraspara bhedabhAvarUpI mAnya hai, ki eka mAnya hai ? / / tA kA uttara / pUrvokta gaNagacchArika bhae haiM, so para kai mukhAtA bhae hai / yA kai viSa koI bhI tahA~ bheda nA~hI hai| aura pravrajyAdi karma ke virSe bhI samAnatA hai| aura jo pUrvokta zrImUlasaDa ke viSa catuHsaGgha ke bheda, AcAryani viSai jo bhedabhAva karai hai, so samyakadarzana te rahita hai, mithyAvRSTi hai, vahari so saMsAra ke mA~hi cirakAla saMcarai hai / jA te yaha catuHsaGgha ke virSe pratimA ke bheda, bahuri prAyazcittAdi karma kA bheda, bahuri AcAra kA bheda, bahuri vAcanAdi zAstrani kA bheda, koI kai bhI paraspara juza bheva nA~hi, sarva eka hI hai / yA te yA maiM je bhedabhAva rAkhai hai", so samyakadarzana te rahita hai', mithyAtvI hai , dIrghasaMsArI hai / vahari pUrvokta catu:saGga sahita pratiSThita ji. napratimA, tA meM aura sandeha nahIM karanA // yA te anya hai, so viparyayarUpa hai| bhAvArtha / catuHsaja kari pratiSThita jo jinavimba so pUjanIka hai / yA te anya kahiye svetAmbarAdika kalpita pratimA hai, so viparyayarUpa hai| ( 19 ) taduktaM nItisAre / / zloka // gaMNagacchAdayastebhyo jAtAste prsaukhydaaH| na tatra bhedaH kopyasti pravajyAdiSu karmasa // 1 // catuHsajenaro yastu kurute bhedbhaavnaaN| sa samyagdadhanAtItaH saMsAre saMcaratyaraM // 2 // ma tatra pratimAbhedo na praayshcittkrmnnH| mAcArapAcanApayavAcanAsu vishesstH||3|| catuHsana mahitaM jinabimbaM pratiSThitaM / mamenAparasIyaM yato nyaasvipryyH||4|| ( 20 ) aise pUrvokta prakAra bhadravAha bhae / tA ke pIche aura AcArya anukrama te bhae hai, so kizcit mAtra bhadrapAha se le kara yoM kA varNana anukrama se likhiye hai| vikrama rAjA dUM rAjyapadastha ke dina te saMvat kevala ke caitra eka 14 caturdazI vine zrIbhadravAha bhAcArya bhaye / tA kI jAti prAmaNa / gRhastha varSa 24 cauvIsa / dIkSA varSa 3. tIsa / pAvarSa 22 vAIsa ke upari mAsa 10 daza dina 27 sattAIsa vahari virahadina 3 / tina kA sarvAnuvarSa chihattara 76 / punarmAsa 11 gyAraha / / (21) vahari tA ke pIche saMvat kevala chahavIsa 26 kA phAlguna zukla 15 caturdazI dina maiM gumagupti nAma bhAcArya jAti paravAra bhaye / sA kA gRhastha varSa 22 vAIsa kA / bahuri dIkSAvarSa 14 caudaha / pahasthavarSa 9 nau, mAsa 6 chaha dina 25 pacIsa. viraha dina 5 pA~ca / yA kI sarvAyuvarSa paisaThi 65 mAsa sAta 657 kA jAnanI / / "MS. svetvaasH| 24 The reading of the text is not quito reliable here.
Page #77
--------------------------------------------------------------------------
________________ MARCH, 1892.) PATTAVALIS OF THE DIGAMBARAS. 69 . Here follows the remainder of the patta vali, which I omit. The method of each entry is sufficiently shown by the two initial entries above quoted. But the substance of the whole I again give in a tabular form below. The final entry runs as follows: (22) bahuri tA ke pIche picyAsImA~ paha saMvat 1550 codaha se pacAsa kA mAgha zukla paJcamI 53 puAbhacandramayA sA kA gRhasthakAla kA varSa 16 solaha, dIkSAvarSa 14 caudaha, pahasthavarSa 56 chappana mAsa 3 tina dina 4 cyAra viraha dina 11 gyAraha sarvAyuvarSa 86 DiMyAsI mAsa 3 mIna dina pandraha 15 kI bhaI / ityAdika padAvalI jAnanA / / ___(23) tA ke pIche bhadrabAhu sau lera merukItti tAI paha chavIsa paryanta dakSipadeza virSa bhahalapurI meM bhae // 26 // vahari mahIkIti bhAdi lera mahIcandrAnta tA~I chavIsa paha mAlavA virSe / tA maiM bhaThAraha 18 ujjainI maiM bhaye / candarI ke virSe 4 cyAra bhae / bhela maiM 3 tIna bhae / kuNDalapura eka bhae 1 / / yaha sarva chabbIsa 26 bhae / bahuri tA ke pI, vRSabhanandi Adi siMhakIti anta tAI paha vAraha 12 vArauM viSai bhae / / 12 / / vahari tA ke pIche kanakakIrti Adi vasantakIya'nta paha daza 10 cItoDa kai viSa bhae / / 10 / / vahuri sUracandra 1, mASacandra 1, jJAnakIrti 1, narendrakIrti 1, ye cyAra paDa vaSerai bhaye / 4 / / bahuri proSThilakIrti Adi prabhAcandrAnta paha 6 chaha. ajamera bhaye / 63 / bahuri pagranandI Adi bhacandrAnta paha2 doya gujarAtadeza vi vAgvara deza mai bhaye / vahari sakalakAtti Adi vAgvara deza meM bhe| aiseM zrImUlasavA nandyAnAya sArasvatIgaccha balAtkAragaNa kI pahAvalI anukrama meM jAnanA aisai / / ___(24) aura senaMsaddha 1, siMhasaGka 1, devasA kI 1 pahAvalI judI hai| senasaGga maiM jinasena Adi aise hI sarvatra junI juhI pahAvalI AcAryani kI hai / tA ke virSe senasA maiM rAja, vIra 2, bhadra, sena 4. aisecyAra nAma hai| bahuri siMha 1, kumbha 2, Azrava 3, sAgara 4, aise vyAra 4 saGga ke nAma siMhasA meM hai| pahari deva 1, itta 2. nAga 3, laGga, aiseM siMhasakate aura cauthA devasaddha vi cyAra nAma hai // (25) bahuri pUrvokta senasaGga viya senasaGka puSkaragaccha, sUrasthagaNa jAnanauM / bahuri siMhasa candrakapATa gaccha kANUragaNa siMhasaka virSe hai / / bahuri devasaddha pustakagaccha dezIgaNa yaha devasaddha virSe hai| (26) taduktaM gAthA / / NandI cando kittI bhUsaNa NAmA0hi pnsijst| seNo rAjora vIro bhaho taha seNasahussa // 1 // siMho kumbho Asava sAyara nAmA hi siMhasAssa / debho datto nAgo laGgo taha devasahassa // 2 // ityAdi digambarAnAya virSe AcAryani kI paripAThI jAnanA / / TRANSLATION. Om! Salutation to the Perfect ones! In the fifth period, after the death of the Lord Mahavira, its decadeace took place on account of the badness of the times. Of the several pontiffs who came after him, I am going to give a brief account in their proper order. $ (2) After the death of the last Tirthan kar, the Lord Mahavfra, for 62 years, there abode Kevala-jiminins. These I now name. After the Lord Vardhamana had died, the Gapadhara Gautama attained the knowledge of Kavalin. He abode for 12 years. After him the Lord Sudharnman attained aKevalin's knowledge. He too, abodeas a Kevalin for 12 years. After him the Lord Jamba attained the knowledge of a Kevalin. He abode for 38 years. Thus, for 62 years there lived three Kevalins in the fifth period. $ (3) After this, there came in syccession five Srutakevalins, men versed in sacred lore, who possessed a knowledge of the eleven Angas and the fourteen Parvas. . Among them first was VishyakumAra (who abode) for 14 years after him (came) Nandimitra for 16 years: next Aparajita for 22 years; next Govardhana for 19 years; next Bhadraba hu I. for 29 years. Thus their total period extended to 100 years. Up to this point of time 162 years must be understood to have passed since the death of the Lord Mahavira. MS. baat. Ms. jaane| Ms. rjo| MS. taheva . m.
Page #78
--------------------------------------------------------------------------
________________ 70 THE INDIAN ANTIQUARY. [MARCH, 1892. (4) After this, there came eleven Munis who possessed a knowledge of eleven Aigas and ten Purvas. Their total period extended to 183 years. Among them the Acharya Visakha (abode) for 10 years, Proshthila for 15, Nakshatra for 17, Nagasena for 18, Jayasena for 21, Siddhartha for 17, Dhritisena for 18, Vijaya for 13, Buddhiliuga for 20, Deva for 14, Dharmasena for 16. Thus the total period of these men extended to one hundred and eighty-three years. Up to this point of time 345 years must be understood to have passed from the death of Mahavira. (5) After this there came five Munis, who (only) possessed a knowledge of the eleven Augas. Among them the Acharya Nakshatra arose 345 years after Mahavira, and abode for 18 years. Next, 363 years after Mahavira the Acharya, named Jayapala, arose. His period comprised 20 years. After him, and 383 years after Mahavira, the Acharya Pandava arose, and his period took up 30 years. After him, and 422 years after Mahavira, the Acharya Dhruvasena arose. His period was 14 years. After him, and 436 years after Mahavira, the Acharya Kaisa arose. His period was 32 years. Thus the total period of these five Acharyas extended to 123 years. All these only. possessed a knowledge of the eleven Angas. (6) Again 468 years after the Lord Mahavira there arose the Acharya Subhadra. His period was 6 years. After him, and 474 years after the Lord Mahavira, there arose the Acharya Yasobhadra. His period was 18 years. After him, and 492 years after the death of Viranatha, a second Acharya named Bhadrabahu (II.) arose. His period was 23 years. After him, and 525 years after Virasvamin, came the Acharya Loha. His period was 50 years. Thus, the period of all these four Acharyas was 97 years. Each of these four Acharyas knew one Aiga less than his predecessor; their knowledge extended as far as the tenth, ninth, eighth and seventh Angas respectively. (7) After this there came five Munis, who possessed a knowledge of one Anga (only), They are the following: 565 years after the death of the Lord Vardhamana there arose the Acharya Arhadbalin. His period was 28 years. After him, and 593 years after Vira, the chief of the Jinas, there arose the Acharya Maghanandin. His period was 21 years. After him, and 614 years after Sanmati Natha, there arose the Acharya Dharasena. His period was 19 years. After him, and 633 years after the blessed Vira, there came the Acharya Pushpadanta. His period was 30 years. After him, and 663 years after Mahavira, there came the Acharya Bhutavali. His period was 20 years. Thus they followed one another; and the traditional knowledge of the Angas and Purvas went on, till the year 683 after the death of the Lord Mahavira, but it gradually decreased. The total period of the above named five Acharyas, Arhadbalin and the others, extended to 118 years. Up to this point of time there lived Munis, who possessed the knowledge of (at least) one Anga. (8) After this there were only Munis, who were Srutajianins, (i. e., who knew of the sacred lore only by hearsay). Of such as were actually able to recite an Auga, there was none. The above is the traditional enumeration of the Acharyas. (9) On this subject there are the following Gathas: (See the translation, ante, Vol. XX. p. 347ff. The gathas are the same as those cited in pattavali A, except that the three verses describing the Third period of the Ten-Purvins are omitted in pattivali C, apparently by a mere oversight of the scribe.) Thus it is written in the (work called) Vikrama Prabandha. This gives the traditional enumeration of the Acharyas of the Jain religion, as they followed in regular order after the Lord Mahavira. (10) Now in the year 470 after the death of the Lord Vira the birth of King Vikrama took place. Now it took place [2 years]29 after the above-named Subhadra Acharya's (accession to the pontificate). Again the accession to the pontificate of the above-named Acharya 29 The bracketed clause is wanting in the original text, probably by a mere oversight of the scribe.
Page #79
--------------------------------------------------------------------------
________________ MARCH, 1892.) PATTAVALIS OF THE DIGAMBARAS. 71 Bhadraba hu II. took place 4 years after Vikrama's aceession to the throne. Further Bhadrabahu II. had a disciple named Gupti. The latter had three names, viz., 1, Guptagupti30, 2, Arhadbalin, 3, Visakhacharya. Further he had four disciples, viz., 1, one who used to keep his fourmonthly rainy season's retreat in the hollows) lower part of a tree of the Nandi species ;- this was the Acharya Maghanandin, who founded the Nandi Sangha : 2, one who originated the practice of keeping the rainy season's retreat under bushes ;31 he was called Jinasena, and founded the Sena Sangha : 3, one who tised to keep his rainy season's retreat in the hole of lion,.hence he founded the Simha Saigha : 4, one who used to keep his rainy senson's retreat in the house of a courtenan named Devadatta; (he founded) the Deva Sangha. Thus, there arose four Sanghas of Acharyas in the Jain religion during the fifth period. (1) Further in the before-mentioned Nandi Sangha there were the following names in use (for the Saogha): 1, Nandi Sangha, 2, Parijata Gachchha, 3, Balatkarn Gana: and the following four names for the Munis, viz. 1, Nandin, 2, Chandra, 3; Kirtti, 4, Bhushana. Also the following four (names for the Saigha) were in use: 1, Sri Mula Saigha, 2, Nandi-Amnaya, 3, Sarasvati Gachchhn, 4, Balatkara Gana; and the four already-mentioned names for Munis: 1, Nandin, 2, Chandra, 3, Kirtti, 4, Bhushang. (12) On this subject the following slokas occur in the Nitisara, a work of Indranandin : The Guru Arhadbalin effected the excellent combinations into Sanghas: the Simha Saigha, the Nandi Sangha, the famons Sena Sangha, and the Deva Sangha, which are well know to be distinguished by the places of their establishment.33 (13) Further the year 492 after the Lord Mahavira, which was the 24th year of Subhadra's pontificate, was also the 22nd year after the birth of Vikiama. Again in the fourth year of the latter's reign Bhadrabahu succeeded to the pontificate. (14) Now 470 years after Mahivira King. Vikrama was born. Afterwards he passed 8 years in child's play ; next he spent 16 years in wandering over different countries; next he passed 56 years in ruling (his own country), being at the same time) devoted to varions sorts of beresy : finally having abandoned his earlier heresies and fostered tho Jain religion for forty years, he obtainea admission among the gods. Thus was the birth, etc., of King Vikrama. (15) On this subject there are the following Gathas in the Vikrama Prabandha : "It was the year 470 when the birth of Vikrama took place. For eight years he played as a child; for sixteen he roamed over the country; for fifty-six he exercised rulo, being given over to false doctrine; for forty years he was devoted to the religion of the Jina and then obtained heaven." (16) Thus there arose in the Mola Sangha Ganas, Gachchhas, Sanghas, and such like (distinctions). On this subject there is the following verse ir the Nitisira : " First there aroso from the Mula Saugba the Sitapata (or white-robed) Saugha, and then the Kishtha Sangha. Then there arose the so called Dravida (Saugha), and then again a certain Yapuli Saugba. In that Mula Sangha, adorned by many Munis, there was the Sona and the Nandi Sangha; also the Sangha of wide reputation, which was called after Simha; and as the fourth there was tho Deva Sangha." Thus then in the original Mala Sangha there arose first another sveta Parti, or "whiterobed," Gachchha, after that there came the Kashtha Sangha, after that the Dravida Gachchha, and finally the Yapuliya Gacltchba. (17) Further, some time after the above-mentioned Gachchhas the Svetambaras came into existence : also the Yapaniya Gachchha, the Kekipichchba, the Svetavisa, the Nibpichchha, and the Dravida. These five Sanghas are called false Jains. They adopt marks in imitation 10 Or rather, Gaptigupta. 01 Text: trinta-tala vishai, lit. at the foot of grassos.' * Referring to the places probably, where the several retreats used to be kept in the rainy seasons.
Page #80
--------------------------------------------------------------------------
________________ THE INDIAN ANTIQUARY. [MARCH, 1892. of the Jains; but they, drawing on their own imagination, hold tenets in variance with the Siddhantas (or Holy Scriptures), and follow practices contrary to those of the Jinendra (or founder of Jainism). On this subject, there are the following slokas in the Nitisara : 72 "Then after the lapse of some time there arose the 'Svetambara, the Dravida, and the Yapaniya (Sangha), as well as the Keki Sangha through arrogance. The Kekipichchha, the Svetavasa, the Dravida, the Yapuliyaka, and the Nibpichchha; these five are well-known as being false Jaina sects, Having in reliance on their imagination, elaborated practices in variance with the Siddhantas, they have caused divisions in the religion of the Jinendra." Thus it should be understood 33 (18) Here the question may be asked: "It has been mentioned that there are (Acharyas called) Nandin, Chandra, Kirtti and Bhushana, and that there are the four Sanghas called Nandi, Sena: Deva and Simha, now do the Acharvas of these Sanghas differ among themselves? In what estimation should they be held? Are they to be considered as differing among themselves, or are they to be considered as one ?" To this the following answer (is to be given) :- "The Ganas, Gachchhas, etc., which, as above mentioned, have arisen, have been the channels of eternal happiness. Among them there exists no sort of difference; and in their mendicant and other practices they are alike. And as to the above-mentioned four Sanghas into which the Mula Sangha is divided, if any one make a difference between the Acharyas, he is devoid of truth and is a heretic; moreover such people have for a long time been leading a worldly life. Therefore in these four Sanghas there is no difference of images, nor any difference in penitential and other practices, nor any difference of rules, nor any difference in their teaching and in their scriptures; in no single point is there any difference between them;, they are all alike. Hence those who maintain a difference, are devoid of the truth and are heretics and worldlings of old standing. And there is no reason to entertain any more doubts regarding such Jina images as are consecrated and adored in the four Sanghas; all others that there are, are heretical." In short: "any image that is consecrated by the four Saighas, should be worshipped; all others, such as the images made by the Svetambaras and others, are heretical." (19) On this subject, there are the following elokas in the Nitisara: "The Gapas, Gachchhas and others that have arisen from them, are the grantors of eternal bliss. There is between them no difference whatever in their monastic and other practices. If any man imagine any difference in the four Sanghas, he has travelled beyond the truth and is gone completely into the world. In them there is no difference of images nor of penitential observances; nor is there any distinction in their rules and readings. Any Jina image 35 It may be useful for purposes of comparison, to add here the notice of the Digambaras, which Muni Atmaramit, the head of the Vijayagana of the Svetambaras, gives in his Jaina Mata Vriksha, or Genealogical Table of the Jains:"In 609 A. V., Sivabhuti Sahasramalla, the disciple of Krishna Suri, originated the Digambara sect (mata). He had two disciples, Kaundinya and Kaushtavfra. After these two there came Dharasena, Batavali and Pushpadanta. These commenced, in 683 A: V., on the 5th day of the bright half-month, to compose three; siatras, viz., 1, the Dhavala comprising 70,000 slokas, 2, the Jayadhavala comprising 60,000 slokas, and 3, the Mahadhavala containing 40,000 slokas. These three sAstras exist to the present day in the Karnataka country; and borrowing from them Nemichandra (No.: 17 or 67 ?) composed the Gomattasara for the perusal of Raja Chamunda. No sastra older than these three is to be found among the Digambaras. Afterwards the Digambaras becaine divided into four Sakhas, viz., 1, Nandi, 2, Sena, 3, Deva, 4,, Simha. Later on there arose four Sanghas, viz., 1, Mulasangha, 2, Kishtha Sangha, 3, Mathura Sangha, 4, Goppa Sangha. Still later, there arose the following Panthis; viz., 1, the Visapanthi, 2, the Terapanth,3, the Gamanapanthi, and 4, the Totapanthi, i, e., those who worship a book (pustaka) in the place of an image (pratim). At first Sivabhuti originated the Nagna-pantha (or the ordinance of nakedness); next he taught that a woman could not be saved (moksha), and that a Kevalin should not eat a morsel; finally he taught a mass (lit. eighty-four) of other things. In our days, the Terapanthis have put forth a mass (bahut hi), of heterogeneous things, which may be learned by comparing their old with their new books." With regard to the origin of the Terapanthis he adds in another note to the Vriksha:"In Sam. 1709 Lavaji, the adopted son of PhilA BAI, the daughter of the Bora Viraji of the Lumpaka sect (i. e., the NAgor section; see above, p. 63), together with Dharmadasa, the cotton-printer, originated the pantha (or sect) of the mouth-covering Dhundhakas. These divided into 22 sections, the second of which is the Dhanaji ection: Dhana's disciple (chela) was Bhudhara; his disciple was Raghunathaji; his disciple Bhishma originated; the Terapanthis and propagated the sect of Mukhabandhas (or mouth-coverers)."
Page #81
--------------------------------------------------------------------------
________________ MARCH, 1892.1 PATTAVALIS OF THE DIGAMBARAS. 73 consecrated and adored by the four Sanghas one should reverence, but not any of any other Sangha, because this only leads to heresy." (20) Thus, in the manner above explained, Bhadrabahu arose. After him came other Acharyas in regular order. Of these I am going to write only a brief account in their proper order, commencing with Bhadrabahu. It was not more than 4 years after the date of the accession to the throne of King Vikrama, on the 14th day of the light half of Chaitra, that Bhadrabahu succeeded to the pontificate; by caste he was a Brahman; as a householder he lived for 24 years, as an ordinary monk for 30 years; as pontiff for 22 years 10 months and 27 days; the intercalary days were 3; the total period of his life was 76 years and 11 months. (21) After him, not more than 20 years after Vikra na), on the 14th dar of the light half of Phalguna, Guptigupta, a Parwar by caste, succeeded to the pontificate. He lived as a householder for 22 years, as an ordinary monk for 14, as pontiff for 9 years, 6 months and 25 days; the intercalary days were 5; the total period of his life was 65 yeni's and 7 months. (22) After this the 85th pontificato34 began in the year 1450 after Vikrama, when, on the 5th day of the light half of Magha, Subhachandra succeeded. He lived as a householder for 16 years, as an ordinary monk for 14 years, as pontiff for 56 years 3 months and 4 days; the intercalary days were 11; his total period was 86 years, 3 montlis and 15 days. This should be understood to be the pattavali (or list of the pontiffs). (23) After this (it is to be added that) the 26 pontificates, commencing with Bhadrabahu down to Merukirtti, took place in Bhaddalpuri in the Southern Country. Again the 26 pontificates, commencing with Mahikirtti down to Muhichandra, took place in Malva. Amoug the latter 18 took place in Ujjaini, 4 in Chanderi, 3 in Bhol, and one in Kundalpur. These make up the 26 pontificates. After this, 12 pontificates, commencing with Vpishabhanandin and ending with Simhakirtti, took place in Vara. After this 10 pontificates, commencing with Kanakakirtti and ending with Vasantakirtti, took place in Chitor. After this, 4 pontificates, viz., of Surachandra, Maghachandra, Jnanakirtti, and Narendrakirtti, took place in Vagher. After this, 6 pontificates, commencing with Proshthilakirtti and ending with Prabhachandra, took place in Ajmer. After this 2 pontificates, viz., those of Padmanandin and 'Subhachandra, took place in Vagvar in Gujarat. After this Sakalakirtti succeeded to the pontificate in Vagvar.. This is the list of pontiffs in their proper order in the glorious Mulasangha, the Nandi Amnaya, the Sarasvati Gachchha, the Balatkara Gana. (24) Farther the pattivalis of the Senasangba, Simhasangha and Devasangha are separate. In the Senasangha there is a pattavali of Acharyas in all respects different, commencing with Jinasena. In that (patta vali) there are four names in use for the Senasanigha, viz., 1, Raja, 2, Vira, 3, Bhadra, 4, Sena. Again the four names, in use in the Simhasa gha, are 1, Simha, 2, Kumbha, 3, Asrava, 4, Sagara. Again in the Devasaigha, the fourth after the Simhasaugba, there are the following 4 names in use, viz., 1, Deva, 2, Datta, 3, Naga, 4, Langa. (25) Further it should be understood that the above-named Senasangha is known by the (three) names Sena Sangha, Pushkara Gachchha and Surastha Gana. Similarly the SimhaBangha is known by the (three) names Simha Sangha, Chandra Kapata Gachchha, and Kanura Gana. Again the Devagaigha is known by the (three) Dames Deva Sangha, Pustaka Gachchha, and Desi Gana. (26) On this subject there are the following gathas : "Nandi, Chanda, Kitti, Bhasana, these are the names of the Nandisangha. Sena, Raja, Vira, Bhadda, are those of the Senasangha. Simha, Kumbha, Asava, Sagara are the names of the Simhasangha. Deva, Datta, Naga, Langa are those of the Devasangha." This is a complete enumeration of the Acharyas within the Digambara Community. The intermediate pontificates are given in the subjoined table.
Page #82
--------------------------------------------------------------------------
________________ 74 THE INDIAN ANTIQUABY. [MARCH, 1892. Table of the Pontifical Succession in the Sarasvati Gachchha of the Digambaras; from MS. . Dates of accession. Householder. Monk. Pontif. Total. Serial Number Intercalary days. REMARKS. samvat. Jays Years. Nontha Days, Years, Montbs. Days, Yea.re. Months. Days. Bhadrababa II .. Brahman by caste. C. S.14 Gaptigupta ......... ... .625 565 71... Parwar by caste. (So also c, but A bas Pawar, B Pamar. MS. has Guptagopti). ... 4 426 4685 ... 3 Baghavandin Junachandro... ... 8 6865 ...... 19 Kundakanda ..... ... ... 41 10 20 585 10 15 urhvad by caste (M88. P. V. 8 A, D give him 51 years pontificate, and a total of 95).56 & Omisvamin ....... (101) ...... 40 811 584 8 6 K. S. 8 1|Lohachary. 142 ... 10 10 20 6 691e 26(So also MSS. B,EUR, bat MSS. A, E have A. S As. V. 11 14.) 9 Yasabkirtti ...... 153 68 (8)|(31)| (5) 92 (9)|(35) (MSS. A, Dgive the same J. S. 10 inconsistent dates.) 9 Yasonandin ...... 211 154 16 46 4 479 4 13 (80 MSS. B,D, but M8. Ph. V. 10 A has Ph. v. 11.) 10 Devanandin....... 258 10 28 4.76 112 (MSS. A,B,Dada Porwil As. 8. 8 by caste.) 11 Jayanandin ........ 308 11 22 771 620 (MSS. A, B, D bare Pat J. S. 10 yapada.) 12 Gananandin. 353 8 1 438 8 (MS. bas 358 Sauvat.) J. S. 9 13 Vajranandio......... 361 5 () (MS. A gives correct Bh. 8. 14 dates.) Kumarapandin 886 Pb. V.4 15 Lokachandra ...... 4371 1. V. Prabhachandra - 453 Bh. S. 14 Nemichandra ...... 478 Ph. S. 10 BhAnunandin ...... 487 311 9 24 12) 58 10 6 (MS A gives a pontifP. V.5 cate of 22, inconsistent with 508 Sathyat.) Nayananandia... 508 7 29 (MSS. A,B,D have HaM. S. 11 rinandin; P.10, Sim bapandin) Vasunandin .......... 525 8 | (M8S. AD give differ. A S. 10 ent, thouge equally consistent months.) 21 Viranandin ........ 531 P. S. 11 22 Ratnanandin ... 505 8. ... 12 ... ... 23 4 7 11 48 4 8 (MSS. A,B,D have Re M. S. 5 Enakirtti; but (P.10, Ratnanandin.) MS. adds "He had five names (nma): Padmanandia, Vakragriva, Gridhrapichobha, ElAcharya, KundakundAcharya. The special reasons for having those names may be known from another book (grantha)." 24!
Page #83
--------------------------------------------------------------------------
________________ MARC#, 1892.) PATTAVALIS OF THE DIGAMBARAS. 75 Dates of accession. Householder. 1. Monk. Monk. Pontiff. Pontif. Total Total. Serial Number NAMES. REMARKS. Intercalary days. Days. Sahvat. Years. Months. Days. Years. Months. Days. i Months. Years. Months. 3 Manikyanandin ... (MSS. A, B, D Manikanapdin.) (MS. A gives equally 24 Meghachandra ... 25 Santikfrtti I....... 585 As. V. 8 60) P. V.3 627. As. V.5 612 8. S. 5 1 26 Merukiitti ......... inconsistent dates.) 25 25 32 1 20 (MSS. A, D agree in dif. ferent though equally consistent days.) 13|13|63 8 26 (MSS. A, D give different though equally. consistent days. D has S. V.5.) 5 25 45 11 20 (MSS. AD give different I though equally con sistent years, they also have Mahakirtti.) 5 1 (MSS. A, D give different, but equally consistept days.) ... 26 27 Mahikirtti ......... 17 696 Mr. S. 4 Vishnunandin .... Sribhashana I..... Srt Chandra 81 Srtnandin 704 Mr. V.9 726 1 C. S. 9 735 V. S. 5 749 Bh. S. 10 765 c. V. 12 765 A. S. 10 4|| 18 50 6 17 (MSS. A,B,D have Nan dikfrtti, but P. 12, Bri nandin.) 6 6 7 42 618 32 Deeabhushana. 33 Anantakirtti......... 25 10 18 10 5 (MSS. A, D give different, I though equally con Il sistent days.). 5 58 70... 34 Dharmanandin ... 25 8. S. 15 35 Vidyanandin 82 ... 4 470 ... 8!(MSS. A,B,D have Vira chandra, and A, D give different, though equal ly consistent days.) 16 10 ... 6 36 Ramachandra ...... 37 Rannakirtti ......... 26 21 | J. S. 15 840 As. V. 12 857 V. S. 8 878 A. S. 10 (897) K. S. 11 38 Abhayachandra ... 39 Navachandra ..... 40 Nagachandra ..... 916 Bh. V.5 939Bh. S3 41 Harinandin....... 9 ... 954 9 (This agrees partly with MS. B, partly witb MS. AS ......28 - 3 10 57 ... 13 ... ... 8 9 10 9 27 9 207(MSS.A,B,D have Naya nanandin,and different, but equally consistent years. A has Bh. 8. 9. See No. 19.) ... 14 8 ... 26 1 8 9 49 1 17(MSS. A, D' have dif. ferent, but equally con sistent days.) ... 10 11 ... 16 ... ... 5 40 11 5|| (MSS. A, D have dif ferent, but equally consistent months. MSS. B, D have Sath. 972 and li Bo on.) 18 ... ... 20 ....... 32 2 24 065 8 1 Harichandra 948 As. V.8 43 Mahichandra I....! 974 S. S. 9 14 ... 998 46 Magachandra. I. ...I 990 M. S. 14
Page #84
--------------------------------------------------------------------------
________________ 76 THE INDIAN ANTIQUARY. MARCH, 1892. Dates of accession. Householder. Monk. Pontiff. Total. Serial Number. VANES. REMARKS. Saziyat. Intercalary days. Months. Years. A.D. Days. Months. Years. Days. Months. Years. Days. Years. Months. Daye. 43 Lakshmichaudra... 1 4 3 11 604 Gumakirtti ...... 1 (MSS. A, D have differ. ent, but equally consis. tent years.) 13 (MS. A,B,D have Guna nandin, but B, D add Gunakirti on rrargin.) Ganachandra ..... Lokachandra II ... 1009 1023 J. V. 2 1037 A. V. 1 1048 Bh. S. 14 1066 J. S. 1 1079 Bh. S. 8 1094 C. V.5 1115 Ch. V.5 49 Srutakirtti ......... 1022 15 6 6 6 50 Bhavachandra... / 12 $1 Mahichandra II ... 20 11 25 5 48 ... ...(MS. A,D bave different, ll but equally consistent years.) 25 5 10 5 61 5 15 (MIS. D has different, but equally consistent years. MSS. D, P have Mah&chandra.) 4 3 17 7 31 324 52 Maghachandra II.. 108324 ... 58 Brahmanandin ... 1140 Bh. S. 5 1114 P. V. 14 1087 7 ... 54 Devanandin II...... 10919 ... ... (1148) V. S. 4 53 Vievachandra ... 1155 Mr. S. 5 1098 11 .. ... ... 2 41 41 46 45 (80 P. 16, but MSS. A, B, D have Vpiahabhanandin. MSS. A, D have different, but more consistent years.) 7 ... ... 7 6 104 14 28 624 (MSS. A,B,D have sive nandin, and A, D ha: different, though cou sistent dates.) ...... 7 28 835 81 (S. P. 16, but MSS. A, B, Dhave Vasuchandra. MSS. A, D have dif ferent, but equally con sistent years.) 4 ... 24 5 43 ... 29 (So also P. 17, but MS. A Sanghapandin, MSS. B, D Sishananda) .... 348 2 8 56 Harinandin.... 1099 7 57 Bhavanardin ...... 1103 Devanandin II...... 1110 10 44 3 12 Vidy&chandra ...... 1156 8. S. 6 1160 Bh. S. 5 1167 K. S. 8 110 Ph. V.5 1176 8. 8. 9 1184 A. S. 10 1188 M. S. 1 Strachandra ....... 61 Maghavandin II... 6 4 29 1049 5 9 (MSS. A, D have entirely different, but equally consistent dates.) 29 257 2 1 (MSS. A, D have differ ent, but equally consis tent years.) 1127 1 ... 51 31 8 7| (MSS. A,D have entirely different, but equally consistent dates.) 1131 10 ... ... 84 ... ... 10 ... 31 7 55 ... 10 (So also P. 18, but MSS. A, B, D Jidpakirtti. From here the term antarala din.) 114213 ... ...! 7 2 8 10 58 218 62 Jhananaudin ...... 1149 81 63 Gangakirtti... 1199 Mr. S. 11 64 Simhakirtti...... 1206 Ph. V. 14 65 Hemakortti ......... 1209 J. V. 3 68 Charanandin ...... 1216 A. S. 3 2 2 15 16 37 8 1 (MSS. A, D have different but equally consistent, years.) ... 7 8 276.4448 115213 .. 1159 of 9 ... 19 3 ... 6 6 20 10 327 ... (So also P. 18, but MSS. A,B,D Sundarakirtti.)
Page #85
--------------------------------------------------------------------------
________________ MARCH, 1892.) PATTAYALIS OF THE DIGAMBARAS Dates of accession. Householder. Monk. Pontiff. Total. Serial Number NAMES. Intercalary days. Months. Days. Years. REMARKS. Samyat. A.D. Years. Months Days. Years. Months. Days. Years. Montbs. Days. 67 Neminandin II ... 1166 1223 V. S. 8 7 829 7 35 9 6 (So also P. 19; but MSS. A, B, D Nemichandra, A, D have different, but equally consistent days.) 1 11 28 4 421. ... ... ... 18 12 36 1 - 68 Nabhikirtti ......... 1173 ... ... 69 Narendrakirti ..... 70 Srichandra II ..... 1230 M. S. 11 1232 1175 M. S. 11. 1241 1181 Ph. S. 11 1248 As. S. 12 12531 As. S. 13 71 Padmakirtti...... 72 Vardhamana ...... ... 6 8 24 7 38 41 (MSS. A, D give different but equally consistent years.) ... 4 11 25 687 ... 1 .... ... 2 11 8 18 25 11 21 (S. P. 19, but A, B, D Varadbachandra. A D give different, but equally consistent dates.) .... 1924 7 48 41 1199 1200 ... 5 1204 73 Akalankachandra. 1256 Ag. S. 14 74 Lalitakirtti......... 1257 K. S. 15 Kesavachandra .. 1261 Mr. V. 5 76 Charukfrtti ........ 1262 J. 8.11 Abhayakirtti...... 1281 A. V. 8 78 Vasantakirtti...... 1264 M. 8.5 79 Praksh&ntikirtti... 1256 As. 8.5 8 620 (MSS.A,Dhave different, but equally consistent days.) 2 746 8 9 (MSS.A,Dhave different, but equally consistent years.) 11 7 41 11 18 (MSS. B, D have A.V.8.) - ... 21 15 ... ... 2 8 16 428 6 ... (A, D bave different, pro bably consistent dates.) 320 (MSS.A, Dhave different, but equally consistent days. MSS. B, D have Prakah Ataktrtti.) 9 15 (A, B, D BAntikiriti.) 9 7 8 43 ... 5|(A,D have different, and most concistent dates.) 80 VibAlakirtti........ 1268 K V.8 Dharmachandrs... | 12711 8. S. 15 82 Ratnakertti II...... 1998 Bh. V. 18 83 Prabhachandra ... 1310 P. S. 14 84 Padmanandin ...... 1985 P. 8.7 85 Sabhachandrs..... 1450 M. S. 5 1993 16 ... ... 14 ... ... 58 8 4 11 88 818(MS9, A, Dhave different, but equally consistent years. He was 820ceeded by Sakalalirtti. see $29.) PATTAVALI D. This pattavalt is drawn on the plan of pattAvall B, with which it also agrees very closely in regard to names and dates; that is, it gives no introductory or concluding remarks, but consists only of the list of successions commencing with Bhadrabaku II., interspersed with a few short notes. It differs, however, from B, in giving full details of every pontifical life, as is
Page #86
--------------------------------------------------------------------------
________________ 78 THE INDIAN ANTIQUARY. [MARCH, 1892. done in A and C. The list is carried down in it to No. 100, Nainakirtti, who succeeded to the pontificate in A. D. 1822. As his successor followed in 1826 (see ante, Vol. XX. p. 353), it follows that pattavali Dmust have been written between 1822 and 1828. I now subjoin the short interspersed notes, as well as those successions, in which D differs from other pattavalis. From No. 88, D alone gives full details of the lives. After No. 51 Mahichandra II., there is the following note : - etA pATa mAlavai bhadilApura ( in No. 26 bhadalApura ) havA / 26 huvA / paTa 25 ujINa meM huvA / mahIcandra sAI sarva paTa 19 // i.e., " These pontificates took place in Bhadilapur (or Bhadalapur) in MAlavit; they were 26 in number; 25 pontificates took place in Ujina (Ujjain); down to Mahichandra the total of pontificates was 5)." After No. 63 Gangakirtti, there is the following note: - e paTa vArA meM gajanakIrti jI tAI / gvAlera aThA tUM lera paTa 14 huvA / abhekItti jI tAI paTa 77 / / i.e., "These pontificates took place in Vari, down to Gangakirtti; beginning from here 14 pontificates took place in Gwaler; down to Abhayakirtti there were (altogether) 77 pontificates." After No. 83 Prabhachandra II., there is the following note: - saMvata 135 dina se eka mArka prabhAcandra jI ke AcArya cho| so gujarAta me zrI bhahArka jI to na chA aru vai AcArya hI chaa| so mahAjana eka pratiSThA ko udyama kIyo / so vai to na Aya pahuMcyA / jadi AcArya ne sUrimantra divAya bhara bhahArka padavI gujarAta kI dInhI pratihA karivA pAcha tiThA se gujarAta me paha thaaro|| AcArya sabhAka huvo| nAma pacananda jI diiyo| i.e., " In Samrat 1375 there was a certain Acharya belonging to (the suite of) the Bhattaraka Prabhuchandra. Now the Bhataraka himself was not in Gujarat, but that Acharya was there. Now & certain Mahajan (or banker) had resolved to perform a consecration. Now he (Prabhachandra) could not arrive in time; so he (the banker) caused the Acharya to receive the powers of a Sari and conferred on him the Gujarat? title of Bhattaraka, after he had performed the consecration. Thenceforth his pontifical residence was in Gujarat. The Bhattiraka title dates from that Acharya. The name Padmananda was given to him." In pattavalt B, the corresponding note runs thus : prabhAcandra jI ke AcArya gujarAta meM cho| so va ekai zrAvaka pratiSThA nai prabhAcandra jI ne balAyauM / so vai nAyA / tadi AcArya ne saramantra (read mUri') bhahAraka kari pratiSThA kraaii| tadi bhahAraka pacanandi jI huvaa| tyA~ pASANa kI sarasvatI muLe bulaaii| i.e.. There was an Acharya belonging to (the suite of) Prabhichandra in Gujarat. Now there (i.er, in Gujarat) a certain Sravaka called Prabhachandra to perform a consecration. Now he could not come. Then having given to the Acharya the powers of a Suri and having made him a Bhattaraka, he got the consecration performed. Then he became the Bhataraka Padmanandin. He carved a stone figure of Sarasvati and made it to speak." (See ante, Vol. xx. p. 354, No. 83). The last circumstance is thus referred to in pattavali P : pacanandI gururjAto blaatkaargnnaamlii| pApApaghaTitA yena vAditA zrIsarasvatI // ujjabantagirau gacchaH (svachaH)sArasvato'bhavat / bhatastasmai munIndrAya namaH zrIpacanandine / / i.e., "The Guru Padmanandin then became the leader of the Balatkara Gana, - he who made the stone figure of the glorious Sarasvati to speak. (Thus) on mount Ujjayanta the (pure) Gachchha came to be (called) the Sarasvata. Hence let us give honour to him, the great Muni Padmanandin." From this notice it would seem that the miracle of the speaking figure of Sarasvati took
Page #87
--------------------------------------------------------------------------
________________ MARCH, 1892.) PATTAVALIS OF THE DIGAMBARAS. 79 place on the mount Ujjayanta, and that it was the cause of the Gachchha being called the . Sarasvati Gachchha.' After No. 87, Prabhachandra, there is the following note:ekai vAra gaccha 2 nIkalya, gvAlera ko nAgora ko, saMvata 1902 kA // i.e., "Once the Gachchha separated into two, that of Gvaler, and that of Nagor, in the year 1572." Or it might also mean "Once from the Gachchha (at Chitor) two (branches) came ont, that of Gvaler and that of Nagor." But the former version is more probable, to judge from the wording of the corresponding passage in A, which is as follows: ekai vAra gaccha kA dova ivA, cItoTa bhara nAgaura kI, saM01572 kA / i.e., "Once the Gachchha split up into two, those of Chitor and of Nagor, in the year 1572." Table of Pontifical successions in which D differs from A and E. Dates of accession. House holder. Monk. Pontiff. Toto. NAMES. Serial number. Intercalary days. REEKS Sanyat. Year. Months. Days. YoArt. Months. Daye. Yeart. Monthe. Days. Years. Montbs. 18 Minanandin 24 Meghachandra ... 487 P. V.5 601 P. V.3 5 24 12 46 11 6 (Here A, D, E bare esoh different datos. A. E BhAnnnandin). 2 1856 6 211 (A, E give each differ ent and inconsistent dates). 45 1 1|| (A, E give different I days). 8 1067 ... 18|| (A, E give different years.) 6 15 (A, E differ entirely). (A, E differ each). 911 8 27|| (So also B, E, but A transposes the names I Nos. 86 and 87). 5.8 8 56 5 611 8 18 88 Abhayachandra ... 878 821 A. 8. 10 40 NAgachandra ....... 916 8 59 Bh. V.5 51 Mabachandrs ......il 1113 i 1066 Ch. V. 5 81 Dharmachandra ... 1271 $. . 15 88 Jinachandra.......... 1507 J. V.5 87 Prabhachandra ... 1571 Ph. V 2 Dharmachandra ... 1581 8. V.5 Lalitakirtti ....... 1603 Ch. S. 8 Chandrakrtti .... 1623 1566 V. V.? Devendraklrtti.... 1662 1605 Ph. V. P 92 Narendrakirtti. 1691 1635 | 11 .../ K. V.8 93 Surendraikfrtti...... 1722 1668 8. V. 8 94 Jagatkfrtti 1783 1676 8. V. 5 99 Sukhondr.kirtti ... 1852 1795 (From here D alone gives details of the Lives). 751 ... 221 PPP 7 (Down to No. 94, most of the details are wanting). 15 81 PPI 10 17|| PPP I 26 ... ... 87 6 29 717466 (From No.95-100 names and dates as in B, but all details are want ing). P PPPPPP || (Here the pattavali closos). 100 Nainakirtti ......... 1822 PPPPP 1879 As. V. 10
Page #88
--------------------------------------------------------------------------
________________ THE INDIAN ANTIQUARY. [MARCH, 1892. / PATTAVAL E. In its general arrangement, this pattavali resembles pattavalis A and C. It begins with an introduction, followed by the pattavali proper. But the latter, like pattivali B, gives only a list of the names and dates of accession of the pontiffs. A pecaliar feature of it is that it adds notices regarding the caste of each pontiff. In a few exceptional cases such notices are also given in pattavali D; and these are noted in the tabular statement below. I am doubtful, however, regarding the correct spelling of many of the caste-names; some of them I cannot identify. That the tradition represented in pattavali E considerably differs from that of the other pattavalis has been already referred to; also that it gives the succession list of the so-called Chitor section. The latter it brings down to No. 102, Mahendrakirtti, who succeeded in 1880A.D. and is probably still living. In the following, I again give the introduction in extenso, and the pattavali proper in tabular form. In the latter my own remarks are within brackets. TEXT. Introduction of Pattavalt E. (1) bhaya vaMsAvalI gurA~ kI likhyate // zrImahAvIra jI 1, gotama svAmI 2, sudharamA svAmI, jammU svaamii|| varasa 62 tAI kevalI huvA // 4 // (2) viSNunanda jI zrutajJAnadhArI 5 nandAmitra jI zrutajJAnadhArI,bhaparAjita jI zrutajJAnadhArI, govaradhana jI zrutajJAnadhArI, bhadravAha jI zrutajJAnadhArI 9 // varasa so tAI // 9 // (3) visAkhAcArtha dazapUrva kA pAThI 10, (proSThila jI padhapUrva kA pAThI, kSatriya jI dazapUrva kA pAThI 11, jayasena jI isapUrva kA pAThI 12, nAgasena jI dasapUrva kA pArI 13, siddhArtha jI. dasapUrva kA pAThI 15, dhRtisena jI dazapUrva kA pAThI 15, vijayasena jI dacapUrva kA dhArI 16, vahadhUli jI dspuurv0||183 varasa // 9 // (4) gaGgAdeva jI gyArA bhaGga kA pAThI 10, dharmasena zrI gvArA bhaGga kA pArI 14, nakSatrAcArya gvArA bhaGga dhArI 19, jayapAla jI gyArA bhajadhArI 20, pANDava jI gvArA bhajadhArI 21, dhruvaseNa jI gvArA bhajadhArI / / 220 varasa tAI rahyA / / 15 // (5) kaMsAcArya prathama bhajakA dhArI 22, abhadra jI prathama bhAkA dhArI 23, jasobhana jI prathama bhaGgakA dhArI 24, bhadravAha jI prathama bhajadhArI 25, lohAcArya jI prathama bhajadhArI 26, vinayadhara bhI prathama bhaadhaarii|| 118 varasa tA~I r|| (6) zrIdattaseNa jI 20, sivadatta zrI 28, bharadatta jI 29 // bhadrAvAhu jI sa0 104 kai sAla pATa baiThA kAtI sadi 14 / / setAmbara ai sau nikasthA pahAvalI pravRtti karI // 30 // Here follows the pattavali. After No. 21 (45) there is the following remark - vetA paTa to mAlava desa mai huvA / / 2 / / Similar remarks follow after No. 23 (47), 60, 75 (91), 80,86 (98), 88, 92 (102), 93, 94 (103),95, 90. TRANSLATION. $1. Here the Vamskvalt (list of succession) of the Gurus is written down : (1) The glorious Mahavira, (2) the Lord Gotama, (3) the Lord Sudharma, (4) the Lord Jambu. These were Kevalins for 62 years. Altogether 4. The bracketed portion is wanting in the MS., owing probably to a mere slip; as the totalisation at the end of the paragraph shows. * It will be notioed that the numbering, actually given in the pattAvall, is very capricious, some members being left annumbered, without any apparent reason. These capricious nombers are quoted within brackets.
Page #89
--------------------------------------------------------------------------
________________ MARCK, 1892. PATTAVALIS OF THE DIGAMBARAS. $ 2. Then came those versed in sacred lore (srutajnana-dhari), viz., (5) Vishounanda, (6) Nandamitra, (7) Aparajita, (8) Govardhana, (9) Bhadrabahu I. These (abode) for 100 years. Altogether 9. $ 3. Then came those who could recite 10 Purvas, viz., (10) Visakhacharya, [Proshthila, (11) Rahattriya, (12) Jayasena, (13) Nagasena, (14) Siddhartha, (15) Dhritisena, (16) Vijayasena, Vahudhuli. These lived for 183 years. Altogether 9. 4. Then came those who could recite 11 Aigas, viz., (17) Gangadeva, (18) Dharmasena, (19) Nakshatracharya, (20) Jayapila., (21) Pandava, Dhruvasena. These abode for 220 years. Altogether 15. 5. Then came those who could recite (only) the first Anga ; vis.. (22) Kamsa, (23) SCbhadra, (2-4) Jasobbadra (25) Bhadrabaho II., (26) Lohacharys, and Vinayadhara. These abode for 118 years. 96. Then came (27) the glorious Dattasena, (28) Sivadatta, (29) Aradatta, and (30) Bhadrabahu III., who succeeded to the pontificate on the 14th of the light half of Katik, in the year 104 after Vikrama. The Svetambaras originated at this time and commenced a pattavali of tbeir own. Note after No. 21 :- Now these 26 pontificates took place in the Malava country. Vansavali of the Gurus of the Digambaras. From MS. E. Datos of accession. Dates of Accession. Serial Number! Number in MS. Yumes. REMARKS. Serial Number. Number in MS. Names. REMARKS. Sarnvat. A. D. Sarvat. A.D. 360 Lavochu by casto 1 Bhadra bhull 10447 From him thol 15 Sretambara K. S. 11 went forth!! and initiatod al 16 rattivaliofil their own. Im A, B, C, D Brahmuu by caste). 17 11 Lokachandra.. 427 (38) J. V. 4 12 Prabhachandra 453 Bh. S. 14 396 Pancham Sravak by caste. 13 Nemachandra. 478 Ph. 8.10 421 Nagam Srivak by caste. 430 Dusar by caste. 4 14 Bhinunanda... 497 P. V. 5 Sinbadanda ... 508 M. S. u 451 Srimal Sakarya by caste. Vasunanda ... 3 2 (31) 3 (32) 4 (33) 3 (34) 6 (35) 8! 7 (36) Maghananda... 130 79 Silwal by erste A. S. 1 (AL Sah.). 11 Jivachandra... 11083 A Chisara Puri wal. (C basl 19 Ph. S. 14 Huthvad.) Kundukunda.. 119 92 Palival by caste. P. V.9 U nasvami...... 201 141 A Sravak of Ayo K. S. 9 dhya. Lohacharya 242 185 Labechu by caste As. S. 14 Jasakirti ...... 253196 Pirral by castells As. 8.9 (A, B, D have 23 Jayalval). 525 A. S. 10 by 468 Vadhneri caste. Virananda...... 531 P. S. 11 Ratnananda ... 561 M. V. 5 19 MAaikananda.. 585 As V.12 474 Labochu caste. 504 Vigadya caste. 528 Agarvala caste. 544 Khandelval 8 Gunananda ... 363 306 Parvagola by J. S. 4 caste. 9 Vajrananda ... 364 307 Golaperb by 25 Bh. S. 14 caste. | 10 Kumarananda. 386 329 Salajval by castel (37) Ph. V. 20 Meghachandra 601 P. V. 3 21 Sentikirtti...... 627 As. V.6 560 Sahajval by caste. All these 36 had their seat of pontificate in More
Page #90
--------------------------------------------------------------------------
________________ THE INDIAN ANTIQUARY. (MARCH, 1892 Dates of accession. Dates of accession, Serial number. Number in MS. Names. REMARKS. Serial oun bor. Number in Ms. Names. REMARES Sauvat. A.D. Samvat. A. D. 19 Merukirtti... 585 Jaisval by caste. 642 $. S. 3 198 629 23 Mahakirtti ... 686 Mr. S. 15 (47) * I'48 Sahajvil by caste. Up to here the seat of 49 pontificate was in the town of Bh: dalpur in 50 Milava. =32 28 Vasavachandra 1066 1009 Sahajvalhy caste. J. S. 1 (So also P.14). 45 Lokachandra P Sahajval by caste J.S. 1 Surakirtti...... 1079 1022 Sachand by caste Bh. S.PL Bhavachandra 1006 1039 P by caste. Ch. V. 5 Mahichandra.. 1115 1058 Srimal by caste. Ch. V. 5 Maghachandra 1140 1033 Pancham Sravak 13h. S. 5 Brahmananda. 1146 1087 Vadhoora hy P. V. 14 caste. 51 Sivananda...... 1148 1091 Sahajvil by v. v. 14 ca-te. Siyachandra ... 1155 1098 Vadhnora by Mr. S. 61 Harinanda...... 115G 1099 Sichani by cante. $. 8.6 Bhivananda... 1100 1103 Damak Sravak Bh. S. 5 Surakirtti ...... 1167 1110 DhikadyaSravak V.8.9 by custe. Vidyachandra. 1170 1113 Vagela Sravak Ph. V. 51 by ciste. 57 Surachandra... 1176 1119 Narsimhapuru by Ciste. Maghananda... 1194 1127 Chatrurath Ari. vak by caste. A. S. 10 59 Gunkyana- 1188 1131 Gagari hy caste. nanda. Mr. S.1 ! 60 Gangakirtti ... 1199 1112 (Caste omitted). M. Y.11 All these 37 Pontiffs resided in Wara Vuod. 61 Simhnkirtti ... 2106 1149 Narsinghpara by Ph.V,14 cante. Hemakertti ... 1209 1152 Hummad by J. V. 11 caste. 63 Charananda... 1216 1159 Sahajval by A.S. caste. . Nemananda ... 1223 1168 Nagad Rahis by as 24 Vasunanda ... 704 617 Vagiya by caste. Mr. S. 9 (Dhe Vagado.li 25 Sribhushana... 726 669 Sthajval by casto. 17) Ch. S. 9 26 Silachandra ... 735 678 Srimit by caste. V. S. 5 27 Brinanda ...... 749 699 NAgndraha byl Bh. $.10 caste. Desabh(shar! 765 708 Srinnal by caste. Ch.V.12 Anantakirtti... 766 709 Portal by caste. A. S. 10 30 Dharmananda. 785 728 Nhgaya by caste. S. S. 15 Vidyenanda ... 803 761 Vagherval by J. S. 51 caste. 32 Ramachandra. 840 783 Pancham Srayak Ag.V.12 by caste. 33 Ramakirtti ... 857 790 Lavecha by enste | v. V.3 34 Abhayachandra 878 821 A Bravak of| A. S. 20 Ayodhyapurl. 62 36 Narachandra.. 897 840 Nagam Sravak by caste. | 63 36 Nagachandra.. 916 859 Bagad by caste. Bh. 8.5! 37 Nayanananda. 939 882 Dasar by casto. Bh. S. 3 38 Harichandra .. 949 801 Sori Vaghervall As. V.9 by caste. 39 Mabichandra... 974 917 Dakadya by caste 8. S. 9 40 Maghachandra 390 933 Padmavatt Por M. S. 10 vil by caste. 41 Lakshmt- 1023 966 Agarila by caste, chandra. J. V. 2 42 Gunakirtti ... 1037 970 GolvAl by caste. (60) 14. 8.1 48 Gunachandra.. 1049 991 GolApurab byl Bh. S. 14 caste. 70 S. S. 9 K. 8. 11 V.3.3 65 Nibhikirtti ... 1230 1178 Nagam Bravak M. 8.11 by caste. 66 Narendrakirtti 1232 1175 Nigad RAh by (83) M. S. 11 67 Srichandra ... 1241 1184 Nagarwal Vag Ph. S. 11 dya by caste. 47 (61) (84)
Page #91
--------------------------------------------------------------------------
________________ MARCH, 1892.) PATTAVALIS OF THE DIGAMBARAS. Dates of accession. Dates of accession. Serial number. Number in MS. Names. REMARKS. Serial number. Number in MS. Names. REMARKS. Saravat. A.D. Samvat. A. D. (97) dra. 69 Padmakirtti... 1248 1191 PrvAl by caste. 88 85 Dharmachan. 1581 (1524 Gangaval by As. S. 121 $. V.5 caste. (So albo Vardhamina... 1253 1196 Vadhnor b yl 89 86 Lalitakirtti ... 1603 1546 Godha hy castc. He pontifice- As. S. 131 onste. C'h. 8. 9 1 ted in Chitor. Akalanka ...... 1256 1199 Pirvil by caste. (So also D). 90 87 Chandrakirtti. 1922 1565 Gaudhi by caste. As. S. 14 Lalitakirtti ... 1257 1200 Lavechu by oaste... V. S. 11 K. S. 15 91 88 Devendrakirtti 1662 1005 Seth by caste. Kesavachandra He pontifica. 1261 Ph.U.11 1204 Castep tedin Singaper. Mr. V.5 92 89 Narendraktrtti 1601 1634 Sogani by caste. 73 Ch&rukirtti... 1262 1205 Pancham Sravak (So also D.) K. V. 11 (99) J. S. 11 by coste. 74 Abhayakirtti.. 1264 1207 Ath Sakh Per-03 00 Surendrakirtti 1712 1655 KAIA by caste. (Su also D.) (90) S. $.9 vil by caste. A. V. 3 (100) 75 Vasantakirtti 1264 1207 SAh Rayad by 94 91 Jagatkirtti ... 1733 1076 Sokhu RAYA by 8. 8.7 Caste. (D has caste. All those M. S. 5 Sikhuri Yogi.) 15 pontiffs rello sided in GvAler. 16 || 95 92 Devendrakirtti 1770 1713 Volva by casto. (Dhas GodhA.) M. V.11 These four pon 76 Visalakirtti... 1266 1209 Pancham Gravak tiff resided in (92) As. S. I by onste. Avairi. 77 Subhakirtti ... 1268 1211 SAh Vad byl 93 Nalendrnkirtti 1702 1735 Panaivn! (So (93) K. V. 11 caste. P. S. 10 alur D.) He 78 Dharmachan. pontificated in 1271 1214 Sethi by caste. D11 (Delhi.) dra. S. S. 15 0794 Khemendra. 1913 1758 Pitant by ca-te. 79 Rntnakirtti... 1296 1239 NAgad RahA byll (105) kirtti. As, S. 11 (So also D.) He pontificated in (941) A. S. 13 caste, Jaspur. 80 Prabhachandra! 1310 1253 Padmavnti Por-las 98 95 Surendrakertti 1999 os 1705 Pchly by P. V. 10. All v o ! V.V.P theso . (So so il D. In Jaiptir. pontiff: rosid 09 98 Surondrakertti 1952 1795 Anion Sven by od iu Ajinor. Mr. V.9 | easte. hay 81 Padmananda... 1385 Anoplivni 1328 Caste? kapiat vari.) P. S. 9 i He pontifira. Ited in Jaipur 82 Sabhachandrn 1450 1393 Agurvala by 10197 Narindra. ... (D has Nain (95) kirtti. kintti, ka by came) 83 Jinachandra... 1507 1440 Agaryl b yl 102 98 Downdrakirtti J. V. 5 D.) 99 Sriratna Ma. 84 Prabbachandra 1871 1514 Vaidyn G trn byli hendrakirtti. Ph. V.2 caute. (So also D.) val by Custoli 84 H00 M. S. 98 Downdrakirtti (96) enste. (So nlso 102 87 POSTSCRIPT. Since writing the foregoing paper, I have procured the Deccan College Manuscript of the Vikrama Prabanding. On examination I find it to be an altogether different work from the one referred to in the pattavalis. The latter was in Praksit verse, while the Vikram Prabandha of the Deccan College Library is in Sanskrit verse, and contains a few folk tales connected with Vikrama: in fact, it is identical with the Panchalanda-chhattra Pralandha, published by Prof. A. Weber in 1877.
Page #92
--------------------------------------------------------------------------
________________ 84 THE INDIAN ANTIQUARY. [MARCH, 1892 On the other hand, the Deccan College manuscript of the Nitisara, which I have also procured, is the work in question. It is a very small work, consisting of 113 slokas, and giving brief explanations of a number of Digambaia technicalities. With the exception of one, all the quotations in the pattavali are confirmed by this manuscript. The first quotation, in $ 12, constitutes the slokas 6 b and 7 in the Natisara. There is, however, a slight difference in the second line, which reads in the Deccan Manuscript as follows: senasako nandisaH siMhasako mhaaprbhuH| The third quotation, in $ 17, forms the 9th, 10th and 11th blokas in tho Nitisara. In that manuscript the 2nd, 3rd, and 5th lines read a little differently : drAviDo yApanIyazca kASThasaGkazza mAnataH / gopuchikaH svetavAso drAviDo yApanIyakaH / svasvamatyanusAreNa siddhAntaM vyabhicAriNaM / The fourth quotation, in $ 19, forms slokas 8, 12, 13, 14 in the Nitisara. In that manuscript they read as follows: gaNagacchAdayastebhyo jAtAH svaparasaukhyadAH / na tatra bhevaH kopyasti pravrajyAdiSu karmam // 8 // catu:saMdhyAM naro yastu kurute bhedabhAvanAM / sa samyagdarzanAtItaH saMsAre saMcaratyaraM // 22 // nAtra pratikrame bhedo na prAyazcittakarmaNi / Ararare are reaa: 113 II. catuHsaDDI saMhitAyAM jaina bimba pratiSThitaM / namenAparasahasya yato nyAsaviparyayaH / / 24 // The second quotation, in $ 16, I cannot find in the Deccan College Manuscript. It is a verse written in the Sragdhara metre. The whole of the Nilisara is written in slokas, with the exception of the last (113th) verse, which happens to be in the Sragd hara metre. This last verse, however, does not belong to the body of the work, but contains a laudatory reference to the author, Indranandin. It does not seem probable therefore, that the verse, quoted in $ 16, really belongs to the Nitisara. The Deccan College MS. has all the appearance of being complete. That the author, Indranandin, belonged to the Sarasvati Gachchba is shown by his being described in verse 113 as & clever follower of Kundakunda. He does not appear in the pontifical succession list. There are, however, certain indications to fix the dates of himself and his work. In verses 67-70 he enamerates a number of celebrated (sattama) Munis from all the four Sanghas. The latest in date among those quoted form the Nandi Sangha are Prabhachandra and Jinachandra, Nos. 86 and 87 in the list. The latter died 1524 A. D. At the end of the manuscript, - quite independently of the work, - there is the remark that it was written Sri-Lalitachandra-pathanartham, "for the reading of 'Sri-Lalitachandra.' This person, in all probability, is the same with Lalitakirtti II., No. 89, of the pontifical list (Chitor section), who died in 1565 A. D. Between these two dates (1524 and 1565) Indranandin should have lived and written the Nitisara. As Lalitakirtti (or Lalita Chandra) pontificated from 1546 to 1565 A. D., the Deccan College MS. was most probably written within that period; and there is just a possibility that it is the autograph of Indranandin himself, who may have been a disciple of Lalita Chandra. 31. The MS. has ear , aram and alam having the same meaning.
Page #93
--------------------------------------------------------------------------
________________ MARCE, 1892.) THE INSCRIPTIONS OF PIYADASI. 85 THE INSCRIPTIONS OF PIYADASI. BY E. SENART, MEMBRE DE L'INSTITUT DE FRANCE Translated by G. A. Grierson, B.C.S., and revised by the Author. (Continued from page 13.) C. - KHALSI, DHAULI-JAUGADA, COLUMNAR EDICTS, BHABRA, SAHASARAM, RUPNATH, BAIRAT. The Spelling of the remaining edicts is so siinilar, that it will be advantageous to group all the facts together in one view. The edicts are referred to by their initial letters: Dh. = Dhauli; Kh. = Khalsi ; S. = Sahasaram; R. = Rupnath ; B. = Bairat; Bh. = Bhabra. For the Columnar Edicts, I have taken, as typical, the only complete version, the most correct and that best known, that of the pillar of Firuz Shah at Dehli (D). I only cite the divergencies of the other versions (D2ARM) when they appear to me to present points of special interest, and to be not merely accidental transformations. The text of Jangada is, in the series of the fourteen edicts, almost invariably identical with that of Dhauli. Dr. Buhler only notes four points of divergence ; according to his texts I count at most seven or eight; the text of Jaugada, being moreover less complete than that of Dhauli, offers nothing new. The case is not the same with regard to the detached (or "separate') edicts; here the two versions more frequently shew points of difference, which are not all devoid of interest. Under these conditions Dhauli, as a general rule, answers for both, and I shall content myself with merely drawing attention, in the proper place, to forms peculiar to Jaugada. The fragments of the Queen's Edict, of the edict of Kansambi, and of the inscriptions of Barabar, are too short and too damaged to lend themselves to methodical treatment. 1. - PHONETICS. (=va, eva), III, 7, &c. - In the middle of (a). - Vowels. words, I note sukhayami, VI, 20; lati, VIII. 23. Changes of Quantity. - Kh. does not mark, for i and u, the distinction between long and DHAULI. - Finals: ahu, III, 9, al. (never short. The solitary instance in which an i has cha); alalhayevu, det. II, 6; chalevu, det. II. been read: piyadasi, I, 2 (Buhler) is so in- 5; nikhamavii, III, 10; pupunevu, det. II, 7; distinct, that the facsimile of General Cunning- yujunh', IV, 8; mame, det I, 5; na, I, 4; ham gives it as short. I have no doubt that he vaseruti, VII, 1 (Jaug. oti). - In the interior is right. - R. and B. read jambudipasi, which of words, we find several instances of lengthenis not sufficient ground for us to conclude that ing, some of which are compensatory or acthey would not have marked the long vowel, cidental: -sahusuni, I, 3; takhasilate, det. I, 24; if the text had brought it again elsewhere; abhikale, V, 25; chilathitika, V, 27; VI, 33; and that especially, because at Bh. we have niche, VII, 2; anavutiya, det. I, 11; nithulicertain examples of i and u. We must, there- yena, det. I, 11; hilarina, VIII, 5 (Jang. ht) fore, conclude that this peculiarity belongs can only be an error of the engraver. only to Kb. DEHLI. - Finals: aha (aha), passim ; apahaVowels lengthened. - KHALSI- A final 'ta, VI, 3 (RMfa), if the form is really equivery often becomes a, more often, indeed, than valent to apahritya; anupalipajeya, VII-VIII, it remains short. I quote only a few examples 17; asvasa, V, 18 (RM osa); bhayena, I, 4; of each case : abhisitasa, XIII, 35, &c.; abhisi. cha, passim; eva, L, 6 (RM 'va); gonasi, V, 18 tena, IV, 13, &c.; aha, passim (once only aha, (RMsa); he meva, I, 8; VI, 6 (ARM (r)va); ja, VIL, 6); ajd, IV, 9; chd (more frequent than napadasa, IV, 5 (RMsa); lokasu, VI, 2, 4, cha); eva, II, 6, al.; hida, I, 1, al.; palata, IX, (RM Osa); mama, IV, 12 (D'RM (r)ma); papova27, &c.; puna, passim ; mama, V, 13; vd / VI, 13 (ARM va), usahena, 1,5; vadheya, VII
Page #94
--------------------------------------------------------------------------
________________ THE INDIAN ANTIQUARY. [MARCH, 1892. VIII, 13, 16, 18: kadha, II, 11 (ARM (r)dhu). one at D.: abhita, IV, 4, RM abhita: D. 1. 6 D. VI, 8 and 1, 4 writes pubya, palikhaya and apelcha, RM(r)kha; D. VI, 8, atana, RM na; D. sususaya, the instrumental written in dya by IV, 10, atha, Da tha ; D. IV, 13, avimana, RM. - Medial vowels : dakhinaye, II, 13 DPRM Ona; D. IV, 3, ayatu, RM ota; likhapita, (D'ARM dao); anupalipaja, VII-VIII, 10, 21, D. 1,2; II, 15; IV, 2; VI, 2, 9, RMta; abhita, 3; anupalipajisati, VII-VIII, 10; sampalipati- D. IV, 12, DPR bhio; alhamipakhaye, D. V, 15, ya, VII-VIII, 8; anupaliparane, VII-VIII, 7; DPRM omideg; D. III, 20, isyakalanena, RM sya. nig huliye III, 20; pachupagamane, VI, 8 (A Changes of Quality.-KHALSI. - a into i : pichu); palibhoge, VII-VIII, 3 pativisithani, majhimena, XIV, 8; pichhe (?) (= paschat), L VII-VIII, 5 (by the side of pativisit hun); pava 4; into e: heta (=atra), VIII, 23, al.; into u: jitanari, VII-VIII, 4; putapapotike, VII-VIII, munisa, II, 6; -- f into e: edisaye, IX, 24; - 10; sampalipajisati, II, 16 (DARMojio). # into a: galu, XIII, 36, 38; into i : munisa, Instead of the chilanthitikui of D, II, 15, D2 II, 6; -6 into i gihitha, XIII, 38; mi, XIV, gives childthitika and ARM chilanthitika; in. 1. 19; -8 into e, not only at the end of words, stead of the chagharuti of D, IV, 10, Da gives md for ah, as in pule, I, 3; mukhate, VI, 18; chaghasiti. - there are some exceptions, as lajano, II, 5; BHABRA. -- Finals: aha 1; che (four times; kelalaputo, II, 4; satiyaputo, II, 4, - but in twice cha); eva, 8. -- Medials: chilafhitike, 4. kaleti, V, 13; IX, 24; apakaleli, XII, 32; upakaleti, XII, 32. SAHABARAM. - Finals: avaladhiyena, 6; chd4,5 (more often cha); paina (= pakcha), 6- Ri changes to a: adhe, IX, 17; ananiyan, likhapayatha, 7. - Medials: chilathitika, 5. VI, 20; bhatiya, XII, 33; vadhi and vadhi, RUPNATH. - Finals: apaladhiyena, 4; paka, passim ; bhalakasi, XIII, 37, al.; kata, passim ; gahuthani, XII, 31; mate, mate, XIII, 35, 36, mamanend, 3; (i)ya(ni)janena, 5; vyuthena, 5. 39; nikati, VI, 19; usalena, X, 28, 29; viyapata, BARAT. - aha, 1; cha, 6. XII, 34, al.; vithatena, XIV, 18; - into i: Vowels shortened. - KHLo. - Finals: ma, adiel, IV, 10; didha, VII, 22 ; gihitha, XIII, 37; XIII, 14; -- Medials: ananiya, VI, 20; Edisaye, IX, 24; kipaninata, VII, 22; mige, I, ayatiye, X, 27; akalena, XII, 32; avahasi, IX, 4; migaviya, VIII, 22; (dise, IV, 10;- into 24; abhilamani, VIII, 22; avari, XIII, 6; avatake u: palipuchh&, VII, 23 ; lukhani, II, 6; rudhaXIII, 39; opaya, VIII, 23; laja, X, 28; lajane, nara, VIII, 23; vutan, XIII, 9. XIII, 5; vijinanane, XIII, 36. DHAULI. - a into * : avucha, VII, 2; IX, 16, DHAULI. - Finals: anuvigina (nom. pl.), det. (Jaug. avacha); munisa, VII, 1, al. (by the II, 4; -viyohalaka, det. 1, 1, and other noms. side of manusa); - a into e: heta (atra), XIV, plur. ; ichha, det. II, 4; sotaviya, det. I, 18; 19; - i into a in puthaviyan, V, 26; - iinto idja, det. II, 4; atha (yatha), four times against e: anusathe (for oth) VI, 31;- u into i: iunisa, twice atha; paja, V, 27; va (=va), V, 21, 25, loc. cit.; pulisa, det. I, 7, 8; & into i : 26; VI, 28, 30; det. 1, 20, 21. - Medials : niti, asamati, XIV, 19; veditu, det. II, 6 (for de det. 1, 8, 12 (?); sa(til)hina, det. 1, 22. = 'dayio); pitenikesu, V, 23; -o into e in Deuli. - Finals: ajaka, V, 7 (RM (r)ka); kaleti, V, 20, al.; and at the end of words asvatha IV, 4, 13; atha, VI, 4 (RM tha); III, when derived from ah: bhuye, dhanimate, &c. 20 ; esa (nom. fem.), L, 9(ARMdeg84); laja (nom.), (ne = no, na, at Jaug. det. I, 4, is doubtless passion (by the side of ldja); siya IV, 15; tatha, only an incorrect reading). VI, 6 (RM tha). - Medials: aladhi, VII-VIII, Ri becomes a: adase IV, 14; ananiyarn, det. 10; ava, IV, 15, (A anava, Mavu); avahumi, VI II, 9; VI, 32; bhati-V, 23; bhalaka, IX, 8; 6; palibhasayisas, III, 21; anwvidhiyanti, kata, passim; vadhi, IV, 18; usalena, X, 16; VII-VIII, 7('dhr, 1, 7); anulupaya, VII-VIII, viyapala, V, 24; -i: adise, IX, II; edisani, 13, 16, 18; bhutanawi, VII-VIII, 9; Opaya, VIII, 3; hedisa, passim; dhiti, det. II, 6; tadise, IV, 14; - u: lukhani, II, 8; puthaIn the following instances other versions viyani, V, 26; vudha, IV, 15; VIII, 4 ; perhaps present a short vowel, as against a regalar long kute, det. I, 16. VIII, 5.
Page #95
--------------------------------------------------------------------------
________________ MARCH, 1892.] THE INSCRIPTIONS OF PIYADASI. 87 JAUGADA. - a final changes into u in savatu, II, 8 (Dh. "ta); - iinto e in ananeyarn (= ananiyan = anrinyarn), det. I, 9; det. II, 13. DEHLI. - a into i; majhima, I, 7; - a into u: -mute (ARM), VI, 19; munisanam, VII-VIII, 2, al.; - uinto i : munisa, passim ; pulisa, I, 7, al.; mina, III, 8, if it really is equivalent to punah, which appears doubtful; into 8 : goti, I, 10 ; - & into i : sukalt. V, 8 (D2 l); gihilhanara, VIIVIII, 4 ; likhapita, passim ;-(ah) final into e: ite, IV, 15. - Instead of seyatha, V, 2, A has sayatha. -- Ri changes to a : apahata, VI, 3 (if really equivalent to apahritya); apakal hesu, VI, 5; bha akcesu, VIC-VIII, 8; vadhi, VII-VIII, 8, al.; kapana, VII-VIIL 8; kala, passim ; viyapa! , VII-VIII, 4, 5, 6; - into i: nisijitu, IV, 10. BHABBA. & changes to i in likhapayami, 8; - si into i in adhigichya, 6. SAHASARAM, - echanges to i in likhdpayatha, 7; -munisa, 3; - kid, 3; misan (=mrisha), 2, 3. RUPNATH. - Pavatisu (for degteo), 4; - amisa, 2; ka!a, 2, al. BAIRAT. - Badhi for 'dhe, 2. Additions and Suppressions.-Kils. - Additions : galaha, XII, 31; galahati XII, 33; supaddlaye, V, 14 (if equivalent to supradaryan); - sinehe, XIII, 38; - puluva, passim ; kuvapi, XIII, 39; suvamikena IX, 25. - Suppressions : pi, passim; ti (iti, IX, 26); na (= eva), IX, 26, alias. DRAULI. - Additions : supadalaye, V, 22; anuvigina, det. II, 4; ithi, IX, 7; kilamathena, det. I, 11; palikilese, det. I, 21; puluva, V, 22, al.; suvamikena, IX, 10; papunevu, det. II, 7. - Suppressions : ti (iti, det. II. 4, 7), pi, va (eva), passim. DEHLI.- Additions : upadahev, IV, 5; vidahami, VI, 6; ge(in)vaya, I, 7; asinare, IL, 11, al.; duvadasa, VI, 1 ; suve, I, 6. - Suppressions : pi, ti, va (eva), passim; anuvekha. mane, VII-VIII, 2; pativelchamdne, VI, 4, 7. BHABEA. - Additions: alahami, 4; abhikhinu, 7; pasine, 5. -- Suppressions : ti, 2, al. SAHABARAM - Suppressions : pi, ti, pagsim; va (eva), 3. ROPATH. - Additions : sumi, 1.- Suppressions: pi; ti; va; dani, 2 ; sumi, 1. Contractions. - KHALSI. - A(1)u into o: kho, X, 28, al.: - aya into e in causals; - ava into o: 610dhana, V, 16; VI, 18; - ayi into e in lekhapesdmi, XIV, 19; - aly) into e: tedasa, V, 14; -ya into i: paliliditu, X, 28; iya into e: etakaye, X, 27. DHAULT. - A(l)u into 8: Iche, IX, 8; - ava into o: viyahalaka, det. I, 1 ; viyovaditaviye, IX, 11; blodhina, passim ; - ava into 8, if aho, IV, 13, is really equivalent to atha va; - aya into e: ujenite, det. I, 23; - ayi into i in veditu, det. IL, 6; - ayo into e : tedasa, V, 22; - iya into e : etaka, passim ; - ya into i : palitijitu, X, 15; - va into u: atulanu, det. I, 11, 12 (Jang. degtu(r)); - vi into w : 81 (=svid), det. II, 4 ; dudhale, det. I, 16. Dehli. - Nigohani, VII-VIII, 5 (nyagrodha);-jhapctaviue, V, 10; kho, passim khu, II, 12; paliyovadatha, VII-VIII, 1; olodhana, VII-VIII, 6; viyovadisarnti, IV, 7, 9: su(svid), VII-VIIL, 17, 18. BHABRA. - Kho, 3; ovade, 5; abhivade. manann (for "dyro), 1. RUPNATH. - Lekhapetaviye, vivasltaviye, 5. Baisir. - Aladhetaye, 6. NASALISED VOWELS. - I do not attempt to point out all the instances in which the anusvara has been omitted, either in negligence, or by error. They are frequent, especially at Khalsi. Kh lsi. -A long vowel equivalent to & nasalised one: atapdsanda (uri), XII, 32, 33; dadata ('tari), XIII, 15; devanapiye, XII, 30, 34; dharmasu(su)sd (sav), X, 27; disa "sani), XIV, 21; heta (tasi), v, 14; kariumatala (lani), VL, 20; puju jash), XII, 31, 34; puna (= punyar), IX, 26; santan, XIV, 17 (if it is really a nom. plur.). - After Dr. Buhler's revision the only trace of a confusion between as and u which would appear to remain is sukhitena, XIV, 17 (for sanko). The concordance of several versions in the spelling supadalaya, V, 14, renders, in this instance, the equivalence of sam and su hardly probable. DHAULI. - Equivalence of the long and of the nasalised vowel: bumbhana and babhana; bhavas udhi (dhi), VII, 1; kalantas (nom.
Page #96
--------------------------------------------------------------------------
________________ 88 THE INDIAN ANTIQUARY. [MARCH, 1892. plur.), det. I, 18; karimala(last), VI, 32, as three sibilants of Sanskrit. I have already against kamatala, at Jaug. ; lili, X, 13 (!ist); dealt with this question in the Introduction ; soilidhi (lirik), VIII, 4; polatini; (old, a); and I shall return to it later on. I can, VI, 23; stuciyani (Jaug. yi), det. I, 17; therefore, neglect its consideration here I vataviyair (y), det. 1. 2; yu (yeni), IV, 17. - may remind my readers that in transliteraSaritani (11. s. m.), VI, 30, and ruye ( vayani), tion I represent the sign M by $. - The det. II, 8, appear to imply the equivalence of second point concerns the use, at Khalsi, of a can and e. - # fer a in le'si aintana, det. II, character t which I, at first, considered as a 10. - The nasal is written double in cinalnit simple graphic variant of +. The same sign bhe, III, 11; samyu, IX, 8; 8ulshii, det. is employed twice (rudili, adhakrisiunt) at D. II, 5. I pass over this difficulty here, and content DEHLI. - Anwalipalitini), VII VIII, 3; myself, in order to retain consistency in tran-visati, V, 1, 20; samlari tom. plur.) IV, 13; scription, with rendering the sign in question tinni = trin), IV, 16: V, 12; ya iyani (= by l, as I lave hitherto done. yari idurit), VII-VIII. 7; - kimwi, VI, 5, (= kimu). Simple Consonants. SAHASARIN. - Am-risur, 2 ; misan, 3(= s(); Changes.-KHALSI. - k into g in uriliyinga, chani, 5 (= ca). II, 5; XIII, 4, 5. g into k in maka, XII, 5; arite kina, ibid. (b). - Consonants. gh into h in lahka, XI, 32, al. Two peculiarities are common to all the ch into che in kichhi, passim. versions, which we are now comparing. In the first place they know neither the cerebral i into d in palitidit, X, 28. ??, nor the palatal n. They replace hoth by the the i t into ! in Thadaka, XIII, 37, alias; kala, dental >>. There is only one solitary excep- passim ; male, XIII, 39 (by the side of male): tion : Dh. det. II, 6, would seem to have, palis, passin; usalen, X, 28, 29; viyepata, according to General Cunningham's facsimile, passin; rithaleni, XIV. 18; - into il in dose. patiina. I should be much surpriseil to find | VI, 19; hidlasukhaye = kitasu", V, 13. this reading authenticated; already, in Prin- into din hediset, VIII, 22; IX, 25 (by the sep's time, the facsimile published by him side of Glisa); duvadasa, III, 7; IV, 13; - shewed that, at this place, the stone is damaged into t in talopaya, VIII, 13 (?); - into y in and the reading uncertain. I am strongly iyan (in the neuter, for ilan), passim. tempted to believe that the real reading is dh into 1 (?) in hida, passim. paimnu, as at Jaugada. As to ? Dr. Buller 1 th into h in heti, etc., passim. states two exceptional occurrences of it, one in khanasi, Dh. det. JI, 10, the other in sarena, y into ; in majului, 1. 4;- into v: vasevu, J. det. II, 3. - In the second place, they have VII, 21 (ordinarily the terruination is eyu): - no r, replacing it regularly (when standing inte h eut. VI. 20. alone) by 1 I notice only two exceptions, - at into h in het chri, IX, 26. Ruppath, where, by the side of ahale, 6, we Dualt. - I changes into kh in akhakhase, read chhavachhare, 1, and chira! Milika, 4. det. I, 22. Samavariya at KL. XIII, 2, is probably a false into gh in chayhati, II, 11, al., if it is reading. really equivalent to jagri, which is extremely Khalsi presents a two-fold peculiarity: the doubtful. first is the use, for the sibilant, of three signs ch into ; in ajula, det. II, 7, (Jaug. has differing in unequal degrees : M , and dof achala); - into chh in kichki, passim. which the first is also employed on one occa! jinto ch in chaghati, loco cit.; karibocha, sion at Bairat (svunngikiye). It appears to me V. 23. to be certain that these signs are all, among I t into ch in chithitu, IV, 17; - into ! in themselves, absolute equivalents, and that they pali, passim ; kala, passim ; viyapad, det. I, do not represent, as has been maintained, the 15, al.; usalena, X, 16.
Page #97
--------------------------------------------------------------------------
________________ MARCE, 1892.] THE INSCRIPTIONS OF PIYADASI. 89 th into h in aho (?), IV, 13. Il into d in udali, 4 dh into d (?) in hida, passim. RCENTU. - d into a in udula, 3. bh into h in lakevri, det. II, 5; hoti, &c., Uh into h in husu, 2. VIII, 4; haitapuluva IV, 14, al. Additions and Suppressions. - KHAls.y into v in the termination Evu of the 3rd Loss of an initial y in: a, XII, 31; ait, IV, 12; pers. plur. of the potential (nt Jang. @yu, except X, 28; udise, IV, 10; atata, II, 5, 6; asi, VII, in nilhamavit, III, 11); uvutite, Jet: IT, 8 (at 21; atha, II, 4; XII, 34; era, IV, 12; V, 14; IX, Jang. kyu); - into h in the lst pers. sing. of 25, 26; hvatake, XIII, 39 ; e, passim. - Addithe potential : ychani, &c. tion of an initial y: yeva, IV, 12; XIV, 17; of v into m in maye (= vayan), det. II, 8. a medial y: kaligya, XIII, 35, 36 (kaliga, XIII, JAUGADA, - Is into g in hidaloga 39); of an initial h: hedisa, VIII, 22; IX, 25; palalagani, (Dh.: Likalokari), det. II, 7; hidalogikao heta (atra), IX, 24, al., heta, X, 28; hecani, (Db.: kideg), det. II, 12-13. passim, (ivari, II, 6); hida, VI, 20, al. d into t in patipatayeha, det. I, 5 (Dh.. DRAULI. - Loss of an initial ), except in: olivedlaweharit). Dulindlavena, det. I. 5 (Dh.: 1 yaso, X, 13; yd, IV, 17; ye, I, 8; V, 21; yehana, pidla); vipalipatayantari, det. I, 8 (Dh.: VI, 32; ynj, passim ; yona, V, 23; -of the vipatipaluyamendhi); palipatayehan, II, 2; syllable ra in hemeva, det. I, 24. - Addition saripolipitayitare, det. II, 16 (Dh. : opdila). of an initial y in : yeva, IV, 17; -- of a v in vule, IX, 10; -- of an initial l in hedisa, passim DEHLI. -- g into gl in chaghatuli (??), IV, (by the side of edisa); hemeva ; heta, XIV, 19; 8, 10. heta(i), V, 21; hevasil, passim (never evani, eva gh into h in laha, VII-VIII, 9. and never heva); hida, passim. j into ch in chaghaniti (PP), IV, 8, 10. DEALI. - Loss of the initial y in: ata, ! into d in vadila, VII-VIII, 2. VII-VIII, 11; atha, III, 20; IV, 10; VI, 4; tinto ! in, kala, passim ; pati, passim ava, IV, 15 (yava, V, 19); 6, V, 17; VI, 8; enu, (paliyasatinesu, VI, 5); viyapala, VII-VIII, VII-VIII, 11 ; -of the syllablo ya in: etailatha 4, 5, 6; - into v in chaoudasari, V, 12. (or possibly oquivalent to elailathai?), VII-VIII, th into !h in nighanthesu, VII-VIII, 5. 3; -of tho syllablo va in homeva, VII-VIII, d into a in duvadusa, VI, 1; painadasari, 4, al. - Addition of an initial y in yeva, V, 13; V, 12 VII-VIII, 8 (by the side of eva); -of an initial ch into a (?) in hida, VII-VIII, 6, al.; - v in vulan, IX, 10; -of an initial h in hemeva; hevan, passim (by the side of evari); hida, VII. into h in nigokani, VII-VIII, 5. VIII, 0, al. pinto b in libi, VII-VIII, 10, 11; - into m BEABRA. - Loss of the initial y. - Addition in mina (= punah?), III, 18. of an initial h in hevari, 3, 8. th into in hoti, &c., passim. SATTASARAN.- Loss of an initial y in am, I, 2 in into ph in kaphala, V. 5.; - into v in (yala, 7). - Addition of an initial v in vivutha, gevaya, I, 7. 7; -of an l in havari, 1. y into y in avuti, IV, 15; termination ecu RUPTH. - Addition of an initial h in of the potential; papovd, VI, 3; - into h in hodha(?), 4; hevuni, 1. - The initial y remains the termination elan of the 1st pers. of the unchanged: yavataka, 5; yd, 2. potential. BAIRAT. - Initial y lost in ari, 3, preserved s into h in hohanti, VII-VIII, 1, 5, 6(hosanti, in ya (yad), 2. VII-VIII, 2), Compound Consonants. BHADRA. - k into g in adligichya, 6. bh into h in losali, 4. kt becomes t. Kh., Dh., D. ky becomes liy: (s)akiye(?), S. 3; sakiye, SAHABARau. - p into v in avaladhiyena, 6; R. 3; svungikiye(?), B. 6. pavatave, 3. kr becomes always k. bh into h in hot16, 5. kr becomes kuv in kurripi, Kh. XIII, 39. v 12.
Page #98
--------------------------------------------------------------------------
________________ 90 THE INDIAN ANTIQUARY. [MARCH, 1892. kesh becomes, at Kh., kh : khudaka, X, 28, &c.; tsy becomes chh at D. in -machhe, V, 4. chh in chhanati, XII, 32;-at Dh., kl: khulaka, ddh becomes, at Kh., dh in vadhi, XIL, 31, det. II, 5, &o. -- at D., kl: unuvelhumdne, 34, 35, remains dh in vadhi, IV, 12, 13; - dh, VII-VIII. 2. &c.;jh in jhapetaviye, V, 10; at at Dh., in vadhi, IV, 18; vudha, IV, 15; VIII, Bh. 1:2 : Whikhuniye, 7; - at S., kl: khuulakii, 4; and at D, in vadhi, passim. 4; - at R, kh : Khudaka, 3. dy becomes j (Kh., Dh., D.), oxcopt in uyana kokn becomes khin in abhilhinah, Bh. (Kh., VI, 18; Dh., VI, 29) in which it becomes kshy bocomos kh in dupafivokho, D. III, 19. y, and at D., I, 3, in dusaspatipadayc for liye, dye. khy bocamos, at Kh., kh : salchasi, XIII, 14:at Dh , khy: miklyamata, dot, II, 2; dot. I, 3 dr booomes overywhere d. (Jaug.: mokhiya"); - at D., kh : milhani, V. du becomes, at Kh., duv: duvadasa, III, 7. 20, and they: milikyamate, VI, 19. &c.; - at Dh., duv : duvala, det. II, 2, &c.; gn becomes, at Kh., 9 : agilidhani, IV, 10; v in anuvigina, det. II, 4; - at D., duv : duvehi, - at Dh, g: agi-, IV, 3; and gin: aruvigina, VII-VIII, 8, &c.; - at S., R. and B., d in det, II, 4. jaribudipasi (8., 2; R., 2; B., 4); and duu at S. in duve (6) gr becomes g, Kh, Dh., D. dhy becomes, at Kh., dhiy in adhiyakha, XII, jit becomes than or ", Kh., Dh., D. 34; - at D., dhiy in avadh[]ya, V, 2, 8, 13 vich becomes in, at D.: paslanadasa, V, 12, (RM dhya), avadhiyani, VII-VIII, 9, &c. ;jh al.; - at 8.: panand (P), 6. in nijhali, VI-VIIL, 8. dy becomes diy at Kh.: parhdiya, XIII, 6; - dhr becomes dh, Kh., D. at D.: chaundiyo, III, 20. ny becomes slan, Kh. Dh., D. my becomes niy in ananiya, at kb., VI, 20; pt becomes t, Kh., Dh., D. - Appears to at Dh., VI, 32; det. II, 9; -wen in hilarina; chango into chango into vat in pavatave (=pruptave), 8., 3. at Kh., VIII, 23; at Dh., VIII, 5. pr becomes evorywhere p. tk becomes k, D., 8. bdh becomes dh : ladha, Kh., XIII, 11, &c. tth becomes th in uthana, at Kh., VI, 9, al.; br becomes b, Kh., Dh., D. at Dh., VI, 31, al. bhy booomos bh, at Kh., in ibhesu, V, 15; - to becomes t, Kh, Dh., D. romains unchanged, at D., in abhyundmayety becomes, at Kh., tiy: apatiye, V, 14, &c.; ha, VII-VIII, 19; abhyushinamisati, VII-VIII, romains unchanged in mityarh, XIV, 19, if 21. - It is written bhiy, at Dh., in ibhiyeu, V, indood wo aro to road thus; changes into ch in 24; alabhiyisu, 1, 3; at Kh., in alabhiyati, niche, VII, 22; into t in palitijitu, X, 28; - at &c., 1, 3, 4. Dh., becomes tiy: atiyayike, VI, 19, &c.; bhr becomes bh, Kh., Dh. changes into ch in tkachd, I, 2 (doubtful; J. bas my remains unchanged in samya at Kh., IX, ekatiyd); nicke, VIL, 2; changes into t in palitijitu, X, 15; - at D., becomes ch: sache, 25; XIII, 37; and at Dh., susiknya, IX, 8. II, 12; pachapagamane, VI, 8; tiy in patiya mr becomes mb, at Kh., in tarabapmaniyd, sathne su, VI, 5, which R. and M. write patyasao. XIII, 6; at D., in ambavadika, VII-VIII, 2. tr becomes everywhere t. rg becomes everywhere g. tv remains unchanged in tadatvaye, at Kh. rgr bocomes gh, at D., in nighanthesu, VIIX, 27, and at Dh., X, 13; - becomes t at S.: VIII, 5. muhatatu, 3; sati, 7; and at R.: mahutata, 2; rel becomes ch, Kh., Dh., D. sata, 5. rn becomes in, Kh., D. to becomes s at Kh.: chikisa, II, 5; never- rt becomes, at Kh., t in nivateti, IX, 26; theless chikisalcichha, same line, appears to anuvatavili, XIII, 8, &c.; !, in anuvatisanti, show & certain hesitation between the formv , 9; (va)li, nival@ya, IX, 26; - at Dh., t chikisd and the form chikichha; usatena, X, 29; in anuvatisahti, V, 21; ! in anuvalatu, V, 27; - at Dh. II, 6; X, 6; - at D.: usuton, 1, 5; leili, X, 13; -- at D., t in pavatay@vu, IV, 5, chh, at R, in chhapuchhare. 13; ! in kovala, V, 14; palihutave, IV, 11.
Page #99
--------------------------------------------------------------------------
________________ MARCH, 1892.] - rth becomes, at Kh., th or th: atha, IV, 12, al.; atha, VI, 17, al.; - at Dh., th in athaye, det. I, 19, 21; det. II, 8; th in atha, passim; at D., th in atha, VII-VIII, 3, 10; th in atlasi, VII-VIII, 4, al.;-at S., th: athum, 7, al.; at R., th: athaya, 3, al.. rthy becomes thiy at Kh. (IX, 23) and at 25; at J. det. I, 6, we have alasyena. Dh. (IX, 7), in nilathiyam. er becomes 8, Kh., Dh., D., R. THE INSCRIPTIONS OF PIYADASI. rd becomes d, Kh., D. rdh becomes, at Kh., dh: vadhayisanti, IV, 12; diyadha, XIII, 35, &c.; dh in vadhite, IV, 11 (ordinarily vadhita); at Dh., dh: vadhayisati, IV, 16, &c. ;- at D., dh: adhakosikani, VII-VIII, 2,. &c.; at S., dh in avaladhiyona, 6; dh in vadhisati, 3,.6; at R., dh: adhitiyani, 1; vadhisati, 4; -at B., dh: vadhisati, 7, 8. 1 rdhy becomes, at S., dhiy in avaladhiyena, 6; dhiya in diyadhiyam, ibid.;-at R., dhiy and dhiy (same words); - at B., dhig in diyadhiyam, 8. - rbh becomes bh, Kh., Dh. rm becomes, mm, Kh., Dh., D. ry becomes, at Kh., liy in anamtaliyena, VI, 19; lay in supudulayo, if we assume it to be equivalent to supraclaryah; at Dh., the same, VI, 31; V, 22; liy at D.: suliyik, VII. VIII, 10; mithaliye, III, 20, &c.; at Bh.: aligavavui, 5 palydydai, 1, G. ru usually becomos in all texts; -luv, at Kh. and Dh., in peluca, passim. ra becomes 8, Kh., Dh., D. rsh becomes usually s (vase), Kh., Dh., D., Bh. - lp becomes p, Kh, Dh. ly becomes y in kayana at Kh., Dh., D. -- vy becomes, at Kh., viy: migariya, VIII, 22; viyamjanate, III, 8, &c., except in divyani, IV, 10; at Dh. and D., viy: divinani, Dh., IV, 3, &c.; hantaviyani, D., V, 15, &c.; ichhitaye, at Jaug., det. I, 5, should, probably, bo restored ichhitu (vi)ye; at R. viy (lekhape --- taviye, 4), except in vyuthona, 5; at B., y in aladhetaye, 6. or becomes v, Kh., Dh., D. sch becomes chl, Kh., Dh. en becomes sin in pasine, at Bh. (5). sy becomes siy, at Kh., in pativesiyena, IX, ev becomes at D., s in seta, V, 6; suv in suve, I, 6. shk becomes k, at Kh., in dukale, V, 13; at Dh., in the same word, V, 20, al. shkr becomes kh: nikhamati, Kh., III, 7, al., nikhami, Dh., VIII, 4, al. 91 - sht becomes th, Kh., Dh., D., R., and th, at S., in vivutha, 7. shth becomes, at Kh., th: adhithandye, V, 15; sethe, IV, 12; at Dh., th: adhithane, V, 26; adhithandyo, V, 23; nithuliyena, det. I, 11; h in chithitu, IV, 17; at D., fh, nithuliye, III, 20. rshy becomes, at Kh., chh in kachhami, &c., VI, 18, al. (= kar()shyami); - at Dh., s in isiga, det. I, 10; chh in kachhabi, VII, 2, al.; at D., sy in isyakalunena, III, 20; chh in kachhati, II, 16, nl. sth becomes, at Kh., th in chilathitika, V, 17; gahathani, XII, 31; th in chilathitika, VI, 20; at Dh., h in chilathalika, V, 27; VI, 33; at D., th in chilathilaku, II, 15 (AR rh becomes lah, at Kh., in galahati, XII, thi); thambhani, VII-VIII, 2; h in chila33; at Bh, in alahami, 4. at thitike, VII-VIII, 11; anathiku, V, 4; Bh., h in chilahlitike, 4; - at S., the same, 5; at R., thin silathumbha, 5; th in chilathitike, tsth becomes th in uthi (= pali utha 4 hati), Jaug., det. I, 7. sn becomes sin in sinehe, at Kh., XIII, 38. sm becomes, at Kh., s in locatives in asi; at Dh., remains unchanged in akasma, det. I, 9, 20, 21; becomes s in the locative in asi; ph shp becomes, at Kh. (IX, 26) and at Dh. (IX, 10) ph, in niphati;-p, at D. in chatupads, V, 7. shy becomes, at Kh., 8: alabhiyisanti, 1, 4, &c.; at Dh., 8: anupayisati, III, 11, &c.; h in Chatha, dot. I, 17; dot. II, 9 (Jaug., in both cases satha); at D., s: abhyannamisati, VII-VIII, 21, &c.; h in hohamti, VII-VIII, 4, 5, G (by the side of hesimli), and, to add it at once, although here k sy, in dahanti, IV, 18; at Bh., s: upatise, 5. sk becomes, at Kh., k in agikum Ihani, IV, 10; at Dh., kh: ayikhamlhani, IV, 3. et becomes everywhere th. - - - -
Page #100
--------------------------------------------------------------------------
________________ 92 THE INDIAN ANTIQUARY [MARCH, 1892 in aphe, det. I, 7, &c.; tuple, det. I, 4, &c.; - L a +i gives i in banbhanibhiyesu, V, 24. at D., s in the locative in asi; - at S., sum a+u gives 8 in munisopagani, II, 7; pajopain sumi, I,. in the locntive; - at R., sum in daye, IX, 26 (J.: pajupadaye). sumi, I; ph in tup(h)aka(), 5; 8 in the a+& gives & in cheva, IV, 16. locativo; - at B., s in the locative in asi. iti gives i in nitiyan (?), det. I, 12 (Jang. sy becomes, at Kh., s in the gonitive in asa; nitiyori), and in intime (Jaug., det. 1, 3), if we siy in siya, XII, 31, al.; - at Dh., s in the must really understand kinti ime. genitive in asa; siy in siya, passim ; alasiyena, * + u would seem to give uo in pasuopagans det. 1, 11; - at D., sa in the genitive; siy in (50 also at J.) (= pasu(k)opagani P), II, 7. siyu, IV, 15; VII-VIII, 11; - at R., siy in But most probably we should take as starting siya, 3. point a form @paga cquivalent to upaga. er becomes 8, Kh., Dh.; sin, at D., in asinave Bofore ti (=ilt), a final vowel is lengthened : II, 11, al. patipaday&mdti, det. I, 10; palipajeyati, XIV, sv becomes, at Kh., & in salunit, VI, 18; suv 19; mamati, det. I, 12;.aladhayaritati, VI, 33; in suvamikina, IX, 25; remains unchanged in aphesuti, det. II, 4, &c. svagan, VI, 20; - at Dh., remains unchanged d final remains unchanged in tadopaya, asvasandye, det. II, 8, 10 ; svaga, passim ; VIII, 5. becomes suv in swvamikena, IX, 10; at D., re mit before a vowel changes to m, or is even mains unchanged: asvasa, V, 18; asvatha, IV, written im in hodisarimeva, det I, 24 ; snkha. 13; - at S., su in suaga, 4; - at D., remains sameva, dot. II, 5. unchanged in svage, 3; - at B., remains DEHLI. unchanged in svaigikiye, 6. a + a gives , or remains uncombined as in hm becomes, at Kh., hbh in baibhana, Puasaablisita", VI, I (RM subhio), al. passim ; once ihm in barihmano, XIII, 39; - at Dh., bh, vibh in babhana, IV, 12, &c, ; a + u gives o: chhayopagani, VII-VIII, 2. bannbhana, IV, 15, &c.; - at D., th: babhana, a + e gives & in cheva, VII-VIII, 4. VII-VIII, 4, 8. i + a gives i in dupafivekhe, III, 19; palive kshami, VI, 4, 7. (c). - Sandhi. KILSI. 16 + a gives u in anuvekhamane, VII-VIII, 2. a+a gives a; but atata ; II, 5, 6; dhash * + u gives u in anuposathan, V, 13. manusathi, III, 7, al. ; &c. e + i gives i, in kiyani, II, 11, if my expla nation is right. a ti gives e in cheme, V, 17; 1, in baribhansbhesu, V, 15. Before ti, a final short vowel is sometimes lengthened : namati, III, 19; kachhatiti, II, 16 a +u gives 8: manusopagani, II, 3; pajopa (RM (r)tio); dladhayevuti, IV, 19, &c. (but daye, IX, 24. vadhisati ti, VII-VIII, 7; hotu ti, VII-VIII, 10). a+& gives e: cheva, IX, 25; yenesa, XIII, 38. d final remains unchanged in tadatha, VII. i +a gives i in ithidhiyakha, XII, 34. VIII, 3. u+u gives & in pasopagani, II, 5. d final remains unchanged in sadvisati, I, 1 & + a gives & in eyan (1) (= ayain), V, 15; al.; assimilated in samasike, V, 9. etayelhaye, VI, 20; a in etayathayo, XII, 34. in final remains unchanged, or is even doubled + a vowel changes to m in tam eva, XIII, before a vowel; hevari meva, VI, 6; etameva. 15; tanam eva, XIII, 38 ; hovam eva, II, 6; VII-VIII, 2; kayanaimeva, III, 17 (A name). XIII, 6. BHABRA. DHAULI. Laghulovdde, 6; sarnghasiti, 2; h()satidi, 4 a + a gives & (but atata, II, 7; chashmanusa hevarmeva, 8. thi, VIII, 5, &c.); or remains uncombined in: 1 SAHASARAM. mahlapaye, det. 1, 15 (Jaug., mahdpaye); Sadhike, 2. manaatileke, det. 1, 16; desaayutike; Jaug., RUPNATH det. II, 12 (Dh. : desavu). Satileka.
Page #101
--------------------------------------------------------------------------
________________ MARCH, 1892.] MISCELLANEA. 93 MISCELLANEA. AN EARLY KADAMBA ROCK INSCRIPTION. A FOLKTALE ABOUT THE KOMATIS. The following rock-cut inscription, in two lines, The Komatis are generally the merchant class of was discovered by Mr. Govind Gangadhar Desh- Southern India. Economy and frugality are their pande, at the falls of the Ghataprabha near characteristic traite. If a person goes to a Komati Konnur, in the Gokak Taluka, Belgaum District. bazdr to purchase anything, the merchant is all I transcribe it from estampages made by him; a politeness to him and entreats him to take a seat. note on them indicates that the inscription is This politeness is partly superstitious, and leads " on the face of the cliff on the right of the to one curious practice. Supposing a purchaser falls." asks for pappr (or dal) and the Komati has none with him he will never say ledhu (no), but TEXT. will answer "Suomi, uppuundhi, Sir, there is salt." 1 Pitfi' bhaktas=suchir=ddaksba[b] Baty. "No" is considered to be a word of ill-omen otskha-pratapaven LI ] and is never heard from a Komati's mouth. In giv. 2 Kadambanam kule jatah srim&n=Damo. ing an answer to do duty for "no," Komati will daro pripah [ll *] usually try to rhyme to the purchaser's remarks. To the popular mind the word Komati, or TRANSLATION rather Knimati, taken to be ku (good)+ mati intel. Dutifulto(his) father, pure, intelligent, possessed lect), means a man of aense or a clever man. of courage and energy and vigour,-(such is) 1 In this connection the following story about the illustrious king Damodara, born in the the Komatis is told :family of the Kadambas. "Once upon a time a Pandiyan king had a new This record gives us a new name in the Early silver goblet of enormous size made for the use of Kadamba family, and may perhaps be taken to the palace, and he superstitiously believed that its indicate a point to the porth-east to which the first contents should not be of the ordinary kind. territories of the kings of that line extended. So in view of making a special use of it, he ordered Damodara is probably to be allotted to a period his minister to publish it abroad that all the subnot long after the last of the connected names jects of his kingdom were to put into the vessel a given in my Dynasties of the Kanarese Districts, chembu full of milk from each house. The frugal p. 9. Komatis, heuring of this, thought each within himself, Oh! when the king has ordered such a Another point of interest in this record, is, that the characters, which belong to the large quantity, and all will bring milk, it will be southern class of alphabets, are of the same "box enough for me to take a chembu full of water, as a little water poured into such a large quantity of headed" type with those used in the Eran in milk will not change its colour. It will not be scription of Samudragupta and the Nachne-ki-taldi and Siwan Vakataka records (Gupta Inscriptions, known that I poured in only water, and I shall pass pp. 18, 283, 243). The size of the letters varies off as having given my tribute. In this way all the Komatis brought each a chembu full of from 21" to 4'; the largest akshara not formed entirely between the lines of writing, - vis., the water, and no one of them told the other of the deceit he was about to practise. Now, it so erf of Sriman, line 2,- is about ten inches from happened that the Komatis were the first to top to bottom. Line 1 is about 4' 4'' long; and line 2, about two inches longer. It should be enter the palace, while they thought that the noted how the visarga is assimilated to the follow people of other castes had come and gone. The ing sibilant in 'bhaktab=buchiro, line 1; but the vessel was placed behind a screen, so that no one might cast the evil eye on it and the Komatis same is not done at the ends of the first and third quarters of the whole verse. were let in one by one to do honour to it. This they did in all haste and each returned with great Near the above record, there occurs twice the joy in the success of his deceit. Thus there was name of ari-Damodara : once in "box-headed " nothing but water in the vessel. Now it had characters of precisely the same type; and once been arranged that the king was to be the in the characters customarily used in the Early person to see the contents of his new vessel, and Western Chalukya records. and when he went to the apartment where the J. F. FLEET. ! vessel was kept and saw its contents, he was 1 Metre, Bloks (Anushtubh).
Page #102
--------------------------------------------------------------------------
________________ 94 THE INDIAN ANTIQUARY. [MARCH, 1802. thunderstruck to see only water, and was greatly We each brought a chembu-ful of water to find disappointed. He became enraged at the impu- | out how many chembu-fuls your Highness' dence of the Komatis and directed his minister precious vessel contained. Now that we have to punish them severely. However the ready taken the measurement, we will forthwith fetch witted Komatis came forward with all presence of the quantity of milk required.' The king was ex. mind and eried out, 'ogracious king! appease thy tremely pleased to hear this and sent them away." anger and kindly listen to what we have to say. K. SRIKANTALIYAR. NOTES AND QUERIES. SIMILAR PASSAGES IN THE BHAGAVATA. word for word similar, yet are sufficiently so to PURANA AND THE BHAGAVADGITA. prove that the author of the Bh-igavata-Purdna While recently reading through the Bhaga- was familiar with the Bhagavadgitu, and used it vata-Purana, I came across several verses which freely in the composition of his work. I give are almost word for word the same as are found below, in parallel columns, a few of these similar in the Bhagavadgita. Others again, though not | verses :Bhagavata-Purana. Bhagavadgita. nahi kazcitkSaNamapi jAnu tiSThatvakarmakRt // nahi kazcitkSaNamapi jAnu tityakarmakRt / / kAryate yavazaH karma guNaiH svAbhAvikaibalAt // kAryate hyavadhaH karma sarva prkRtijairgunnaiH|| 631,53. 3; 5. yadyadAcarati zreyAnitarastattavIhate // yadyAcarati zreSThastattadevetaro jnH|| sa yatpramANaM kurute lokastadanuvartate / / sa yatpramANaM kurute lokastadanu vartate / / 6% 32,4. 3:21. badA badeha dharmasya kSayo vRddhizca paapmnH|| badA badA hi dharmasya glAnirbhavati bhArata / / sadA tu bhagavAnIza AsmAnaM sRjate hariH / / abhyutthAnamadharmasya tadAtmAnaM sajAmyaham / / 9% 324,56. 4; 7. saMsthApanAba dharmasva prazamAyatarasya ca // parivANAya sAdhUnAM vinAzAya ca duSkRtAm / / bhavasINoM hi bhagavAnaMzena agdiishvrH|| dharmasaMsthApanArthAya saMbhavAmi yuge yuge| 10333,27. 48. patraM puSpaM phala toyaM yo me bhalayA prayacchati / / patraM puSpaM phalaM toyaM yo me bhalyA prayacchati // tadahaM bhattayupahRtamamAmi prayatAsmanaH / / tadahaM bhanyupahatamAmi prayatAtmanaH // 10:81,4. 9; 26. J. E. ABBOTT. SANSKRIT WORDS IN THE BURMESE | in which the Tripitaka and its cunamcntarios LANGUAGE. ure written, being the language of their religion, It is generally stated by those who can speak one would nuturally expect that the Burmese with authority on the subject, that the Burmese would borrow from Pali rather than from derived their culture, religion, and letters from | Sanskrit. The appended list may, in some degree, India through the Talaings, and that Burmese serve to corroborate the above statement. civilization dates from the conquest of Thuton by The following remarkable passage, extracted A noratazo" (PAli Anuruddha) in 1058 A. D. This from the preface of Trenckner's edition of the statement appears to be vitiated to some extent Milindapatho, will be of interest in the present by the fact of the existence in the Burmese connection, as shewing the use by the Burmese of language of a number of Banskrit words, the Sanskrit, rather than the Pali, spelling of both derived and naturalized, importing not only certain Indian words:terins in religion and mythology, but also those relating to social life. The language of Magadha, "It is, however, but fair to add that, on closer In explanation of this note it must be remarked that in Burmese pronunciation consonants are seldom tuapirated. Where they are the aspirate is shown by'-. The consonants shown in brackets, as (k), (), denote the common Burmese trick of barely soundiug certain finals in syllables. In Burmese ky, kr are sounded ch: qw.gr as j. In every case in the table the pronunciation of th is as in thin. The Burmese t and d are practically the English sound of those consonants-Ep.1 [represents the sound of aw, as in awful.-En.l
Page #103
--------------------------------------------------------------------------
________________ MARCH, 1892.] NOTES AND QUERIES. 95 acquaintance, certain spellings (found in Burmese MSS.) are met with, which strike our attention by agreeing closer with Sanskrit in etymology than the corresponding Sinhalese forms. Now the Burmese can soarcely be suspected of introducing Sang. kritisms, and it is rather to be presumed that, in such cases, they have been the sole preservers of the true and original Pali form." Burmese. Sanskrit. PAli. Spelling. Pronunciation. Adun. 1. Adhvan 2. Ainrot* 3. Bhissiks 4. Chakra 5. Chakrava! 6. Chakravates 7. Chankram 8. Drap 9. Groh 10. KambhA7 11. Mrikkaso 12. Parissad 13. Phusha 14. Prakate 15. Prassad 16. Pritta 17. Rase. 18. Samuddard 10 19. Sariputtara 20. Sattava 21. Sikra Amyaik Be(k)thek Se(t)chs Se(t)chawala Se(t)chawades Zinjan Dya(t) Jo Kaba Myo(k)katho Paye(k)that Pok tha Pyagale. Pya(t)that Pekta Yathe Thamo(k)days Thayipo(k)taya Thadawa Thaja 8 Adhvan Amrita Abhisheka Chakra Chakravala Chakravartin Chankran Dravya Graha Kalpa Mrigasiras Parishad Pushya Prakati Prieda Preta Rishi Samudra 8&riputra Sattva Sakra Addhaniya Amata Abhiseka Chakka Chakkavala Chakkavati Chankama Dabba Gaha Kappa Migasira Parisa Phussa Pakati Paskda Pata Isi Samudda Seriputta Satta Sakka KALLIL, A FAMOUS SHRINE IN SOUTHERN INDIA. Kallil, which means literally 'a stone,' is the name of a famous pagoda situate in the Kannuthnad Taluks of North Travancore, about sixteen Taw Sein Ko. miles east by north of Tripontera, the residence of the Cochin royal family itself, and distant about six miles east of the British port of Cochin. Members of the small colony of Banians (Jain Vaisyaa) settled in Native Cochin frequent 3 [It is by no means yet proved, bowever, that the Burmese had no learned communications with Indis direct in days gone by.-ED.) This word being a synonym for Nirvana, one would naturally expect a derivative from Pfli rather than from Ranskrit. * The prefix of Sanskrit and Pali derivatives is generally olided in Burmese: cf. sankhyd for asankhayya ; dhipati for adhipati. The conjunot consonant is sounded as in the Arakanese dialect, but is always softened into y by the Burmese. The ch of Sanskrit and PAli is always pronounood s by the Burmese. 1 The conjunct consonant l, as in salldpa, allapa (pronounood aanldpa, anldpa), is always pronounced like anusviru in Burmese. In ancient books the word kambhd (for kolpa) is written kanphd. . The voweli is pronounced as & when followed by # Bonsonant. It is a remarkable fact that the Talaings, through whom the Burmese are supposed to have derived their knowledge of Buddhism, have naturalized the PAli word ini, in ito proper form, while the Burmese have adopted . Sanskrit derivative from pishi. 10 The pronunciation of dra is phonetically impossible to Burman : hence the insertion of an augmentative a between d and r. See a similar augment in the caden of tra and toa in the two next words. 11 The Sanskrit form of the name of the chief discipl of Gautama Buddha is worthy of notice. 19 A fanciful etymology has been invented to derive Bakra from thi, to know, and kya , to hear : knowing and hearing of events that happen in the world of Amen being one of the attributes of the Recording Angel of Buddhism. [In Upper Burms I have known the word spelt (satkya) the(t)cha, though pronounced correctly thajd, and the folk etymology of it given as that, to descend, and (kya) cha, to fall, 1.8., he who descends and falls, because the Burmese Recording Angel deboende to the earth during the great annual festival of the New Yor.-ED.)
Page #104
--------------------------------------------------------------------------
________________ 96 THE INDIAN ANTIQUARY. [MARCH, 1892. this shrine, and believe that he who proceeds coming into it; but the rook always gradually thither a sufficiently large number of times obtains rises, so as to throw down the building. The salvation. The pagoda is on the top of a preci- old nen of the village are always willing to pitons rock, a small portion of which alone touches certify to this. the earth, affording a beautiful and wonderful N. SUNKUNI WARIAR. scene to anyone who goes up. A Pisharoti (high-caste Sadra temple-servant by profession), who lives close by, has the sole management of the ANTIQUITIES OF MALABAR: PARAL. pagoda, although he is looked down upon, because Mr. R. Sewell, Lists of Madras Antiquities he has not a large family growing up round him. (Vol. I., p. 255), says - Siva and Bhagavati are both enshrined here. Of "Five miles south by west of Trichar - on a recent years a figure of Brahma is said to have rock, here, is an inscription with some large foot. sprung up of itself on the top of the rock. prints cut in bas-relief and other sculptures." There is a superstition that if Bhagavati's I beg to subjoin some notes on the place. nge is not the first to be seen on going up to The small pagoda here is known as Parola lit. worship, the pilgrim is sure to die within eight on a rock, as it actually is). It is dedicated to days thereafter, generally by a sudden attack of Vishnu. It belonged to Mayaya Mangalam fever. Several instances in point are cited by the Naiburi (author of the Naishada Champu?), villagers. Pilgrims, therefore, take the necessary on the extinction of whose family the rights precautions to avoid so sudden a termination of 1 in it devolved on Tarananellurir Namburi. The their earthly existence. pagoda was built about 1866 by the present Uaya In Malabar the solar (or Tamil) New Year's Day Raja of Cochin (recurring on 12th April) is called Vishu, -and is On the northern side of the pagoda are five observed as a day of rejoicing and festivity. Early tirthams or sacred pools, and one on the western on the morning of this day it is the duty of side. These tirthams are named after the every devout Hindu to see the village deity the Pandavas, who are said to have lived bere for first of all things. For this purpos many lie some time. down to sloep the previous night within the Dharmaputra's is circular in shape. That of pagoda precincts, and people, who sleep in their Bhimasena is shaped like his gada (instrument). Bhima own houses in the neighbourhood, are escorted That of Arjuna is shaped like his bow. Those of thither by those who have been the first to Nakula and Sahadeva are smaller in size, and are make their obeisance. The good or bad fortunes the only ones in which there is no water during of the whole year appear to them to turn on this the hottest weather. The water in that of matter. Many go to see the image with their Paschali (the consort of the Pandavas) is reddish, eyes shut, and sometimes bound with a cloth, and said to be so because she bathed in it to - common custom during visits to parti. purify herself after her courses. cular images. On the rock may be traced lines drawn for The evening pfija to the goddess is offered at playing at dice. Here is a small shrine dedicated the Pisharoti's house, and not at the pagoda on the top of the hill, which is not approached About half a mile to the south is the celebrated by human beings in the afternoon, or after the pagoda of Ayyappan or Shasthavu, the village midday service is over. The tradition is that deity, nearly opposite which is the fifth milestone the goddess was once coming from Muhambi (a from Trichur. It is owned by a large number of celebrated shrine in the Western Ghats in South Namburi houses in the district. Kanara) playing with two pieces of stone and tossing them up and down as she was moving The offerings most pleasing to the deity are along, with a worshipper in front of her. All cakes, kadali plantains, rusuyums, nei (yl) and of a sudden, as they came near this spot, the pal (milk). man, according, it is said, to a row the goddess The god is noted for giving to dumb worhad taken, - sat down. There are two rocks shippers perfection in the art of letters, and on the hill, which appear to touch the ground there are traditions of several men having become beneath them without actually doing so, and famous after a continued worship here. The these are said to be the two stones used by the young Brahmans of the neighbourhood make it goddess. a point, before starting in life, to worship here for terms varying from seven days to one year. Efforts are occasionally made to raise & wall round the pagoda to prevent crows, &c., from N. SUNKUNI WARIAR.
Page #105
--------------------------------------------------------------------------
________________ APRIL, 1892.] THE AMGACHHI GRANT OF VIGRAHAPALADEVA III. THE AMGACHHI COPPER-PLATE GRANT OF VIGRAH APALADEVA III. BY PROFESSOR F. KIELHORN, C.I.E.; GOTTINGEN. THE HE plate which contains this inscription was found, in 1806, at Amgachhi in the Dinajpur District of the Bengal Province, by a peasant, digging earth for the repair of a road near his cottage; and it was forwarded to the Asiatic Society of Bengal, in whose Library it is still deposited. An account of the inscription was given by H. T. Colebrooke, in the Asiatic Researches, Vol. IX. pp. 434-38, and republished in his Miscellaneous Essays, Vol. II. pp. 279-82. And a tentative reading of the text was first published by Dr. Hoernle, in the Centenary Review of the Asiatic Society of Bengal, Part ii. pp. 210-13, and reprinted, after revision, ante, Vol. XIV. pp. 166-68. For my own account of this inscription I have used an excellent ink-impression, made and supplied to me by Mr. Fleet. The plate is a single one, measuring about 12" broad by 141" high, and surmounted by a highly wrought ornament of brass, fixed on the upper part, and advanced some distance on the plate so as to occasion a considerable break in the upper lines. It contains 49 lines of writing, 33 of which are on the front, and 16 on the back of the plate. The writing has suffered much from corrosion, especially on the proper right side of the front and on the corresponding part of the back, where many aksharas are more or less illegible. The size of the letters is about "The characters may be described as Nagari, of about the 11th century A.D., but as a special feature of the alphabet employed it may be pointed out that r, preceding another consonant, is often written by a short line, sideways attached to the right side of the akshara of which it forms part, not by the ordinary superscript sign, -a peculiarity which the inscription shares with others written in Eastern India. The language is Sanskrit. From about the middle of line 20 to the beginning of line 43 the inscription is in prose; the rest, excepting the introductory om svasti, is in verse. As regards orthography, the imperfect state of the plate prevents me from saying more than that b is throughout denoted by the sign for v. 97 The inscription is one of the devout worshipper of Sugata, or Buddha, the Paramesvara Paramabha!! araka and Maharajadhiraja, the illustrious Vigrahapaladeva, who meditated 'on the feet of the Maharajadhiraja, the illustrious Nayapaladeva (lines 23-24); and both in the arrangement of the matter and in its wording it follows closely the Bhagalpur grant of Narayanapaladeva, published ante, Vol. XV. pp. 305.7. After the words om svasti, it contains (in lines 1-20) fourteen verses on the genealogy of Vigrahapala, the text of which will be given in full below. In the prose portion which follows (lines 20-42) the king from his camp of victory pitched at a place which was not Mudgagiri, but which is spoken of exactly as Mudgagiri is in the Bhagalpur plate, informs the people and officials concerned that, in order to please the holy Buddha (bhagavantam Vu(bu)ddha-bhattarakam uldisya, line 36), after bathing in the Ganges on the occasion of a lunar eclipse (line 40), he has granted to a Brahman some land in the Kotivarsha vishaya of the Pundravardhana bhukti (line 24); and he directs the people to make over to the donee whatever may be due to him under this grant. This prose part closes (in line 42) with the date, probably the year 132 on the 9th day of Chaitra.' Lines 42-48 contain a number of benedictive and imprecatory verses. Another verse (in lines 48-49) gave the name of the data, appointed by Vigrahapala for this grant. And the inscription (in line 49) closes with a verse according to which the plate was engraved by the artizan Sasideva, a son of Mahidharadeva3, who, or whose ancestors, had come from the village of Posali. - What is of real and, indeed, of very great value in this inscription, plate grant hitherto discovered of the so-called Pala dynasty of Bengal, verses with which it opens. Of these, verses 1-5 are identical with the the latest copperare the fourteen verses 1, 2, 4, 5 1 See Asiatic Researches, Vol. IX. p. 434. 2 I am unable to make out with certainty from the ink-impression whether the year is 12 or 13. This Mahidhara engraved the Dinajpur plate of Mahipaladeva which will be mentioned below.
Page #106
--------------------------------------------------------------------------
________________ 98 THE INDIAN ANTIQUARY. [APRIL, 1892. and 7, and the sixth verse is only a slightly altered version of verse 10, of the Bhagalpur plate of Narayanapala, ante, Vol. XV. p. 305. And the genealogy, furnished by these six verses, undoubtedly is as Dr. Hultzsch, ib. p. 304, has put it : 1. Gopala. 2. Dharmapala. Vakpala. I 3.. Devapala. Jayapala. I 4. Vigrahapala. 1 5. Narayanapala. The verses 7-11 it would have been impossible to make out fully from this Amgachhi plate alone. But fortunately the very same verses also occur in a copper-plate grant of Mahipaladeva, which a few years ago was discovered at Dinajpur, and of which rubbings have been supplied to me by Dr. Hoernle. And although in the Dinajpur plate they are in general even less legible than in the Amgachhi plate, a continued study and comparison of both plates has enabled me to restore the text in a manner which I believe to be substantially correct. The Dinajpur plate also contains verse 14 of the Amgachhi plate, but places it immediately before the verse referring to Mahipaladeva, between verses 10 and 11 of the Amgachhi plate. For the decipherment of verses 12 and 13 (lines 16-19) of the present grant I have had no help beyond the ink-impression. Now, having (in verse 6) brought the genealogy down to Narayana, our inscription, according to my text, proceeds as follows: (Line 11). And his son was the protector of the middle world, the illustrious Rajyapala, whose fame is proclaimed by tanks as deep as the sea, and by temples the walls of which equal the noblest mountains. As the store of light proceeds from the eastern mountain, so sprang from that king of the east a son, born from Bhagyadevi, a daughter of the high-crowned Tunga,5 the moon of the Rashtrakuta family, the illustrious Gopaladeva, who was long the sole lord of the earth, gaily clad by the four oceans, lustrous with many precious stones. Him, richly endowed with the qualities of a king, the Fortune of regal power energy, good counsel, and majesty, worshipped as her lord, dear and attached to him, though he served the earth like a fellow-wife. From him sprang in the course of time, augmenting the innumerable blessings of his parent, Vigrahapaladeva, who, dear to all, stainless and versed in every art, when he arose, alleviated like the moon' the distress of the world. From him sprang the protector of the earth, the illustrious Mahipaladeva. Having in the pride of his arm slain in battle all opponents, and having obtained his father's kingdom which had been snatched away by people who had no claim to it, he put down his lotus-foot on the heads of princes. My reading of the text of this inscription will be published in the Journal Beng. As. Soc. The words bhagyadset and tunga of the original text need not, perhaps, necessarily be taken as proper names: but there can be no doubt that the author, by the words tungasy-ottunga-maule, wishes to suggest the name of the Rashtrakuta king of whom he is speaking. The reading of the Dinajpur plate is here slightly different. 7 The epithets, applied to the king, would also be applicable to the moon.
Page #107
--------------------------------------------------------------------------
________________ APRIL, 1892.] THE AMGACHHI GRANT OF VIGRAHAPALADEVA III. 99 From him, in consequence of his religious merits, was born the fortunate prince Nayapala Renouncing the attachment to sin, putting down his foot on the heads of princes, eagerly fulfilling all desires, free from mental blindness, beloved by his subjects, and the one home of affection, - he was like the sun which, when it rises from the eastern mountain, moves away from the night, touches with its rays the tops of mountains, opens up quickly all the quarters, drives away darkness, and is pleasant and red. From him is born the illastrious prince Vigrahapaladdva, full of majesty, eagerly gazed at by the good, always anxious to worship Smara's enemy, expert in battle even more than Hari. a god of death for the clan of his enemies, and a supporter of the four castes who plenses the world with the abundance of his bright fame. When the huge elephants of kis army had dronk pure water in the water-abounding paster. land, and had roamed about at will in the sandal-forests at the foot of the Malaya range, they like clouds settled down on the ridges of the snowy mountain, baving cooled the trees witli showers of drizzling rain.' Our Amgachhi plate, then, clearly furnishes the following line of the so-called Pala kinys :1. Gopala I. 2. His son Dharmapala. (According to the Mungir plate he married a Rashirakuta princess.10 And according to the Bhagalpar plate he conquered Indraraja of Mahodaya or Kananj, and gave the sovereignty of Kanauj to Chakrayudha. See ante, Vol. XX. p. 188.) 3. His nephew Devapala; (in his Mangir plate, which is dated in the year 33 of his reign, described as the son of Dharmapala.) 4. His nephew Vigrahapala I; (married, according to the Bhagalpur plate, Lajja, a Haihaya princess.) 5. His son Narayanapala. (His Bhagalpur plate is dated in the year 17 of bis reign). 6. His son Rajyapala; (married Bhagyadevi, a daughter of the Rashtrakuta Tuiga perhaps to be identified with Jagattuiiga II, who ruled in the first quarter of the 10th century A. D.) 7. His son Gopala II. 8. His son Vigrahapala II. 9. His son Mahipala. (He issued the Dinajpur copper-plate grant; and the Sarnith inscription, publislied ante, Vol. XVI. p. 140, furnishes for him the date V. 1083 = A. D. 1626). 10. His son Nayapala. (A Cambridge as. is dated in the 14th year and a Gaya inscription in the 15th year of his reign. See Bendall's Catulogur, p. 175, and Introduction; p. iii. and Sir A. Cunningham's Archirol. Surrey of India, Vol. III. Plate xxxvii.) 11. His son Vigrahapala III; (issued this Augachbi copper plate grant which is sited in the 12th or 13th year of his reign). As indicated above, this statement of the relationship of the l'ala king does not, so id: regards Devapala, agree with ihe account furnished by the Mingir copper-plate, which distincidy makes that king the son of Dharmapala, and his qucen a Rashtrakuta princess. This differe I am unable to reconcile. For the rest, I have only to add that all these kings andgabtedly were Buddhists; and that the figures given under 9, 10, and 11, prove this Amgachhi plate of Vigrabapa la III. to have been issued after A. D. 1083. . My translation very imperfectly expresses the meaning of this rerse. It may be sufficient to pay that the king i represented as the substratum of four colours (chiturtarrya), inasuch as he way yellow pila, red (rakta), groen (harita), and black (ala). * vis., with the water emitted from their trunks. 20 Was she a daughter of Sri-Vallabha ? i.e., Govinda III. (who rule in the art quarter of the 9th centary A.1). The lithograph bas sri-Pararalasya duhitun.
Page #108
--------------------------------------------------------------------------
________________ 100 THE INDIAN ANTIQUARY. [ABRIL, 1892. TEXT, LINES 1-20.11 1 0m2 svasti | Maitrix43 ka[runya)-ratna-pramudita-hridayah preyasin sandadhanah 2 [sa]myak-samt o(mb)[alhi-vi}dya-sarid-amala-(jala-ksha]lit-ajaina-pa3 ikah 1 jitva yah kana-kari-pinbhavam-abhibhavam sasvati[m] + prapa santi[m] sa srimaml=lokanatho jayati Da[sa]va(ba)18 Spyas-cha 5 [Gopalade]vah | Lakshmi".janma-niketanai samakaro vodhu[m] kshamah kshma bharan paksha-chchheda-bhayad=upasthitavatam=ek-asrayo bhubhrit[&] mary jada-pari palan-aika-niratah san(sau)ry(A)6 layoSsnad-abhadedu gdh-ambhodhi-vilasa-hasi-mahima fri-Dharmapalo pripah 1 Ramasyeva gpihita-satya-tapasas=tasy=inprupo gunaih Saumittrer=udapadi talya7 [mahima Vakpala-]nam=annjah yah sriman=naya-vikram-aika-vasatir=bliratuh sthitah sisane bunyab satra-patikinibhir-akarod-ek-atapattra disal [ll] Tasmad18=U8 [pendra-charitair=jagati]m-punanah putro vaba)bhuva vijayi Jayapala-nama dharma-dvisha[m] samayita yadhi Devapale yah purvajalo bhavana-rajya sukhany-avai(nai)shit 'Srima-17 9 [n=Vigra]hapalas-tat-shnur-Ajatasatrur-iva jatah satra-vanita-prasadhana-vilopi. vimal-asi-jala-dharah 11 Dikpalaihis kshiti-palanaya dadhatan deh[e] vibha10 [ktangunan 19 srimantam janayamva(mba)bhuva tanayam Narayanam sa prabhun yah kshonipatibhih siromani-ruch-alisht-amgh[r]i-pith-opala[m] nyay-opattam-alanchakara charitaih 11 [svai]reeya dharm-isanan 11 Toyikayair20-jaladhi-mula-gabhira-garbhair=d[@]valayais cha kulabhava(dha)ra-talya-kakshaih vikhyata-kirttir=abhavat-tanayas-cha tasya sri-Rajyapala i. 12 ti smadhya ma-loka-palah Tasmatal-purva-kshitidhran=nidhir=iva mahasa[m] Bash trakat-Anvay-endog-Tungasy=ottunga-mauler=duhitari tanayo Bhagyadavyam prasutah ["] brima13 [n=Gopala]devas-chirataram-avaner-ekapatnya iv-aiko bhartt-abhun=naika-ratna dyuti-khachita-chatuh-sindhu-chitr-amsukayah 11 Ya[u] "svamina[] raja gunaireanunam=isevate cha14 [ruta]r=anuraktill utsaha-mantra-prabhu-sakti-lakshmih prithvin sapatnim-iya sila yanta[i] # Tasmada-ya(ba)bhuva savitar=vasu-koti-vardhi kalena chandra iva Vigrahapaladeve15 [h 1 visva?]-priyena vimalena kalamayena yen=oditena dalito bhuvanasya tipah 11 Hata?i-sakala-vipakshah saugare va(ba)hu-darpadeanadhikrita-vilupta rajyam asadya pitryam [1 ] 16 [nihita)-charana-padmo bhubhritam murdhni tasmad-abhaval=avanipalah sri-Mahi paladevan | Tyajan doshasaiga[m] sirasi krita-pidah kshitibhritan vitan. van sarvv-asih prasabha17 [maendalvadrereiva ravib (0) hata-dhvantah snigdha-praksitiranurag-ai(?)ka-rasatis tato dhanyah punynir-ajani Nayapalo narapatih | Pitah sajjanale(18)chanaih Smara-ripoh paj-i 11 From an impression supplied by Mr. Fleet. 12 Expressed by a symbol. This symbol for 8ris is apparently preceded by the akshara ni, which is also put in the upper proper left corner of the plate. In the Bhagalpur plate of Narkyapapala the same alkhara ni is engraved in the upper right and left corners of the plate, above the first line. And in the Dinajpur plate of Mahipila it stands at the beginning and end of the first line. I am unable to explain the menuing of this alahan. 13 Metre, Sragdbart. 14 Metre, Sard Glavikridita; and of the next verse. 16 Metre, Vasantailaka. 16 Originally purvajo, but altered to prirvay . 17 Metre, Ary. 18 Metre, B&rd alavikridita. 30 Read gunanasrimantan. The BbAgnlpur plate hos vibhakth sriyah. 20 Metre, Vasantatilaka. * Metre, Sragdbara. 23 Metre, Indravajra. 93 Metre, Vasantatilaks * Metre, Malini. 28 Metre, Sikharipi. 20 Dietre, Sragibari.
Page #109
--------------------------------------------------------------------------
________________ APRIL, 1892.) THE INSCRIPTIONS OF PIYADASI. 101 18 (nuraktah sada] 27 samgrame [chaturo] Sdhika[i=cha] Haritah kala[1] kule vidvish Am chaturvvarnya-samasrayal sitayasa (sa)[h-punjai]2=jjagad=laijayan 127 srimad. Vigrahapaladeva-nipati19 [raejajne tato dhama-bhcit?] | Dese28 prachi prachora-payasi svachchhamrapiya tayam svairan bbrantva tad-anu Malay-opatyaka-cbandaneshu klitva san drais-tarushu jadatim sikarair-a20 [bhra-tulyah Pral@]y-adreh katakam-abbajaneyasya sena-gajendrah I THE INSCRIPTIONS OF PIYADASI. BY E. SENART, MEMBRE DE L'INSTITUT DE FRANCE. Translated by G. A. Grierson, B.C.S., and revised by the Author. (Continued from page 92.) 2.- INFLEXION. | (?), II, 5. - Dh. : laja, lajine, lajina, passim.; nom. plur. lajane, II, 6; VIII, 3; atanari, (&). - Gender. det. II, 7; atane, det. I, 25; kuimane, III, 10 I do not mention here the nee of the nomi (by the side of the nom. kurime, and of the gen. native in e for the neuter, although, strictly kariumasa). - D. : laju, passim ; nom. plur. speaking, it should, I consider, be dealt with lajane, VII-VIII, 12, 15, by the side of lajini, under this head (cf. at Kh., VI, 9, katuviyasi | VII-VIII, 3, with transition into the i-declenlakahite, &c.). sion ; atand, VI, 8. Khils. -- chat(u)7i (nom. mase ), XIII, 5; Bases in ANT. - Kh. : the noms. sing. sarite, hathini (nom. plur.), IV, 10; yulani (acc. plur. VIII, 22; kuluvile, XII, 33, have passed over masc.), III, 8. Also note the use of iyari for into the vocalic declension; of the consonantal the nom. sing. neut. (IV, 12, al.). declension there only remains the nom. plur. DHAULI. - yutani, III, 11; hathini, IV, 13; tithasile, IV, 12. - Dh. : malonial e (nom. sing.) iyoria in the nenter, passim ; esa ... hedisah, has passed over into the declension in a. - D.: IX, 8; dhaimachalanasi imta, IV, 16. To the the nom. plur. saritasi (), IV, 13, is surely masculine ime jata, Dh., det. I. 12, corre- to be referred to the vocalic declension, which sponds, at Jangada, the neuter etani jatani, Dh., is doubtful for anupalipajaritan, VII-VIII, det. I, 15, mahaapaye is in agreement with the 10.- Bh. : bhagavata, 3, 6. feminine asanpalipati. Bases in AR(RI). - At Kh., except in the De Ll. - annsathini, VII-VIII, 20, 1; puli- nominative plural natale, IV, 11; V, 13, all have sani, IV, 6; esa (III, 19, 21, al.) and iyani (III, passed over into the declension in i: lhatindi, 17, 18, al.), in the neuter; nigohani, VII-VIII, 2. IX, 25; bhatinasit, V, 16; pitina, IX, 255; BHABRA. - paliyayani, pitisu, III, 8; IV, 11.-Dh. : nom. sing. pitii, 6; & (nom. sing. det. II. 7; the nom. plur. nati, V, 21, must be neuter), 2. referred to the declension in i, like all the SAHABARIM. -iyash for the neuter, 4, 6, and other forms : bhatina, IX, 9; Whatinorit, V, 25: the mascnline, 5. pitinu, IX, 9; pitisu, III, 10, al. But, along ROPnATh. -- Kala employed in the feminine: with the base mati, IV, 15, we find the base imaya kulaya, locative, 2; iyan in the masculine, pitu, IV, 15. - At D., the one example which we 3, 4. possess, pitisu, VII-VIII, 8, shews the change into the i declension. The nom, apahala, VI, (b). -- Declension of Consonantal Bases. 3, is at least very doubtful, Here again we only find fragmentary re- Basce in AS. - Kh. : yaso (acc. sing.). X, mains. 27, 28. On the other hand, VIII, 23, we have Bases in AN. -Kh. : laja, passim; lajime; | Bhuye. - Dh. : yasa, X, 18, and bhuye, VII. lajina ; nom. plur. lajane, XIN, 5, al.; lajano | VIII, 9. 97 These signs of punctuation are superfluous. * Metre, Mandkkrenta,
Page #110
--------------------------------------------------------------------------
________________ 102 THE INDIAN ANTIQUARY. [APRIL, 1892. Bases in IN. - At Kh., we have both the Feminines. - Dative sing. in uye; D. : consonantal form piyadasine, piyadasind, and the vihiinsaye, V, 10; VII-VIII, 9, &c. -- Instr. vocalic form piyadasisu, 1, 2, 3, &c. - At Dh., sing., Kb.: madhuliyaye, XIV, 20; pujaye, along with the nom. piyadasi (never osi), we XII, 31; vividhaya, XII, 31 (read vividhuye) : only find the consonantal declension piyadasine, Dh.: dav(a)ye, det. I, 9; isaya, det. I, 10; piyadasina. - At D., we have only the nom. tulanaya, det. I, 11 (Jaug. in dye); D.: agaya, piyadasi, written always with the short final 1, 3 (RMya); agaya, I, 4 ( M yan); anulu, vowel, while A has usually piyadasi. -- Bh. : payu, VII-VIII, 13, 16, 18; arihinsaye, VIIpiyadasi, 1. VIII, 9; ku mutayu, I, 3 (ARM 'ya); palikhayd I, 4 (ARM Oya); pujayu, VI, 8 (RMya); (c). - Declension of vocalic bases. vividhaya, VI, 8; vividhaya, VII-VIII, 3; Bases in A. - Masculinos. - Nom. sing. susisiya, I, 4 (RM oya). - Abl. sing., D.: everywhere e. Kh. has two noms. in 8 : kela- vihiti ye, II, 13. - Loc. sing. Kh.: sarililaputo and satiyaputo, II, 4. - Dat. sing. in lanaye, pujuye, VI, 19; Db.: sculilandya, CI, uye, everywhere except at R., which has only | 31 (Jang. bas saritilaniyd, which should prothe two datives etaya athaya, and once at M. bably be read : 'nayd); palisaya, VI, 30. D.: in athaya, corresponding to D., II, 15. - Loc. artalikuye, V, 20; athamipakhaye, V, 15, sing. in asi. Anne bhage (Kh., VIII, 23; Dh., 18; chayudusuye, V, 15, &c.; tisayan, V, 11 VIII, 5) and pajopadaye (Kh., IX, 24; Dh., (tisaye, V, 15, 18). - Nom. plur., Dh. : paja, IX, 6) appear to be locs, in e; at Jang, det. II, V, 17; janao, IX, 24; Bh. : gathu, 5; upasiku, 16, khanokhanasi of Dh. is represented by khane 8. san'an, which can hardly be taken as any Bases in T.-Neuters.- Nom. plur., Dh. ;. thing but a double locative, santan being hathini, IV, 3. D.: asinavagumini, III, 20; equivalent to savite (?); Kh. appears to read anusathini, VII-VIII, 20, 1. vijayariui, XII, 11.- Abl. sing. in in manatata, R., II, 5, 3.-The acc. plur. would be in a Feminines.- Nom. sing., Kh.: in i ;D h.; in bahuka dosu, Kh., 1, 2, if comparison with in i, except ahini, IV, 18; dadhi, det. I, 15, G. and J. did not lead us to consider that this 16 ; annsathi, I, 4, 14 ; VIII, 5; apariyati, III, spelling represents the singular bahukan 11 ; asasi, atipati, IV, 12; det. I, 5; lipi, I, I, posan. In Dh. det. I, 18 ; Dr. Buhler appears 4; det. I, 19; det. II, 9, 10 (Jaug. 1) ; dhiti, to take tise (which is his reading for my tisena) det. II, 6; D.: in i, except aladhi, VII-VIII, as an acc. plur. 10; libi, VII-VIII, 10, 11 ; lipi, I, 2; II, 15; IV, 2; dhati, IV, 11; palipati, VII-VIII, 7; Neuters. - Nominatives singular every vadhi, VII-VIII, 8, 9; vidhi, I, 9. - Dative where in e. Kh., however, has the following sing., Kh.: radhiya, V, 15. D., in iye : nominatives in ani: ai, IV, 12; XII, 31 ; anu anupalipatiye, VII-VIII, 7, &c. - Instr. sing., susanan, IV, 12; badhari, VII, 22 ; XII, 32; Kh.: in iya; but anusathiye, IV, 10. Dh, in XIII, 36 ; danari, III, 8; galumatatalari, XIII, iya; but anarritiya, det. I, 11 (Jaug. tiye). 36; kataviyon (lokahite), VI, 19; lekhitav, D., iyci, as anusathiya, I, 5 (RM 'ya), &c. - IV, 13; madaron, (?), XIII, 2; nityar, (?), Abl. sing., Kh.: taxibapariniyd, XIII, 6. Dh.: XIV, 19; palari, V, 14 ; yaa, VIII, 23. - Dh.: niphatiya, IX, 10.- Loc. sing., Dh.: puthabudhari, VII, 2; durala (= lan ?), det. II, riyari, V, 26; tosaliyan, det. I, 1 ; II, 1. D.: 2 ; (Jaug., I, 2, duvalarn; II, 2, duvale); chatumusiye, v, 15; pusimamusiyani, V, 11. - rutai, IX, 10 ; hedisan, IX, 10; det. I, 29. - Nom. plur., Bh. : bhikhuniye, 7. - Gen. plur., In det. I, 14, I doubt very much the nom. Kh. : natinari, IV, 9, 10; bhagininasi, V, 10. sumpalipada -- dan of Dr. Buhler. - D. : Dh., bhugininau, V, 25; natinan (7), V, 26. 1.: badhan, III, 21 ; VII-VIII, 1.- S. : badhani, devinari, VII-VIII, 6. - Loc. plur., Dh.: natisu, 1. - Acc. sing. in an everywhere. But at IV, 11, al. D.: natisu, VI, 5; chaturimusisu, V, Kh.: satabhaye, sahasabhage, XIII; 39 ; dane, 11, 16. XII, 31 ; viyasane, XII, 38 ; niche, VIII, 22. - Nom. and acc. plur. in ani. But at Kh.: Bases in U. - Masculines. - Nom. sing., dasana, IV, 9; halapita, lopapita, II, 6; sava, D.: sadhi, II, 12 (ARM dhu). - Gen. plur., XII, 31 ; at Dh. : halapita, II, 7. Kh.: gulunan, IX, 25. Dh.: gulunan, IX, 9, B
Page #111
--------------------------------------------------------------------------
________________ APRIL, 1892.] - Loc. plur., D.: gulusu, VII-VIII, 8; bahusu, IV, 3. Nom. plur., D.: bahune, VII-VIII, 1. Neuters. Nom. acc. sing., Kh.: bahu, IX, 24, al.; sadhu, III, 8, al. Dh.: sadhu, III, 11, al. Nom. plur., Kh.: bahuni, IV, 9, al. Dh.: bahini, IV, 12; bahuni, I, 3. D.: bahuni, II, 14 (R hudeg). Abl. plur., Kh.: bahuhi, IV, 10. Dh. bahihi, IV, 14.- Loc. plur., Dh.: bahisu, det. I, 4. D.: bahusu, IV, 3. Feminines. Nom. sing., Kh.: sudhu, III, 7, 8; IV, 12. Dh. III, 10, 11; IV, 18. Loc. sing., D. punavasune, V, 16. (d). Declension of Pronouns. Demonstratives, &c. anya. Kh.: amne, nom, sing. neuter, IV, 11, al.; amamanasa, gen. sing., XII, 33; amnaye, dative sing., IX, 24, al.; amne, loc. sing., VIII, 23; amne, nom. plur. masc., II, 5, al.; amnani, nom. plur. neuter, passim. Dh.: ahne, nom. masc. sing., det. I, 9; amne, nom. sing. neuter, IX, 9; amne, loc. sing., VIII, 5; anime, nom. plur. masc., V, 23; amnesu, loc, plur., V, 26.D. amne, nom. plur. masc., VII-VIII, 6, al.; amnani, neuter, V, 14, al.; amnanam, gen. plur., VII-VIII, 6. 2. - ima. Kh.: iyam, nom. masc., V, 16; iyam, nom. fem., passim; iyam, nom. neuter, IV, 12; III, 7; VI, 21; IX, 25, 26; XII, 31, 35; XIII. 36; imam, nom. neuter (?), IX, 26; imam, acc. sing., IV, 11, 12; imasa, gen. sing., IV, 13; imisa, gen. masc., IV, 12; imaye, dative; ime, nom. plur. masc., XIII, 38; fem. (paju), V, 17, -Dh. iyam, nom, masc., V, 26; det. I, 7, 8 (?); iyan, nom, fem., passim; iyan, nom. neuter, III, 6; IV, 8; VI, 32, 34; imam, acc., IV, 16; V, 17; imasa, gen. masc., IV, 18; imaye, dative masc., V, 26; fem., III, 16; imena, instr., IX, 12; ime, nom. plur. masc., V, 26; imehi, instr. plar., det. I, 10. - -D.: iyah, nom. masc. II, 11 (?); nom. fem., I, 15, al.; neuter, III, 17, 18, 21, 22; VI, 8, 9, 10; VIIVIII, 7; imam, acc., VII-VIII, 3; imani, nom. plur. neuter, VII-VIII, 9, al. S.: iyah, nom. sing, masc. (athe), 5; neuter (savam, phale), 3, 4, 6. R.: iyah, nom. sing. masc. (athe, pakame), 3, 4; imaya, loc. fem. sing., 2. - - THE INSCRIPTIONS OF PIYADASI. --- eta. - Ekatya. Kh. : ekatiya, nom. plur. masc., I, Dh.: ekacha (?), nom. plur. masc., I, 2: - Kh.: esa, nom mase sing., XIII, 38; 1 ese, VI, 19, al.; ese, nom. sing. neuter, IV, 12; IX, 25; XIII, 38; etasa, gen. ; etuye, dat., passim; etanam, gen. plur., XIII, 38, Dh. esa, nom. sing. masc. (?), IV, 15; VIII, 5, al.; neuter, IX, 8, 9: det. I, 3; det. II, 2; eta, acc. sing. neuter, IX, 7; etam, acc. sing. masc. and neuter, det. I, 15, 16, 22, 25; etasa, etasi. etaye, passim; ete, nom. plur. masc., det. I, 11, -D.: esa, nom. sing. masc., VII-VIII, 3, 7, 9; fem. I, 5, 9 (ARM 'sa); neuter, III, 19, 21; VII-VIII, 4, 11, 14, 20; esa, nom. sing. neuter, IV, 14 (RM sa); etam, acc. sing. neuter, passim; etuye, etena; ete; etani; etesu.-S.: etaye, 4; etena, 2. R.: esa (phale), 2; etaya, dative masc., 3; etina, instr. masc., 5. 103 - - GO - ka. Kh. kechi, nom. sing. masc., XII, 32; kichhi, nom. sing. neuter, passim. - Dh. : kechha, nom. sing. masc., det. I, 7 (Jang., kecha, i. e. kechi); kichhi, nom. neuter, VI, 30, al. D.: kina (na), instr. sing., VII-VIII, 17, 18. ta. Kh. sa, nom. masc. sing., XII, 33; XIII, 3; se, ibid., passim; sa, nom. fem. sing., XIII, 11, 12; ta, ibid., VIII, 4; se, nom. sing. neuter, IX, 26, employed as tad, used as a conjunction passim (to se of Dh., det. I, 14, corresponds tam. at Jaug.); ta, nom. sing. neuter, X, 28; tam, id., IX, 25; ta, id,, used as conjunction, V, 13; tam, acc.; tuye, VI, 19; tena; te, nom. plur. masc.; tanam, gen. plar., XIII, 38; tesa(m), ibid., XIII, 4, 37; tehi. Dh. se, nom. sing. masc., V, 21; det. I, 13, al.; neuter, IX, 8, 10 (conjunction); IX, 9; tam (conjunction), V, 20; ta, nom. sing. fem., VIII, 4; tam, acc. sing. neuter, det. I, 2, al.; tasa, tena, tasi; te, nom. plur. masc.; se, id., V, 24, 25; tani, neuter; tesa (read tesam)), gen. plur., det. II, 8, 10; tinam (read tanam), id, VIII, 3. -D.: se, nom. sing. masc., VII-VIII, 9, al.; neuter (conjunction) VI, 13; VII-VIII, 10, 17; ta, nom. sing neuter (conjunction), VII-VIII, 3; tamh, acc., VI, 3, al.; tenu, VIIVIII, 7; te, nom. plur. masc., VII-VIII, 1, al.; se, id., VII-VIII, 4, 6; tunamh, gen. plur., IV, 17; tesam, id., IV, 3 (RM sam); tesu, VIIVIII, 5. Bh. : sa, nom. sing. masc., 3. S.: se, nom. sing. neuter (conjunction), 4.-R.: te, nom. plur. masc., 2. ya. - Kh. e, nom. sing. masc., V. 16, al. (ye. V, 14); neuter, X, 28; XIII, 36; ye, nom. s'ng. neuter, VI, 18; XIII, 35; a, XII, 31; am, IV, 12; X, 28; yam, VI, 18, 20; XII, 35: asa,
Page #112
--------------------------------------------------------------------------
________________ 104 THE INDIAN ANTIQUARY. [APRIL, 1892. gen. sing. masc., VII, 21; yena, XIII, 38 ; ye, tini, nom. neuter, I, 3, 4; chatali (read otu), nom. plur. masc., IX, 25; ya, id., XII, 34; nom masc., XIII, 5; parchasu, loc., III, 7. yesarit, gen. plur., XIII, 38 ; yesu, loc, XIII, DHAULI. - @kana, det. I, 18; det. II, 10; 37. - Dh.: , nom. sing. masc., V, 2, al. ; ye, tinni, nom. neuter, det. I, 4, 24 ; parachasu, V, 21 ; det. I, 8; a, fem., det. II, 6; 6, neater, det. 1, 21. det. II, 5, al.,; , VI, 30, 32, al. ; ya (neut.), DEHLI. - duvehi, instr., VII-VIII. 8; tisu, IV. 17: asa: gen. masc., VII, 2; &na, instr., I loo. fein., V, 11, 16; lint, nom, neuter, IV, det. II, 9, al, i ye, nom. plur, masc., V, 20; 6, 16; V, 12. V, 23, al. ; ani, neater, II, 7. - D.: 6, nom. SAHASARAM. - duve, nom. 6. plur, masc., VI, 8; ye, II, 16, al. ; ya, fem., I, 9, al. ; ye, neuter, VII-VIII, 9; ya (neuter), 3.- CONJUGATION. VII-VIII, 7; yena, instr., IV, 12, al. ; ena, (a). - Verbal Bases. VII-VIII, 11 ; ye, nom. plur. masc., VII. VIII. 11 ; yani, neuter, VII-VIII, 7, al. - Bh. : e, I only note modifications, which, as comnom. sing. masc., 5; neuter, 2. - S.: art, sing. . sing pared with Sansksit, are not of a purely neater, 1, 2.- B. : ya, sing. neuter, 2; an, 3, phonetical and mechanical character. KHALBI. - Simple bases : kaleti V, 13, al.; sarva. - Kh. : save, nom. sing. neuter, XIV, apakaleti, upakaleti, XIII, 32; chhanati, XII, 18; savari, acc. masc. and neuter, passim ; 32; dakhati, I, 2, al, ; papunati, XIII, 38; save, nom. plur. masc., VII, 21; suvesu, loc., upaharili, XII, 33, is the only example of the V, 16. - Dh. : save, nom. sing. masc. det. 1, 4; preservation of the consonantal conjugation; neuter, XIV, 17; savari, acc.; savasa, savenu, vijina mane, XIII, 36; vijinitu, ibid. ; pajohipassim; sane, nom. plur. maso., VII, 1; savesu. - D. : savasi, loc. sing., VII-VIII, 6; savesu, taviye, I, 1; punati, X, 32, seems to me to be. loc. plur., VII-VIII, 5. - Bh. : save, nom. very doubtful. Causals : vadhiyati, XII, 32; vadhiyisati, IV, 11, forodhao; ayi, contracted to sing. neuter, 3. & in lekhapesami, XIV, 19; the formative aya ia Personal Pronouns.. retained in the participle, in inapayite, VI, 19; 1st person. Kh. : hakan, nom., VI, 18, weakening of the vowel of the base : likhupita, 20; mama, gen., passim; me, gen., passim; XIV, 19. - Passives: ulabhiyanti, alabhiyi. mamaya, instr., V, 13, 14; VI, 7, 19; me, sasti, dlabhiyisi, 1, 3, 4. instr., III. 7; mi, the same, XIV, 19.- Dh. : DHAULI, - Simple hases : anususami, det. II, Takari, nom., VI, 29, 32, al.; mama, gen., 6; chithitu (*tishthitva), III, 7; dakhati, det. I, passim: me, the same, V, 10, al.; mamaya, 2, al. and dekhati, det. I, 7, al.; kaleti, V. 20. instr., VI, 28; mamaye, the same, det. II, 4 al.; kalami, VI, 29; kalats, det. 1, 23; kalanti, (Jaug.: mamiyuye); maye, nom. plur., det. II, det. I, 26; papundtha, det. I, 6, al.: pajo. 8; majhen, the same, det. I, 10; apha, aco. [hitaviy(r)], I, 1. - Causals: veditu (=vedayitu), det. II, 7 (Jaug. : apheni); ne, II, 5; aphakan, det. II, 6. - Passives: alabhiyisariti, I, 4. gen. det. II. 5, 7 (Jaug. : nd); aphesu, loc., DELHI. - Simple bases: anugahinevu, IV, 6; det. II, 4.-D. ; hakani, III, 21; mas, Acc., anusishmi, VII-VIII, 21; upadahevu, VI, 5; IV, 8, 9; mama, gen., VII-VIII, 6, al.; me, vidahami, VI, 6; participle retaining the forI, 7, al.; mamaya, instr., VII-VIII, 3; mative: sukhayile, VII-VIII, 3.-Causals : & for mamiya, VII-VIII, 7. -- Bh.: hakani, 4; huma, uyi in jhapetaviye, V, 10 (RM payi"); weakening yen., 2 ; haniyaye, instr., 3. of the base vowel in anapitani, VIII, 1 ; nijhapa2nd person. - Dh. : tuple, nom. apr. plor., yati, IV, 7; likhapita, passim; likhapapita, VII. det. I, 4, al.; Jaug., det. II, 8 (twice) 11, reads VIII, 10; manali, for manayati, det. I, 7, is to not tuphe, but tupheni; tuphalani), gen. det. I. me very doubtful. - Passives: khadiyati, V, 7. 13; tupheli, instr., det. I, 3, 10; tuphesu. BHABRA. - Cagsals: likh apayanni, 8. loc., det. II, 2. -- Bh.: ve, instr. plur., 2. - R.: SAHABARAM - Causals: likhupayatha, 8, 7. tupaka (read tuphakar), gen. plur., 5. RUPNATH. - Simple bases : papotave, 2. (e). - Declension of Numerals. Causals: lekhapetaviye, 4. KHALSI. - duve, nom masc., I, 4; II, 5; BAIRAT. - Capsal: al(a)dhetaye, 6.
Page #113
--------------------------------------------------------------------------
________________ April, 1892.] THE INSCRIPTIONS OF PIYADASI. 105 (b). - Terminations. sy is changed to h: thatha, Dh. det. 1, 17; det. Present. The only trace of the medial II, 9 (Jang. esatha) ; udhuriti, D., IV, 18; ho. termination occurs in Dh., X, 13, if the reading hasti, VII-VIII, 4, 5, 6. It only remains to mention the forms hosami, det. II. 8: marinate is really certain; even in the passive hosati, det. I, 22, at D.; hisanti (by the side we have alabhiyanti, &c., Kh., I, 3. - I note at of hihamli), at D., VII-VIII, 2; hosati at S. and R, the form stmi of the 1st person of as. Bh., 4. - It is a question if at Dh., det. I, 23, 26, the forins laluti, kalaviti (cf. kalami, VI, 29) do not Absoluutive. - Kh.in tu: dasayitu, IV, 10, &c. : represent the subjunctive. in ya in sashkhaye, XIV, 21; - Dh. in tu: unu. Imperative. - No medial terminations. The susitu, det. II, 6, 8; chithitu, IV, 17; kag, det. second person plural ends in ta in lekhata, II, 7, &c.; - D. in tu: nisijitu, IV, 10; sulu, VII-VIII, 21; in ya in apahatu=apahritya (?), Dh., det. I, 7 (Jang. dekhatha), 14 ; iu tha in VI, 3; -- Bh.: in ya in udhiyichya = allikri. chaghatha, Dh, det. I, 19; det. II, 11; in paliyovuiatha, D., VII-VIII, 1; likhupayatha, tya, E. S., 7, 8. Infinitive. - Dh.: kladhayitave, IX, 12; stut paripadayitave, det. 1, 19; det. II, 11, - D.: Potential. - 1st pers. sing. in ehan, at Kh., uladhayitare, IV, 10; pilihalave, IV, 11; pati. Dh., D., eyari, at Bh. (disey usi, 3). - 3rd pers. chalitave, IV, 8; samadapayitare, I, 8. sing., Kh.: palipajeyu, XIV, 20; siya, passim, perhaps siyati (), X, 28. Dh.: pufipajeya, Participles. - Participle present. - Kh. XIV, 19; ugachh(EUR), det. I, 13 (Jaug. uthi(he), The medial form in allamanasi, VI, 17 and uthuye according to Dr. Buhler); huveya, X, 15; vijinamane, XIII, 36; kalaute, XII. 33. - Dh. siya, passim. D.: anupalipajeyu, VII-VIII, 17, The medial form in sipati pajamine, det. I, vadheya, VII-VIII, 3, 16, 18; papovu, VII, 16; vipatipadayaminehi, det. I, 15 (at J.: vipa3; siya, VII-VIII, 11 ; siya, IV, 15. R. : siya, tipatayaritan), al., in which Onio in the place 3. - 1st pers. plur, in ema. Kh., Dh. - 3rd of ondo is curious; but cf. payamino, D., V, 8. pers. plur., Kh.: haveyu, XII, 34; sususeyu, - D. has the medial form in anurekhumaine, XII, 33; vasevu, VII, 21. Jaugada, except in VII-VIII, 2, in the passive of the causal priya. niklamacu, III, 11, and perhaps va(8)&(v)u VII, mini, V, 8.- Bh. Participle present passive 1, which is mutilated, forms on the contrary of the causal : ubliculemanon. - S. The everywhere the 3rd pers. plur. in eyu : yureyi- medial form in pulakamimena, 3.-R: paka(ti), det. I, 3; det. II, 4, 14; hey (ti), det. I, mamanena. These two last forms appear to be 6; det. II, 6; papuneyu, det. II, 5, 9; asvaseyu, incorrect. det. II, 6; laheyu, det. II, 6. Dh.: in evu : | Participle past passive. - I note the forms aladha yevusti), det. II, 6; vusevu, VII, 1, una payita, Kh. VI, 19; Dh., III, 9; wijhapayito, &c. ; III, 10, nikhamavu. D.: in ecu : unuga- D., IV, 18; sukhayite, VII-VIII, 3. Auusathe, hinevu. IV, 6, &c., Bh. : upadhalay@yu, 7; | Dh.. VI. 31. J.. VI. 4. seems. As remarked suneyu, 7. Dr. Buhler, to be a wrong formation for unde Past. The perfect remains unchanged in sithe. cha (Kh. always aha, except III, 6; Dh, always Participle future passive. - Kh. in tavrya ; ahu ; D. 3 times ahu; Bh. aha). The imper- in iya in supalalaye (?), V, 14. - Dh. in laciya fect bas survived in the 3rd pers. plur. luvani, in ichhitariye, det. I, 9, 11; pajj(kitaviyd), L. Dh., VIII, 3. - Aorist, 3rd pers. sing., nikha- | 1; in iya in dakhiye, det. I, 13; vadhiye, V, 23; mitha, Kh., VIII, 22; nikhami; Dh., VIII, 4; supadalaye (?), V, 22.-Din taviya : ich hi A, D., VII-VIII, 15, 20; vadhithu, VII- taviye, IV, 14; hartaviyani, V, 15; in iya in VIII, 14, 17. 3rd pers. plur. in isu (Kh., Dh., delchiye, III, 19; dusapalipadaye, I, 3. -- R. D.), except husu, Kh. VIII, 22; husu, D., in taviya : vivaselaviye, 5.-B. in taya, if we are VII-VIII, 12. to judge from aladhetaye, 6; but the reading Future. - No 1st pers. in ani. Forms, such may well be incorrect. as kachhami, have been previously quoted. It The short inscriptions of Barabar, of Kanis the same with fatures in which the formative simbi, and of Allababad (Queen's Edict)
Page #114
--------------------------------------------------------------------------
________________ 106 THE INDIAN ANTIQUARY. [APRIL, 1892. are connected, so far as we can judge, with the orthographic series of the edicts which we have just considered : 1-4 and 1-1, respectively, do not appear to be distinguished in them; the r changes into l; the initial y disappears ; neither n nor have any particular signs; the nominative singular of masculine bases in a, ends in e, &c. As for special points, all I see to quote are the forms adirikehi (for (jivikshi) Bar., I, 2; II, 4; kubha (= guhd), ibid., I, 2 ; II, 3; III, 3; wigsha, Bar., I, 2, as at Dehli. WEBER'S SACRED LITERATURE OF THE JAINS. TRANSLATED BY DR. HERBERT WEIR SMYTH. (Continued from page 23). 426] The third group of the texts of the Siddhanta is formed by the ton painnas' prakirnas. It is as yet undetermined how old is the position of the painnas, prakirnas as the third part of the Siddhanta and what caused their location there. In Avi. there follow upon the u vaingas first the chheaggamthas and then the paznnas. In Svi and V. the paznnas come directly after the uvangas, but the choda texts (with the exception of mshanisfha which is reached after the paznnas are done with) have been placed before (between angas 4 and 5), as if their position at that point belonged to them. Is the mere fact that the painnas are more numerous the reason that in the present arrangement of the parts of the Siddhanta (see p. 226) they have been placed before the chheasuttas? They are certainly very much inferior to the chbeasuttas both as regards inner worth and external extent. The joint name paznna, by which they are united, does not occur in any other place in the Siddhanta, except in their own text, so far as I have been able to observe. The word painna is found, it is true, in the Nandi as samjna, but in another, far more universal signification, viz., as a means of denoting all those texts not contained in the aigas. In the passage of the Nandi 84,000 or even 8,400,000 painnagas are spoken of ! The texts now extant called painnas in the pregnant sense of the word, bear a name, which, denoting "scattered," "hastily sketched" pieces, well suits their real nature as a group of texts corresponding to the Vedie parisishtas. Like the parisishtas they are, with a few exceptions, composed iu metre; [427] and in fact in arya, the metre which is usual in the karika insertions in the augas, etc. They are different from the texts, which we have considered up to this point, in that the nom. sing. masc. first decl. regularly ends in o and not in e (for exceptions see on 5 and 7). This is a proof of their later origin. In the canal enumeration of the anangapavittha texts in Nandi, Pakshikas, and in the three Samayari we meet with bat six of the ten separate titles of the present painna group. In the works just mentioned, the titles of 1, 3, 4, 10 are lacking, texts which bear a decidedly secondary stamp. (The scholiast on the Nandi appears also in the case of No. 2 to have had before him quite a different text from the one we possess.) These ten texts did not originally enjoy the distinction of being the representatives of the painna group; and that they arrived but gradually at this honor is attested by manifold testimony going to prove that considerable dissent at present exists in regard to the representative position claimed by them. In Avi. the enumeration on this point is in three very imperfect gatha: sampai painnaga, mandi , anudgadara , Aurapachchakkhana (2) > mahapachchakkhana (9), devindattha (7) 6, tamdilav@yaliyam (5) samthara (4) , Il 11 bhattaparinna (3) e, ra hanapadagam ganavijja (8) 10, amgavijja 11, ya chausarana (1) 19, divasagarapannatti 13. joisakaramdam 14 11 2 11 maranasamahi 16, titthogeli 16 taha siddhapahudapaznnar 171 narayavibhatti is, chandavijjhaya (! 6) 19, panchakappa 20 11 3 11. # Their collective extent is only about 1,900 granthas.
Page #115
--------------------------------------------------------------------------
________________ APRIL, 1892.] SACRED LITERATURE OF THE JAINS. 107 Here then are twenty names, with but one exception (10 viratthaa) all belonging to the present group. There are five names which recur elsewhere in the Siddhanta - (1, 2, 13, 17, 20). - ; [428]two names which at least were mentioned in connection with the Siddh. - 14, 15, -; and finally there are four names found nowhere else except here - 9, 11, 10, 18. It is of especial interest to observe the ascribing of Nandi and Anaoga to the paznna gronp as being placed before them. This reference recurs in similar fashion in Svi., where the enumeration is but fragmentary and limited to the mention of: namdi 1, anuogadara , devindatthau (7) 3. tamdulareyaliyam (5) 4, chamdavivviyai (! 6) on aurapachchakkhana (2) , ganivijjai (8) ; painpaginam. It then speaks of sesani but does not enumerate them. In V. the painna texts are treated of on two occasions. In the first case we find, for some reason inexplicable to me, in the discussion in reference to the 15th book of auga 5, an enumeration of ten texts, which are not stated to be paznnas, though the titles of six are found among the titles of the 10 painnas. At the head (the action in question is called nandi-m-ainam vamdanaya) we again find namdi and anuoga; then follow devimda (7) 3, tamdula (5) 4, chandarejjha (! 6) 6, ganivijja (8) , marana in jhanavibhatti s, qura (2) 9, mahapachchakkhana (9) 10. Of these No. 7 is doubtless identica13 with maranasamahi in Avi. and No. 8 corresponds to a section in 2. See below. The second passage in V. is that in which the paznnas are directly discussed; (429) and in this passage they appear in the forefront together with nandi and anuoga.39 Fifteen names are there mentioned, among which are all the ten members of the present list, though arranged differently, but at the end they are called only ichch-ii: sampayam painnaga : namdi 1, anudgadaraim . ., devimda-. tthaya (7) 3, tamdulaveyaliya (5) 4, maranasamahi 5, mahapachchakkhana (9) , aurapachchakkhana (2) 7, samthara ya (4) , chamda vijjhaya (6) o, bhattaparinna (3) 10, chausarana (1) 11 viratthaya (10) 12. ganivijja (8) 13. divasagarapannattisargahani 14. gachhay Ara 18 ichch-ai paznnagani. Of the three additional texts mentioned here No.5 is mentioned in Avi. and elsewhere - see p. 428-as belonging to the paznnas; the case is similar with No. 15. No. 14 belongs to the text referred to as No. 13 in Avi., a text which possesses a considerable antiquity - pp. 268, 389. Is the samgahani on it mentioned here identical with the Jambudvipasangrahani of Haribhadra mentioned p. 413 (on apanga 6)? In connection with the above discussion V. treats of the isibhasiyaim (see pp. 259, 281, 402), and allots to them 5040 ajjhayanas. We have already observed that Haribhadra on Av. 2, a identifies the isibh., quoted there, with the "devendrastava etc.," but on another occasion identifies the isibh with the uttarajjhayana. We read therefore in V. that the isibl. were regarded by some as belonging to the uttarajjh. (430] uttarajjhayanesu eyeim amtabbhavanti, to which the mahnisihajogavihi is joined in V. In the Vicharampitasamgraha (see p. 355) as in the three samayari there is an enumeration of the painnagas, which begins with Nandi and Anuoga. Nineteen and not 10 painnas are here enumerated, but of these only the first three are given a name. The passage, which is interesting for other reasons, reads in the very corrupt MSS.: amga 11, upanga 12, chhedasangha 5 (?) mulagramtha 4 pramukhih, pratiniyati eva gramthah kalpabhishyadyuktasatralakshanopetal, yatab kvi 'pi yogavid hau drisyamaneshu nardy-annyogadvari-"turapratyakhyanady-ekonavinsatiprakirnakeshu kesham chid eva jitakalpa-pamchakalpadinim virachayitero jniyante numagraham, na sarveshan, yeshim kartiro na jnayamte tini ganadharak sitani. Here then, aturapratyakhyanam (2), and not devemdrastava (7), comes after nandi and Anuyo, at the head of the remaining painnas. Here as in Avi., the pamchakalpa and, in connection with it, the jitakalpa seem to be counted among the paznnas, whereas - see below - they are generally held to belong to the chhedasutra.1 38 The maranasamahi is also mentioned elsewbere. See pp. 429, 431. We might well recall the maranavibhatti in connection with the marana, or the maranavisohi in the enumeration of the ananga pavittha-, or angab&hira texts in Nandt etc. All these texts refer without doubt to euthanasy; cf. painna 2. 19 The connection with both is, however, very slight, for in v. 61 of the jogavih na we find the express statement : devindatthaya-m-Ai paznnaga, the connection of nandi aud anuoga being ignored. *in anga 4, 44 only 44 ajjh, are allotted to them in conjunction with the develogachuyabh Asiya. 41 Either the paroh. or the jttak, appears as No. 6. The Vicharam., however, recognizes only five chhedasanghas. See above.
Page #116
--------------------------------------------------------------------------
________________ 108 THE INDIAN ANTIQUARY. [APRIL, 1892. I have been able to discover no further information that would prove the connection of nandi and anuoga with the painna group. The lists and MSS. of the painna group, which I possess, pay no attention to these two texts, [431] and limit the paznnas to a smaller number, generally to ten. The enumeration in the Ratnasagara (Calc. 1880) is as follows:-chausaran (1) 1, samthara (4) , tamdula (5) 3, chamdavijjiya (! 6) + ganavijjiya (! 8) 5, devavijjiya virathuva (10), gachhayara s, j(y)otishkaramda y, malapachchakkhana (9) 10. Three names found in Buhler's list (2, 3, 7) do not occur here. To compensate for this omission there are 3 texts mentioned, of which one, No. 6, is quite anknown; the second, No. 8, is found in the V., and the third, No. 9, is referred to even in Avi. among the painnas. In the enumeration of Rajendra Lala Mitra and of Kashinath, see pp. 226, 227, we find the list of Buhler (arranged 1, 2, 3, 9, 5, 6, 8, 7, 4). No. 10 isomitted and replaced by marana. Samabi, the acquaintance with which name we had already made in Avi. and V., and which here occupies the eighth position (between 8 and 7). I possess a MS. of the dasapainnas which contains a recension varying from that given in Buhler's list. The first page having disappeared, a page which does not belong there has been inserted in its place. It is, therefore, doubtful whether the first part is chausaranam (1) or not.12 The arrangement of the following parts is (2, 3, 4, 8, 6, 9,43 5. Instead of 7 we have the gachhayara, [432] which we find in V. (see p. 429) and Ratnasagara (p. 431); but there is nothing to compensate for the omission of 10. The foregoing considerations prove conclusively that it is a matter involved in uncertainty what texts really belong to the painna group, a fact that must be held to render this secondary character a matter of great probability. All that can be drawn from the contents of the present 10 painnas makes for the same conclusion. A considerable portion of the 10 painnas refers to the proper sort of euthanasy, the confes. sion necessary for this end and the abjuration of everything evil. Several portions, however, treat of different subjects, viz. : - 5 physiology, 7 mythology, 8 astrology, 10 hymns. That portion which is of mythological content recalls the Atharvaparibishta, though the Atharvaparisishta must precede the paznnas in order of time, since the latter contains the Greek terms hori and dikkana. It is difficult to give a review of the contents of most of these small tests, since we possess no commentary. The character of some portions (1, 5, 6-8) is very dissimilar from that of others; 6-8 are of a similar type, which marks them out as a separate inter-dependent group. A peculiar characteristic of this group is that the author speaks of himself in the first person, and addresses his listeners in the plural cr singular. In No. 7 a woman is the object of his instruction; and this painna has a special claim to antiquity since it is said to be identical with the isibhasiyaim mentioned in angas 3 10 4,44! See p. 429. It is, however, possible that another text (433] of the same name is there referred to. In the summary which I now give I follow the extant usual list of the 10 painnas which is found in Bubler. XXV. The first painnam, chausaranam, chatuhbaranam; in 63 vy. The first seven verses refer to the shadivasyakam, the six daily duties necessary for the purification of life. See above pp. 161 , 244. 42 Though the extent of the chausarana with its 63 gathis, appears to be very large for one leaf, it is, nevertheless possible that the missing leaf may have contained this part, since this MS. has upon each page 19 lines of 74 aksharan so that the 2,800 akshards of the front and reverse side would be entirely sufficient for these 63 gatbils. 19 No. 9 has here not 86 but 31 verses. " The first verae reads: skvajjajogaviraf ukkittani gunavao ya padivatti khaliyassa nimadana vanatigichchhs gunadhArun cheval It recurs in similar form in the Anuyogadivaras, ete.
Page #117
--------------------------------------------------------------------------
________________ APRIL, 1892.) . SACRED LITERATURE OF THE JAINS. 109 1. The sa maiam, samayikam, explained in the text itself by suvajjajogavirai, desistance from all evil.45 Cf. the use of this word to denote the first anga also in up. 1, 67 (ib. 123, 126 suvajjajogavahiya). 2. chauvisaithaa, chaturvinsatistava, explained ibid. by: ukkittana, praise of the virtues of the 24 Jinas. 3. vardanaa, explained by gunavao padivatti, honor of the guru. 4. padikkamanan, pratikramanam confession (to the gura), explained by khaliyassa nimdana, censure of past misdeeds, conjoined with the intention of not committing the offence again. 66 5. kaussagga, kayotsarga, expiation, explained by: vanatigichha, healing of wounds, further purification of those who have been absolved by confession. [434] 6. pachchakkhanam, pratyakhyanam, explained by: gumadharana, the observance of all virtues, or really the casting off of all evil. The following must be noticed as regards the six avasyakas, which we will discuss later on when treating of Nandi, Anuyogadv., Avasy. It was to be expected that the explanations given for 1 and 6 should have changed their respective positions, i.e. samaiya should have been explained by gunadhiran and pachchakkhana by savajjnjogavirai. Had this been the case a better logical arrangement would have been effected, viz. :- 1. good action, 2. confession of the commission of misdeeds, 5. compensation for the misdeeds committed, 6. desistance from all further sins. Do not these very names seem to indicate that this was the original arrangement ? The two Avaeyakas, cited in the second and third place, interrupt the connection between 1 and 4-6, and are consequently probably to be regarded as secondary additions. In v. 847 the fourteen dreams are enumerated which the mother of a tirthakrit dreams before his birth, an enumeration which is tantamount to a list of his fourteen excellencies or virtues. With verse 9 the text per se begins (the preceding portion is doubtless a secondary addition) by the author announcing his purpose : ... vamdium Mahaviram kusalanubamdhibamdhurar ajjhayanam kittaissami loll Here we have the older name of the text, since the chausaranam, as will soon be shown, forms but a part of its contents. [435] In a MS. which contains all the 10 painnas and which is preceded by an introduction in reference to the sacred namber four, the name of this painna is stated to be kusalagubamdhajjhayanam and not chausaranam. In v. 10 is described the three-fold contents of the following portions, and an explanation given for this division that refers to the name adduced in v. 9: esa gano anavarayam kayavvo kusalaheu tti Il 10 || At the head stands 1. the chausaranagamanam (from which the customary title of this painna has been borrowed), i. e. the prayers by means of which four-fold protection can be obtained : the arihamta (arhant, v. 13-23), the siddha (v. 23-29), the shhu (sadhu, v. 30-40) and the dhamma (v. 41-48). Then follows 2. dukkadagariha, a penitential system (v. 49-54) of confession to the guru, and 3. sukalinumoana, the joy arising from a good deed (v. 55--57). Then come promises of reward and a verse (62) which has compassion on him, through whom chaurango Jinadhammo na kad, churamgam saranam avi na kayam. The concluding verse contains the summons iya . . vira ! bhaddamtam eam ajjhayanam jhaesu (dhyaya). 15 gahi 'vadyena pApena vartarta iti savadyAh, yoga manovAkkAyavy Apards, tehdin viratir nivrittih. *6 na punah karishyAmi 'ty abhyupagamanam; hence the name, the meeting, pratipam kramanan. The prati. kramanam is (see Jacobi, Kalpas. p. 117) divided into five parts; 1. daivasikam (we must accept this and not devabikam as the reading in Jacobi's text) i. e. to be done daily : 2. rdtrikam nightly; 3. pAkshikam semi-monthly : 4. every four months; 5. annually. 67 Avaky. 2, 376, see Jacobi on Kalpasutra Jin. $ 4.
Page #118
--------------------------------------------------------------------------
________________ 110 THE INDIAN ANTIQUARY. (APRIL, 1892. The commentary considers that this implies also a reference to the name of the author Virabhadra, presumably a sadhu, one of the 14,000 who joined Vira.18 5436) There is a commentary by Somasu idara from the Tapagachha; according to the Gurvavals of this gachha (see Kl. 256 ) born sav. 1430, died 1499, A.D. 1374-1413. In contradistinction to the triad of the Buddhists buddha, dharma and samgha, we find here a quadripartite arrangement. The samgha is divided into two parts, the earlier and the present saints, the siddha and the sadhu. The Buddhistic sargha, as is expressly stated in that of the Avesta, has reference merely to the pious of the present, who, it may be remarked, are divided in the Avesta according to sex : yenhe hatam.. yaonham cha tas cha taos cha yazamaide. The "Holy Ghost" of the Christian trinity, the origin of which we ascribed (Ind. Streifen 3, 634) to gnostic connection either with the trinity of the Parsees or with that of the Buddhists, cinbraces all time. XXVI. The second paznnam, aurapach chakkhanam, aturapraty', c. 70 vv. with an insertion in prose after v. 10 treats of the renunciatio of the moribundus, the pandiyamaranam, the genuine euthanasy, cf. Bhagav. 2, 1, 49, 78 (my treatise, 2, 266-7, 200). The introduction consists of enumerations of the five anuvvayas (panivahaveramana etc.), and of the gunav vayas and sikkbis.49 In v. 8 there is a citation from the third painna :jo bhattaparinnae (bhaktaprakirnake) uvakkamd vittharena niddittho 150 so che 'va balapandiya marane ned jahajuggam 1 811 In v. 10 the proclamation of the [437] real intention of the author: itto pamdiya ! pandiyamaranam 61 vuchchham samasinam 11 10 11 The prose paragraph which follows contains a general formula for confession and renunciation, beginning with the words : ichhami bhamte attamattham (I uttamirtham papanan prakaram, gloss) pratikramami, and closes with 63 jhana, dhyana, formulas, beginning : anninam jhane.52 Joined to these are corresponding formulas composed in gaths. The methods of counting the verses vary greatly in the different MSS., since in some the prose part is counted in as 13 verses, so that the total sum is 84 verses; and differences of another nature are also apparent. The scholiast on the Nandi, it may be remarked in passing, 53 in his enumeration of the anangapavittha texts, held another text than the present one to be the aura pachchakkhanam! [438] XXVII. Third painnam, the bhattaparinna, bhaktaparijna, in 172 vv., treats of the balapamdiyamaranam. Cf. the citation just made from v. 8 of the second paznna. This painna contains ethical precepts which refer constantly to the Jinasasanam, Jinavayanam, the Jinapaniya(pranita) doctrines, while at the same time it cites its own title ; cf. (v. 9-11, 14, 18, 35, 169, 171). In the verse before the last, this painna is said like painna 1 to refer back to the 48 yd 'rau Virabhadra Adhuh Sri Virasaktah chaturdasasahasramadhyavarti tanya 'dam etad adhyayanam, evam atrakartuh samasagarbham abhidh nam uktar; asya che 'dhyayana ya Virabhadras Adhukritatvajnapanena yasya jinasya yavantah sadhavah pratyekabudha (soe pp. 265, 334) api tavamta eva prakirpkny api tivariti bhavanti 'ti jnapitam bhavati (see below on the Nandi). 19 In the VichorAmpitasaingal - see p. 430 - the Aurap. is placed after nandi and anuyoga, at the head of the painnas. Seo Windisch in Jour. Germ. Or. Soc. 28, 229 (1874). 61 itah pamditanam viseshato 'pi pa par prochyate sankshepatah. 6a jhane is always construed here with the accus., i.e. probably as 1 p. sing. Atm. of a denominative (dhyenay) P - A collection of examples of these dhy has is to be found in the introduction of Harshakubala'a commentary on the fourth painna: dhyanabhedas tu likhyante : annanajh&ne, atra masatunadrishtArhtah. Harshakubala recognizes the number of these formulas as 6. The words before jhand appear in thematio form, as purvapadini, and not as acous. Cf. the jhanavibhatti above, p. 428. 69 The scholiast has here: charitraaya vidhih: gilanakiranAtiyan giyattha pachchakkhkviihti dine 2 davvahisar karetta ante a savvada papayar bhattatheragain janatta pittinhassa bhavacharimapachohakkhanar kAraverinti tti ityAdi yatra vargyate ; mahatpratyakhylnayii yatro 'ktam. Even if the name Aturapratyakhyanam is not directly mentioned, the meaning and the position of these words between the explanations of the titles: charanavihi and mahapachchalkhanat makes most decidedly for the conclusion that this very corrupt statement of contents, the metre of which cannot be restored, belongs to the title Aura' which in the text is between these two titles. On giyattha see below (pp. 450, 464, 478), on tho chhedasutta. ** Directions as to how a man should abstain from food, Kash.
Page #119
--------------------------------------------------------------------------
________________ APRIL, 1892.] SACRED LITERATURE OF THE JAINS. 111 doctrines of) Virabhadda, though it is perhaps better to assume that Mahavira himself is referred to in this verse :--ia jo isara-jina-vi-rabhaddabhaniyanusarinim (!)inam-bhattaparinnar dhanno padhamti nisunamti bhivamti Il 171 II Battarisayam Jinana va gahana samayakbittapannattami arahamto vihina sasa yasakkham lahai mukkham 11 172 11 According to this concluding verse the text should contain only 170 verses, but perhaps the two concluding verses are a secondary addition. The plural of the verbs in v. 171 in opposition to those in the singular jo ... dhanno is at least very peculiar. Instead of the Sanskrit sarinim (sarinam B! both times with m) osarinim is doubtless the better reading. XXVIII. Fourth painnam, samthara, samstara, in 122 vv., treats of the bed upon straw. Cf. Bhagav. 2, 1, 70, 54 (my treatise 2, 203, 207) as a preparation for the pamdiyamaranam, the proper euthanasy. The title samthara is frequently referred to throughout the text; cf. v. 1, 3, 4, 15, 21, 27, 30 etc.), thus e. g.: samtharammi nibandham ganaparivadim nisameha Itill. This was the case with paznna 3. 439] In v. 32 - 44 the qualities of the man are described who intends to ascend the samthara, the second hemistich recurring throughout as a refrain; .. kruhai jo camtharam savisuddho tassa samtharo. In v. 56 fg. there are cited all manner of instances of those who died samtharam krudha. Thus, the flower-gatherer (? pupphachula) Ajja in Poyanapura v. 56, Sukosalarisi v. 63, examples from Ujjeai v. 65, Rohidagam nagaram v. 68, Padaliputta vy. 70. 73, Kosambi v. 78, Kunalanagara v. 80, the names Kurudatta v. 84, Gayasa kumala v. 85, Chilaiputta v. 86, Mankhali v. 87. It concludes: eva(m) mae abhithuya samtharagaimdakhamdham ardha I Bugamananarimdachamda sabasamkamanan saya dimtu ll 132 11. XXIX. Fifth painnam, tamdulaveyAliyam, 56 in verse, prose, and again in verse. The contents are of an anthropological and physiological nature, and are briefly stated in the introduction: vochchham paznnagam inam tamqulaveAliyam nama 11111 sunaba gaaiese dasa dasa (disa A) vasasayaussa jaha vibbajjamti ( samkalie vogasie jam cha "yum se sayam hoi | all jattiyamitte divase jattiga rai muhuttam assaso 1 gabbhammi vasai jivo abaravihin ya vochchhami 11 3 11 Then follows the statement that the jiva [440] remained in the womb 277 full ahorattas and one-half of an aboratta (cf. Aup. $ 104)-(26 verses + 3). The prose treats especially of the life and development of the embryo in the womb, striking parallels to wbich are found in the statements in Nirakti 14, 6, 7, and in the Garbhopanishad (Ind. Stud. 2, 65). The subject is treated in the form of a dialogue, in antique form, between Mahavira and Goyama. The nominative often ends in e and not in o, so that we may suppose an older source is the base of this recital. Then follows an enumeration of the dasa dasao (disao A), ten "ages of man" (cf. Ath. 3, 4, 1): bala, kitta (A, kida B, vidda C), mamda, bala, panna, hayani, pavamcha, pabbhara, mummahi (A, mao B, sao C), mayani. These are then treated separately in metre. The text then returns to prose, and treats, in connection with the ayos, of the divisions of time: avaliya, khaga up to the kodakodiu, i. e. millions of years, after which it discusses the multiplicity of bodily relations and of the nature of the body in general. Next come the dry measures based upon the magabad pattho, cf. Ath. par. 35, 3 (my treatise on the Jyot. p. 80; Aupap. $ 80, 98), measures of length, of time, the number of the bones, sinews and other parts of the body, of all manner of diseases, of women, &c. Here and there we find verses inserted though they are not counted in continuously with the rest. At the conclusion we find 18 verses : eyam soum sarirassa (metre !) vasanam ganiyapagadamahattham 1 mokkbapaumassa ihat 65 It is uncertain how we are to translate or explain this. In angas 2, 1, 2 veyaliya is == vaidarika, in dasavellia vaikAlika. In ms, or fol. 1075 the title is translated by tandulavaitAlikam; and also in Kashinath (the state of & child in the womb, its birth, do.). 1. jyotius stre, gloss.
Page #120
--------------------------------------------------------------------------
________________ 112 THE INDIAN ANTIQUARY. (APRIL, 1892. (metre !) samattam sahassapattassa (metre!) 11 17 Il eyam sagadasariram jai-jara[441]maranaveganabahulam 1 taha pattaha57 kaam je jaha machchaha savvadukkhanam Il 18 11 xxx, Sixth painnan, chamdavijjhayam, 50 in 174 vv. In the introduction, a daragiha (v. 3), with a conspectus of the contents. Vy. 4- 19 treat of vinaya in general, vv. 20 - 35 of the qualities of a teacher, ayariyagona, vy. 36 - 51 of the scholar, sisagana, vv. 52 - 65 of the impediments (?), niggahaguna, 60 in the way of the vinaya, vv. 66 - 98 of perception, nanaguna, vv. 99 - 114 of the conduct of life, charanagana, v. 115 fg. of death, maranaguna. All these sections are clearly separated by a verse which marks the end of one and the beginning of another (20, 35, 52, 66, 98, 115). Thus, e. g. v. 20: vinayassa gunavisusa ee mie vannia samasenam ayariyanam cha gune egamana me nisameha Il 20 11 In v. 173 the contents is repeated or recapitulated as in the daragaha ; and the concluding verse is closely connected with that of painda 6: tahapattaha kaum je jaha muchchaha gabbhava savasahinam maranapanabbhavajammanaduggaivinivayagamanaoam Il 174 11 XXXI. Seventh paznnam, devin datthaa, devendrastava; in 300 vv. A systematic enumeration of the 32 devindas, and of all the gods according to their (442) groups, dwelling places, &c.61 The Nom, Sing, M. of Decl. I ends frequently in e, perhaps because the contents partially follows the statements in the augas and upangas. The divisions are here, as in the case of painna 6, distinctly separated ; and the author here, too, speaks of himself in the first person, and addresses not unfrequently (cf. p. 458) a sumdari, saanu, as the one for whom his work is intended.62 A patent contradiction to this secular method of treatment is found in Haribhadra on Avasy. 2, 6, where the author proclaims himself to be the composer of a nijjutti: isibhasianam, and explains this word by devendrastavadinam. We have seen above (pp. 259, 281, 429) that on 8, he referred it to the uttarajjhana. That our text should be so honoured as to be brought into connection with a work of such an important title as the isibhasiya (cf. angas 3, 10.4, 44) and to have been thought worthy of a nijjatti at the hands of the author of the Avasyaniryukti (whoever this may have been), seems utterly impossible if we take into consideration the secondary character of this small mythological manual (see above, pp. 280, 432). It is, however, worth our attention to note the fact that also in Svi. V. (see above, p. 428 fg.) the paznnas are frequently said to begin with a text of this name, [443] The table of contents in v. 7 ff. reads : kayare te vattisam devindap ko va kattha parivasai ? kevaiya kassa thit? ko bhavanapariggaho kassa ? Ils 11 kevasya nu vim ana ? bhavana pagara cha humti kevazya? padhavina cha vahuttam uyyattavimana vinno (?) va il 11 karanti cha kiloga (!) Akkoga majjhiman johannan cha nghi so niggigo uddhi (?) visao va ki kesim : Il : 11 and closes : devimdanikaya nam thad (iha) samatto apariseso Il 300 11 XXXII. Eighth painnam, ganiviyyA, ganividya, in 86 vv. The contents is of an astrological character.63 It begins : vuchchbam balabalavihim navabalavibisuttasamchin pasattham jinava 57 Cf. pattihi in Hala. 68 See Hem. 2, 217, Hala 524 in Bhuv. (p. 189). 09 The name is obscure : viyyaya in A, but vijjhaya in B, Nandt, PAkshika and in the three samachari; once in Avi. 'vijjhfya, in Svi. Ovivviyai (a poor MS.) and vejjha in V; Kashinath has : chandavijaya, an account of witchcraft, magic and mysticism ().-The right Sanskfit equivalent of the title is Candraka-vedhya which, a Ogha-niryukti 1142 shows, is the same as radhuvedhya 'aim-striking.'-L. 69 niggayaguna vv. 3, niggahagone in vv. 52 and 173. 61 Panegyrics on the Tirthakara's by Deva and Indra (!), Kashinath. c? The introduction states the situation in explicit terms: koi (kof ?) padhamapausammi savau samayanichchiyaviphahanu (? metre!) | vapnei vayam uyaram jiyamane Vaddhaminammill 3 tassa thunaintassa (Vstu, Cl. 9) jinam samaiyakala piyasu hauisanna painjalinda abhimuhi sunai vayam Vaddhaminassa 13 I Likewise iu v. 7: sa piyan bhanai, and in v. 11: padipuchhio piyke bhanai : suanu! tam nisameha. Further on frequently: vannihimi or vanpehim (! varnayishyami), vuchham, vachhami, &c. 6 The avachuri on the Nandi explains as follows: ganividya jyotishkapimittadiparijnanarupa, si hi samyak parijnAyamana pravrajanas&mayikaropan pesthapanairutoddeeanujnaganarupan&dibinujniviharadiprayojaneshu upa: yogini.
Page #121
--------------------------------------------------------------------------
________________ APRIL, 1992.J 113 yanabhasiyam inam pavayanasatthammi jahadittham II 1 II, and treats according to the daragaha (v. 2): 1. of the days, divasa, vv. 3-8,-. of the lunar days, tihi, vv. 9, 10, - -s. of the nakshatra, vv. 11-41, 4. of the karana, vv. 42-46 s. of the planets, gahadivasa, vv. 47, 48,-e. of the hours, muhutta, vv. 49-58, - 7. of the omens, saunabalam, vv. 59-63, s. of the horoscope, laggabalam, vv. 64-72, and o. of the signs, nimitta, vv. 73-85. The context corresponds in character with the statements of the Atharvaparisishta. The names of the nakshatras represent a secondary stage as upangas 5-7. The karanas are, however, recognized here as in up. 6, though the fourth [444] is called, as in up. 6, not taitila, but thildana. In the discussion in reference to the lagna the word hora is found (v. 66) and, as it appears (the passage is corrupt), also the word dikkana (vv. 67, 69), so that we have a patent instance of Greek influence. PARSI AND GUJARATI HINDU NUPTIAL SONGS. The second collection of the dasapainna (see above, p. 431) allots only 31 vv. to the ganiviyya. Of the verses here only the following recur there: 1-14, 21-32, 35, 37, 74, 82; SSSS 48 are entirely wanting, SS 3 has instead of 31 vv. only 14, and SS 9 instead of 13 only 2. XXXIII. Ninth painnar, mahapachchakkhanam, in 143 vv. A general formula designed for confession and renunciation. It begins: esa karemi panamam titthayaranam anuttaragainam | ..1..I saddahe jinapannattam pachchakkhaemi (a) pavagam 11 a 11 jam kim chi duchchariyam tam aham nimdami savvabhaenam samaiyam cha tivihim karemi savvam niragaram II all The verses frequently close as groups with the same refrain; e. g. pamdiyamaranam marihami (future) vv. 41-48, pauvagad marthami v. 50, rakkhami mahavvae parcha vv. 68-76, sahamti (or saheum) appano attham vv. 80-84, vosirami, tti pavagam vv. 116-120. The formula uses the first person alone: nimdami, garihami, vosirami, vosire, khamemi, pachchaikkhami (!). It concludes eyam pachchakkhanam anupaleuna suvihid sammam vemaniya vva devo haviyya ahavi visiyyiyya 11 143 II. It, therefore, opens up as the prospect of the reward of correct performance of confession, entrance among the vemaniya gods or complete dissolution (vistryeta). PARSI AND GUJARATI HINDU NUPTIAL SONGS. BY PUTLIBAI D. H. WADIA. (Continued from Vol XIX. page 378). PART II. TRANSLATION. No. 6. Song sung when the wedding presents are being carried for the bride or the bridegroom. Five sets of presents for the bride and five for the bridegroom: (Even) the king has admired them from the balcony (of his palace). Five sets of presents for the bride and five for the bridegroom, The wedding guests have been brought from the country of Jasa.1 5 Their praises have been sung in good words. . . . .2 Joy, joy to him by whose side the pipes are being played. Let us make an ovation with a tray full of pearls. Come forth, mother of the bridegroom, his aunts, his sisters all : The petted bridegroom will now mount his horse, 10 And he will have a splendid following. Graceful flower girl, tripping gracefully along, Who will buy thy daisies? His father, Meharwanji, will be sure to buy them; For he is in pressing need of them. The name jitthamala (see Ind. Stud. 10, 283) is found here (v. 11); see p. 380. 1 It is not plain what country is meant. The meaning is not quite clear. The bridegroom's.
Page #122
--------------------------------------------------------------------------
________________ 114 THE INDIAN ANTIQUARY. [APRIL, 1892, 15 His father is overjoyed and spends money (freely) In order to keep up his prestige. The bridegroom's mother has caused a beautiful sadi to be woven for herself, And a bodice of cloth of gold. Father, what shall we admire most in this procession ? 20 I bring my procession (of guests) from the city of Bombay (Mumbai). Send for jewellers from Surat, Send for boxes full of jhal' and jhumran And adorn the bride and the bridegroom with them. Brother, what shall we admire most in this procession ? 25 I bring my procession (of guests) from the City of Surat. Send for goldsmiths from Surat, And get boxes fall of bangles and bracelets. Indulge every desire of the marrying couple. Now, father, you who are a man of influence, 30 Get together good wedding guests. The flower girl enters the narrow street, And brings garlands of buds. Flower girl, we shall buy what you bring. We married women shall unite in buying (your flowers). 35 Get married women to sing songs, And indulge every desire of the marrying couple. Sorabji will now ride his horse, And by his side (will walk) bis brother who is a de sii?. Let me scatter mustard seeds under the horse's feet, 40 And wish the rider every blessing. Let me sprinkle some jiran under the horse's feet: I would not entrust any one with the rider even for a moment. Let me place (some) daniza under the horse's feet, Sorabji will mount his horse with his face to the East. 45 Let me sprinkle some saltle under the horse's feet. This is the first time in my life that I de such a (neritorious) thing. Let me break (some) eggell under the horse's feet. May the rider be as (prosperous as) his ancestors. Now my Sorabji has mounted his horse, And has bowed his head to Dadar Hormajda. * Ornaments for the ear. 5 The meaning is not quite clear. . Women under overture, as distinguished from widows. 7 The beadman of a community invested with certain magisterial powers. * Seeds resembling fennel seeds. * Damni is a sweet smelling herb. 10 Mustard seeds damnd, and jiran, are not, so far as I know, considered auspicious, bat salt is believed to carry prosperity with it. 11 Eggs play an important part in Parsl festive ceremonies: whenever a person is to be welcomed, tray is prepared with a good many things, which are believed to be auspicious. These are: a COCORnut, an egg, a handful of rice, a little water, and some sugar made up into little cakes. As soon as the guest steps up to the door the mistress of the house, or if she happens to be a widow, some relative of hers, goes forth with the tray in her hand, and first taking up the egg waves it over the head of her best, and breaks it against the steps or the pavement; then she does the same with the cocoanut, and finally sprinkles the rice and sugar cakes over the favoured head. This done, she waves her bands over her guest's head, and uttering some blessings cracks her finger joints against her own temples (vide ante, Vol. XIX. page 875, note 13, part 1), and bids the guest step in with the right foot foremost. The coconut, egg. &c., are believed to carry off all evil with them; and they make it a point to break the egg and the cocoanut, from which it appears that some sacrifice is meant, and the egg doen duty for a live offering, which latter the Paris cannot admit into their nuptial ritos, out of respect for the feelings of the Hindus whose customs they have largely adopted.
Page #123
--------------------------------------------------------------------------
________________ APRIL, 1892.) PARSI AND GUJARATI HINDU NUPTIAL SONGS. 115 No. 7. Another Song sung when the mother-in-law welcomes her son-in-law. The mother-in-law welcomes her son-in-law, ornamente adorning her head; Seizing upon an auspicious moment, she welcomes the bridegroom and adorns his neck with a garland (of flowers). With an oblation of flowers and cocoanats and ringgl2 is the bridegroom received, and is made to sit under the mandar. Strinbui, thy husband has come, and wants some place to put up at. Give him an orchard to put up at, and his mother's heart will rejoice. 5 Give him a garden to put up at, and his father's heart will rejoice. Give him a palace to put ap in, and his sister's heart will rejoice. Give him (a place near) a small well to put up at, and his paternal aunt's heart will rejoice. Give him (a place near) a sacred rivers to put up at, and his maternal aunt's heart will rejoice Give him a yard to put up in, and his paternal uncle's heart will rejoice. 10 Give him a mango plantation to put up at, and his maternal uncle will rejoice. Let us bestow upon the bridegroom mango and tamarind plantations, And let us bestow towns and villages on him. Let us give him eighty-four market places, and let us give him extensive forests. (But the bridegroom says) "I care not for your mango and tamarind plantations, nor do I wish to have your towns and villages; 15 I need not your eighty-four market places nor your extensive forests; I am come only to take away Pharamji's daughter, for then only will my life be worth living." The bridegroom is being decorated with twist14 and has been brought down to marry a virgiu. Sprinkle showers of rose-water and hand packets of pan round to the guests). Sprinkle showers of saffron on, and hand bouquets of flowers round (to the guests). 20 The guests are welcome, guests of her who has been waiting (for them). TEXT. ira . varaNIna gIta. pAMce varaNI ne pAMce AdaraNI. dhana dhana re kUkhe vAMsalI vAge. 5015 treft Tag ym. bharI motInI ThALe vadhAvIe. pAMce varaNI ne pAMce kalIANI. . varanI mAe re mAsI, bena phaDa cAlo ApaNe jAe. jasA dezathI te jANa ANI. 3RT17 TT18 at 7. 5 ere vakhANI zacaze vANI avala pAlava jANIra.16 10 zAhAbolo teno khUba sobhaze; 12 The mother-in-law receives her son-in-law when he comes down to marry her daughter in the following manner :She goes forth with a tray in her hand, in which are placed a diamond or any other kind of ring, or some other ornament for the bridegroom along with kunku, some grains of rice, some dry dates and almonde, cocoanuts, and & cope-shaped packet of sugar. The mother-in-law makes a mark with the kankd on the bridegroom's forehead, and presees some grains of rice on to it. Then she puts a garland of flowers round his neck, and puts the ring on his finger. This done, she throws a few grains of rice over his head and passing her bands over his face or his head cracks her finger joints against her temples (ride the preceding note). 15 GTI is the word used in the text and is made to rhyme with a mother's sister. 16 During the marriage oeremony the bride and bridegroom are made to sit opposite each other, and twist is wrapped round and round both their persons by the priests, who continue repeating prayers and burning incense on a fire. This practice is now being gradually dropped by the Parsis, but is still prevalent among the Hindus. ____16 jaTharA I interprot this word arUkhA baloony. 10 This last phrase is unintelligible, separately 37775 means first or best, ** an embroidered border, and jANIe we know. 17 See ante, note 38, part I. 1 TTT is the common namo by which all bridegrooms are called before they are married.
Page #124
--------------------------------------------------------------------------
________________ 116 THE INDIAN ANTIQUARY. [APRIL, 1892 laTakArI re mAlana laTake cAle, sAMkaDI zerImAM mAlaNarI20 Ave. koNa lezeresArI mogharo. kAcA kaLIbhonA hArI lahAve. leza lezere enA meharavAnajI bAvA, mAlaNa tame lAvo te ame lai . sene garajo utAvalI. amo sovAsaNI maLIne laDDUM. 15 eno bAvo reharakhe dalAmA kharace, 35 sIvAsaNa loka kaNa gIta gavaDAvI. nAma potAnA rAkhaze. mArA paraNatAMnA koDa pohacarAvo. varanI mAe te sobhasa sADI vaNAvI, ghoDe caDazere sorAbajI bhAi. kasabI alecAnI kAMcalI. tenI AgaLa vIro dezAi. bAvA sAjaNamAM zure vakhANu. ghoDAnA pagatale chAMTuM re rAi. 20 mAruM sAjaNa mumbAi zeheranu A. 40 ghoDAnA caDatAne bhara bhalAi. murata zeheranA jhaverI bolAvo. ghoDAnA pagatale chAMdure jI. dAbaDA bharI bharI jhAla jhumarAM lAvo. ghoDenA caDatAne ghaDIbhI nahIM dhIrUM. mArAM vahavarane te jore peharAvo. ghoDAnA pagatale meluM re hamanI. vIrA sAjaNamAM zuMre vakhANaM, ghoDe caDaze sorAbajI ugamano. 25 mArUM sAjaNa surata zeheranu Aj. 45 ghoDAnA pagatale chADere miitthaaN.|| surata zeheranA sonIrA bolAvo.. mArI jaNamAre e kAmore dIThAM. dAbaDA bharI bharI curA vArA lAvo. ghoDAnA pagatale bhAMDaMre iMDAM. mArAM paraNatAMnA koDa pohacarAvo. ghoDenA caDatAne varAvonAM mIhaNAM. have bAvAjI baLavaMtavALo.10 ghoDe caDIbhore mAro sorAbajI. 30 tame sArA sAjaNIbhA melavAvo. 150 se dAvAra horamajadane lAgo re pAye. gIta 7. sAsu jamAine haragavA nIsarete veLA gAvAna gIta. vara sAsa se haragavA nIsayAM, mastake bAMdhyA moDa re. utAga Apo bhAMbAMnA mana haze te varanA mAmAnAM. veLA te moi vara haragIbho, gaLe sobhASyo hAraDo. bhApI te AMbAM AmaLI bhApo se nagara gAma re. phula nArala vITIe varaharagIbhI, mAMDava mAhe besAjyo. bhApo corIAsI cauTaDAM, bhApI te bohoLAM rAna re. vara bhAgyo re chIrInabAi tAro mAMge utArA ThAra re. | nahIM le te AMbAM AmaLI nahIM letaM te nagara gAma re. 5 utArA Apo vArInA mana haze te varanI mADInAM. 15 nahIM letaM corIbhAsI cauTaDAM nahIM leuM te bohoLAMrAna re. utArA Apo bAganA mana haze te varanA bApanA. leza leza te pharAmajInI dIkarI mArAM te jIyA paramANa re. utArA bhApo mehelanA mana ho te baranI bahenanAM. varane kAcAM sunare saNagAryA, kumArIse paraNavA utAyo.' utArA Apo kuinA mana ho te varanI phudanAM.. chAMdochAMTote golAbanAM chAMTaNAMpANabIrAMbhApI hAyamAM. utArA Apo kAzInA mana ho te baranI mAsInAM. chAMTochAMTore kesaranAM chAMTaNAM phUla torA te bhApo hAthamAM. 10 utArA Apo jhApAnA mana ho te varanA kAkAnAM. 120 mArA sAjaNIAre bhale bhASyA, nA jotI te vATI re." MISCELLANEA. NOTES ON THE MANNERS, CUSTOMS, (ii) Palaunge, who occupy the highlands. RELIGION, AND SUPERSTITIONS OF THE (iii) Kachins, a hill tribe. TRIBES INHABITING THE SHAN STATES.1 (iv) Karens in very small numbers. The natives of the Shan States belong to the (v) A few Panthays. following tribes: (vi) Las and Was, who occupy atract of (1) Shans, who belong to the great Tai family, country to the east of the Salween river. and occupy generally the valleys of the The descendants of the great Tai family of Shan plateau. Bhans are the main occupants of the country and 19 This phrase is rather ambiguous. Poetical form of mAlana. 1 ist in the plural form of Hilgsalt, but it is grammatically incorrect. na piati a a This phrase is grammatically incorrect, it should be arz wiata 1 [Printed originally as a Government paper, by Mr. W. R. Hillier, but as the vernacular words were then given only in Shan characters, this is practically the first useful publication of these very valuable, though somewhat Enskilfully written, notes.-ED.)
Page #125
--------------------------------------------------------------------------
________________ APRIL, 1892.) MISCELLANEA. 117 rule the States. Their language is both spoken and written, and, like Chinese, is a tonal language. They are Buddhists in religion. Agriculture is their main oocupation, and rice the staple crop. It grows luxuriantly both in puddled land and on the hill slopes, yielding good crope. The Shans are divided in the Northern Shan States into Northern Shans or Tainu, and Southern Shans or Taitau. Northern Shans are again divided into Tainu (Northern Shans) and Tainark'am (Namkham Shans) or Taika (Chinese Shans). The Tainu proper and the Taitai dress alike. The Taitau are often also called Taileng (Red Shins). The Tainamk'am and the Taik'e dress mostly in dark blue (both men and women). The mode of living and habits of all classes are alike, the only difference between them being in dress and accent. At birth no partioular ceremonies are performed. The mother is not secluded. No rules of diet are enforced on the woman during preg. nanoy; but the mother is for one month after the birth of a child forbidden the following, (1) Bambhar flesh, (2) barking deer's flesh, (3) fish called puning, (5) oranges, (5) vermicelli, (6) seesamum oil, (7) pakkat (an edible fern) (8) p'almi (onion). (9) makk'usom (tomato). The above articles of food are said not to agree with # newly-born infant. Immediately after child-birth, the mother has her stomach bandaged, and sits with her back exposed to a fire made of any wood, which, when punctured, does not exude any milk or gom. The woods generally used are, (1) maipim (oak), (2) maikot, (3) maikok (tree fern). (4) maimeut, (5) maika' (chestnut). The mother is considered unclean for seven days, and before entering upon the duties of the household has to bathe and put on clean garments. Pine-wood (maipek) is burnt and the mother inhalee the smoke, and also inhales samongndk, which is said to prevent a rising of blood to the head, and so to prevent bleeding from the nose and mouth. Should the mother bleed from the mouth or nose, she is given a decoction of turmeric or some monkey's blood. The husband observes no special diet during the pregnancy of his wife, or after her delivery, but it is considered undesirable that he should, (1) drive pigs. (2) carry the dead. (3) bore holes. (4) fill in holes in the ground. (5) mock others. After a month the child is bathed in water, into which, if the child is a boy, have been put silver, gold, precious stones, a 10-tald weight, a 5-told weight, a 2-told weight, and other standard weights down to t of a told. If the child is a girl, silver, gold, and all the ornaments of the female sex are put in the bath water. If the child is of well-to-do parents 11 tolds weight of gold is tied as a pendant round the child's neck, and if of poor people four annas weight of silver. The child is now named by one of the elders, who ties a cord, consisting of seven threade, round the wrist. The name is given in the following order :If a boy (son); 1st son = Ai. 2nd son = Ai Yi. 3rd son = Ai S'am. 4th son = Ai S'ai. 5th son =. Ai Ngo. 6th son = Ai Nok. 7th son = Ai Nu. 8th son = Ai Nai. If a girl (daughter); Ist daughter = Nang Ye. 2nd daughter = Nang Yi. 3rd daughter = Nang Am. 4th daughter. = Nang Ai. 5th daughter = Nang 0. 6th daughter = Nang Ok. 7th danghter = Nang It.* These names are kept by both boys and girls, unless changed under the following conditions : (1) It the boy enters a koyaung (Buddhist monastery). (2) If after three or four years the child (boy or girl) is renamed with a name indicating the day of birth. (3) If illness supervenes, when the name is changed in the following manner; A ceremony is performed by which the child is supposed to be exchanged for .d aw in law. * Barmene samongnet = nigella sativa. * [The Burmese naming customs are simply those of the Hindua borrowed direot from India, bence those primi. tive customs of the Shans are peculiarly interesting ED.)
Page #126
--------------------------------------------------------------------------
________________ 118 THE INDIAN ANTIQUARY. [APRIL, 1892. (a) A piece of coarse cloth, and is then called Master (or Miss) Coarse Cloth, Ai Man or Nang Man; (b) A portion of silver, when the name becomes Master (or Miss) Silver, Ai Ngeun or Nang Ngeun; (c) A pair of scales, when, if the child weighs more than a viss (Rs. 100 in weight), the name becomes Ai (or Nang) Swoi S'a, Master (or Miss) More-than-one-viss; OT, (d) The child is put into a roaster and a pretence is made of roasting it, after which it is called Master (or Miss) Roast, Ai Ka or Nang Ka; or, (6) The child is thrown away, and picked op again by some member of the family, and after a little time given back to the parents and called Master (or Miss) Picked-up, Ai (or Nang) Kip; or, (f) If there is a visitor in the house the child is given to him, and then taken back and called Ai (or Nang) Kek, Master (or Miss) Visitor; or, (g) If it be full moon day, the child is called Ai (or Nang) Mon, Master (or Miss) Full Moon; or, (h) If the child have birth marks, it is called Ai (or Nang) Mai, Master (or Miss) Marks. The above changes of name are made to restore the child to health, and if they fail to do so, the child is then taken to the kyaung (Buddhist monastery) with some offerings and called Ai (or Nang) La, Master (or Miss) Offering. All the names under head (3) are subject to further change under heads (1) and (2). A boy, when old enough to talk and learn, is sent to a kyaung (in this case a monastic school), which he attends till he learns off the first prayer, when he is made to repeat it thrice in the presence of the head pongyt, (Buddhist monk and teacher), exchanging his ordinary clothes for those of a pongys, and remaining in the kyaung under a name given by the pongyt. This name begins or ends with one of the following letters, according to the day of his birth., Sunday=a, d, or a, as Sana, &c. Monday=ka, k'a, nga, or ka, as Kaliya, &c. Tuesday=8a, s'a, or na, as Santa, &c. Wednesday=ya, la, or wa, as Wilas'a, &c. Thursday=pa, p'a, or ma, as Pansikta, &c. Friday =sa, or ha, as S'ana, &c. Saturday=ta, t'a, or na, as Nanta, &c. The name thus given is retained for life. In the case of girls the name is given by an elder of the village, and not by a pongyi. Adoption is practised, but is followed by no special ceremony. If the adopting father have no issue, then the adopted son gets all the property. If there be issue, either before or after the adoption, the adopted son gets half the share of the rightful issue or issues, who get equal shares. The same rule is followed with regard to the property of the real father of the child adopted. No ceremonies are performed at Puberty, either in the case of boys or girls. Marriage is permissible with any caste or creed. If a person of either sex dies without marrying, the body, before burial, is banged against a treestump, which is, for the time being, considered to represent the husband or wife. This ceremony is performed in the belief that, if omitted, the person would, in his or her next existence, again die unmarried. A young man, taking a fancy to a young woman, visits the latter's house and woos her, and, if the liking be mutual, she accompanies him to his house as his wife. On the following morning the parente of the young man visit the parents of the young woman with an offering of salt and tea, make known to them the fact of the union of their respective children, beg that their own child may be forgiven for the intrusion, and request the fixing of a day for the marriage ceremony. This request being granted and the day fixed, the young woman returns to her parents. Sometimes the young man on proposing to the girl is referred to her parents, in which case he sends his parents with an offering of salt and sugar to propose for the girl and obtain the sanction of her parents to fix a day for their wedding. On the day appointed the relatives of both parties, and the parties themselves, collect in the house of the girl. The bridegroom, taking with him a bundle of tea (one viss) and a bundle of salt (one viss) tied together, and in them as much money as he can afford to give the parents of the girl as compensation, places his presents before them, and proposes for their daughter. The two bundles are then untied by the parents and the money extracted, 6 [The regulation viss 3-65 lbs. (avoirdupois); but this vies must be about 2. lbs. oply.-ED.) & oi as in voice. 6 San is a qualifying prefix and not part of the name proper. [In the above we have the ordinary Brahmanical system of nomenclature. The remaining customs previously indicated have many parallels among nonBrahmanical natives in India.-ED.]
Page #127
--------------------------------------------------------------------------
________________ APRIL, 1892.] MISCELLANEA. 119 after which one of the elders of the village takes The causes of disease are held to be, the tea and the salt out into the main road, and (1) irregularities of diet, holding them above his head calls on heaven, (2) change of water and climate (air), earth and sun to witness the union of the two (3) evil spirite. parties. He then re-enters the house, and ties a Diseases from (1) and (2) are treated by medicord of seven threads round the left wrist of the cines (mostly herbs) and shampooing, from (3) by bride and one round the right wrist of the bride- applying irritants, such as chilles to the eye. groom. This is called the matrimonial bond. Children are never killed. Abortion is brought The bridegroom next distributes money to the on by shampooing. elders of the village and all sit down to a feast. | Death is considered to be the result of disease The bride with all her worldly goods now and the dead are buried. The corpse is dressed accompanies the bridegroom to his house, but they in new clothes. Clothes with a burn in them are never used under any circumstances for burial are stopped on the road by bachelor friends of the bridegroom, who has to pay his way through them. purposes, the body being buried naked rather than in such clothes. There is no belief in Formal marriage is, however, dying away, and ghosts. The grave diggers, before getting out of marriage now often means cohabitation by mutual the newly dug grave, sweep it out with brambles consent. or thorns to prevent the nats (spirits) from Divorce is by mutual consent of both parties, remaining in the grave. who give each other letters of freedom to re Persons who have handled a corpse are required marry, &e. to bathe before re-entering the village. If the wife claims a divorce and the husband No mourning garb is worn by a widow. is not willing, the wife has to pay Rs. 30 to be The officials (Sabwls, Myozas, Tamons and divorced. If the husband claims a divorce, he Myokhams) decide all cases of murder. The forfeits all his household property to his wife. murderer has to pay the following compensaThe forbidden degrees of consanguinity may tion. To the next kin of the victim, Rs. 333; to be thus stated. A man shall not marry his, the official deciding the case, Rs. 333; to the (1) mother, amats, Rs.); to the sares, Rs. 40; to the bailiff (2) grandmother, and messengers, Rs.''. If he cannot pay these (S) sister, sums his relations have to do so ; if his relations (4) aunt, cannot, his village ; if his village cannot, his circle. (5) wife's mother, If he belong to another clan or state, and refuse to (6) wife's grandmother, pay the fine, then war is declared between the two (7) wife's aunt. states. If two brothers fight and one is killed And vice vered with a woman. All other ties are the whole family are made to forfeit their worldly allowed. goods (household). When a murderer pays the A man may have several wires. A woman compensation he is set free and no alur or stain cannot have more than one husband. Polygamy is attached to him. is sanctioned, as man is believed to be the superior Individual property is recognized and inheriand master of woman. A man obtains a wife by tance takes the following course :wooing and with her consent: sometimes by purchase; and in case of rulers, as an offering of Owner peace, friendship, &c. A man is prohibited from cohabiting with his Son and daughter wife, Wife. ti (equal shares). (1) during menstruation, (2) while she is in the act of suckling her child, (3) when she is ill, Mother and father. (4) on new moon and full moon days, (5) in the open, or in a kyaung or xayat," A widow is free to marry again and act as she Brothers. pleases, no one in particular having any claim to her. [On this Lieut. Henry Daly remarks that the letter is only given by the man, not by the woman. Lieut. Daly is the Superintendent of the Northern Shan States.-ED). This equals the Indian dharmsaia. (Lieut. Daly says that " this statement is, I believe, incorrect."-ED.]
Page #128
--------------------------------------------------------------------------
________________ 120 THE INDIAN ANTIQUARY. [APRIL, 1892. It will be thus seen that property descends to the children and wife, the wife taking 50 per cent. and the children equal shares of the remainder. The eldest son gets the household property, arms, and precious stones. If there be no children the wife is heir ; if no wife, the parents ; and if the parents are dead, the deceased's brothers divide. A title or seat (Sabwaship, &c.) descends to the sons in order of birth. If there be no sons to the daughter's husband, if she be married; if not, to the brothers. Everything is eaten, only human flesh being forbidden. Men, women and childreu all eat together. Cannibalism is practised very seldom, and only by the Bo, or leader of an army. If he be tattoed in a peculiar manner, he eats the flesh of an enemy who has been shot. This is d to render the charm of the tattooing stronger and more permanent. The ground is tilled with a crude plough. The first produce (a portion) is prepared and taken as an offering to a kyaung before any is eaten by the household. Each man is said to tell his prayers before setting out on a warlike expedition. The wife of the warrior (1) rests and does no work on every fifth day; (2) fills an earthen goblet with water up to the brim and puts some flowers into it every day. A decrease of the water or the withering of the flowers is looked upon as an evil sign (death); (3) Sweeps clean, and lays out, her husband's bedding every night; (4) is prohibited from sleeping in his bed during his absence. Mutilation of enemies is carried on to a great extent. The heads are always cut off and brought to the Chief, who gives a reward for every head, according as the head is that of an important or ordinary man. The country is governed by Chiefs whose office is supposed to be hereditary and not elective, and descends as above explained. The following story is told of the origin of the Bhans and of their government. A man, aged 5,000 years, started from the east in search of a wife, and at about the same time a woman, aged 5,000 years, started from the west in searoh of a husband. These two met in the middle of the Shan States and then became man and wife. They had eight sons and seven daughters, who multiplied in their turn and gave rise to a large population. The eight sons and their respective children clamoured for the rulership over the descendants of the daughters, when their language became confused and they then separated and went their respective ways, with their children and clans. The names of the eight sons were (1) Ai. (2) Ai Yi. (3) Ai S'am (4) Ai S'ai. (5) Ai Ngo. (6) Ai Nu. (7) Ai Nok. ' (8) Ai Nai." Not being able to agree as to who should be the Chief, and quarrelling amongst themselves, the eldest two sons and their children heard of the existence of two kings to the north, and went there to invite them to come and rule the Shan country. These two kings are said to be the Bons of K'un Sang, the Chief of the Heavens, who sent them to deliver the Shan country. The emi. grant Shans invited them to come and rule their country, and promised to supply and give them every comfort, and to obey and follow their commands. On the way home the party met a man called Sang P'an, who expressed a desire to follow the two kinge, and they in turn promised to provide for him. After a short distance they met another man, who called himself Toriya, and was a songster He also joined the party, and they all arrived at Sanparalit, now in the south-east. The eight essentials of a city (angkamongpit pong) were attended to, namely, (1) Market. (2) Water-supply. (3) Palace buildings. (4) [P] (5) Fields. (6) Monastic buildings. (7) Heads of armies (bos). (8) Roads. The names of the two first rulers are (1) Maha-K'attiya Yaza. (2) Mahl-S'amp'engna Yaza.18 The first improved agriculture and the second introduced weapons. 18 (For(1)read Maha Kshatriya-Raja and for (2) read (?) MabA-Sempunna-Raja. However, compare these names and that of Sanparalit with the following from the Mahdy kawin (Mahardjavarisa), or Chronicle of the Burmese kings " Gautama Buddha, in the fifth year 10 Soo ante, Vol. XX. p. 422, as to the Manipurt rule of descent.-ED.) 11 [Compare the male nomenolature above.-ED.] 11 This man and his generations represent the Amat class, and the two "king" the Sabwa alags.
Page #129
--------------------------------------------------------------------------
________________ APRIL, 1892.) MISCELLANEA. 121 On arrival they found an engraved stone, with inscriptions said to have been written by the deities to guide them in ruling the country, All Sabwas are said to be descendants of the two first rulers and the officials of Sang P'an and Tariya The earth is supposed to have been brought from the depths by a species of white-ant. The depth is 84,000 yusands, the height 84,000, and the shape square. Nine spirits from above came down and then established earth, water, heavena, and religion. They divided the world into 16 divi. sions. The story of the division is as follows: A lotus with four leaves flowered between three stones. Then the Myinmo mountain, which was 84.000 yesaniis within the waters, and 84,000 yusands above, then appeared. It was surrounded by seven mountains, namely, (1) Wikanto, (2) Yokkantala, (3) Eks'engdala, (4) Nemengdala, (5) Sudatsana, (6) Astana, (7) Gandama. These are the worla, which was divided into four great islands, namely, (1) Pop'a Wideha, or the Eastern Island; (2) Amyagaw ya, or the Western Island; (3) Guru. Utang, or the Northern Island ; (4) Sampudipa, or the Southern Island. This last was subdivided into 16 countries. These having been formed, nine Brahmans came down from heaven and created man, animals, trees, flowers, fruits, grain, and water. varsa-nirmmulana Lainkadvipa-luntana-dvitiyaRama Cholakula-snila-kulisa Karnnatarajavidravana Kathaka-kari-katapakala vividha-ripudurgga-marddana Virs-Kanda-Gopala-vipinada vadahana Kanchi-puruvaradhisvara-Gana. pati-hari 2 nn-Sardadla Nelldrapura-virachita-vira. bhisheka pranata-raja-pratishthapaka maharajadbirija-paramesvara - KUChchadaiparmarmana Tribhuvanachchakravarttiga! emmar. dalamunkond-aruliya Sri-Sundara-Pandiya. devax[ku] yinilu 10vadu pattavadu Risbabhnna yarru apara-[pa]kshattu Budan-kilamaiyuv prathamaiyum perra A[ni). 3 lattu-nal. TRANSLATION. A.-Sanskrit portion. Hail! Prosperity! Hail! The snpport of the whole world, the ornament of the race of the Moon, the Madhara (Krishna) of the city of Madhura, the uprooter of the Korula rnce, a second Rama in plundering the island of Lanka, the thunderbolt to the mountain (which was) the Chola race, the dispeller of the Karnata king, the fever to tl.e elephant (which was) the Kathaka (king), the destroyer of the strongholds of various enemies, the jungle-fire to the forest (which was) ViraKanda-Gopala, the tiger to the deer (which was) Ganapati (who was) the lord of Kanchi the best of cities, he who was anointed as a hero in the town of Nellor, who re-established those kings who prostrnted themselves before him, the maharijadhiraja-paramebvara : B. - Tamil portion. In the 10th-tenth-year of the reign) of (thia) king (ko) Jatavarman, alias the emperor of the three worlds, the glorious Sundara-Pandyadeva, who was pleased to conquer every country,--on the day of (the nakshatra) Anuradha, which corresponded to Wednesday, the first tithi of the second fortnight of the month of Rishabha. Among the enemies of whose conquest the king boasts in the Sanskrit preamble of his inscription, there are two names of individuals, viz. Ganapati, the lord of Kasichi, and ViraKanda.Gopala The dates of each of these are known from other sources. An inscription of the MATERIALS FOR CALCULATING THE DATE OF SUNDARA-PANDYA. The island of Srirangam neaz. Trichinopoly bears two ancient temples, one of Vishnu which is called Ranganatha, and one of Siva which is ealled Jambukesvars in Sanskrit and Tiruvanai. kkovil in Tamil. Within the second of these two temples, my First Assistant, Mr. V. Venkayya, discovered an inscription of Sundara Pandya, which promises to settle the date of this king within narrow limits The inseription is engraved on the south wall of the second prikira which I was not permitted to enter. The subjoined transcript of its first lines is made with the help of another identical inseription, the date of which is lost, on the west wall of the third prukdra. TEXT. i Svosti srih .. Svasti Samasta-jagad-adhara Somakula-tilaka Madhurapura-Madhava Kernla- of his Buddhahood, was presented by the two brothers Mahapunna and Cholapunna with a sandalwood monas. tery situated at Vanijjagama, otherwise called Legaing, ia Sunapuranta." Legaing is in the Minbu District of Upper Burma. Mahapurna and Chulapurna are other wise known as Mahasambhava and Chulasambhava, aons of Lahaduka, adopted son of Thadonganaing, first my. tbological king of Tagaung. The legends given, aute, Vol. XVIII. p. 272ff. and Vol. XIX. p. 437ff, read with this one go far towards settling the origin of these garbled Shan tales. Sanparalit is possibly the Chandapuri on the Mekong of Yule and other writers.-ED.) A y n (y jana) is the measure of the distance the eye enn rench. 15 [The Indian origin, probably through Buddhist tradition, of the above folktales is obvious. -ED?
Page #130
--------------------------------------------------------------------------
________________ 122 THE INDIAN ANTIQUARY [APRIL, 1892 Kakatiya king Ganapatiof Orugallu (Worangal) According to an inscription of the Dharmes which is found in the Ekam ranatha temple at vara temple at Manimangalam in the Chingloput Kanchipura, and which I shall shortly publish in district, Kanda-Gopala bore the surname this Journal, is dated on Tuesday, the 11th tithi Madhurantaka-Pottappi-Chola. A comparison of the dark fortnight of Jyaishtha of Saka of the dates of Nos. I. and 11. shews that 1172, the eyelie year Saumya, which corresponds his accession must have taken place between to Tuesday, the 8th June 1249 A. D. According the months of Mithuna and Simha in the Saka to a Telugu chronicle (Taylor's Catalogue, Vol. year 1172. The units of the two dates of No. 111. p. 483) and an inscription of his successor III. are not absolutely curtain. If the published (Sewell's Lists of Antiquities, Vol. I. Appendix, reading is correct, thedetails would be identical Pxx), king Ganapati died in Saka 1180. Vira- with those of No. II; with the exception of the Kanda-Gopala is very probably identical with nakshatra. In this case either Uttiradlam or Kanda-Gopaladeva, whose date is established by Uttirattadi might be a mistake for the other. three other Kanchi inscriptions, the beginnings The manner in which the year of the accession of which are subjoined : of Sundara-Pandya might be fixed on the basis No. I. of these new data, will be as follows:--The upper On the south wall of the 80-called "rock" limit for the date of the inseription of Sundara(malai) in the Arukila-Perumal temple. Pandya is Saka 1172, as the fight between him and Karda-Gopala might have taken place in his Svasti sri Sakara-yundu 1187 perra Tiribuvaga 10th year, in which his inscription is dated, and chchakkarava[r]ttiga! sri-vijaya-Kapda-Gopaladevarkku yeudu lovadu Midusa-nayarru apara also in Saka 1172, the year of the accession of Kanda-Gopala. The lower limit is Saka 1190, as pakshattu truyodasiyum Sani-kkilamaiyum perra tbe fight between him and Ganapati might have Rosari-nal. taken place in his first year, and also in Saka 1180, Hail! Prosperity! In the 15th year (of the reign) the year of the death of Ganpati. The details of of the emperor of the three worlds, the glorious the date of the inscription must accordingly be und victorious Kanda-Gopaladeva, which corre applied to each of the Saka yenrs 1172 to 1190, sponded to the Saka year 1187, - on the day of and the year of the accession of Sundara-Pandya (the nakshatra) Rohini, which corresponded to will fall between Saka 1162 and 1180. Saturday, the thirteenth tithi of the second fort The Sundara-Pandya of the Jambukesvara in. night of the month of Mithuna. scription may, accordingly, be identical with No. II. Mareo Polo's "Sender Bandi," who was reigning On the north wall of the second prakdra of the in A. D. 1292, and with that "Sundar Bandi," Ekumranditha temple. who, according to the Muhammadan historians, Svasti sri Sakara-yandu 1187 perra Tiribuva. died in A. D. 1293 (Dr. Caldwell's Comparative nachchakkarava[r]ttiga! sri-visaiya-Kanda. Grommar, Introduction, p. 141; History of Gopaladovar[k*]ku yindu 1[6]vadu Simha- Tinnevelly, p. 33). The "Pandya king Sundara," nayarru apara-pakshattu tritiyaiyum Sani-kkila. who is mentioned in a Sinhalese obronical (J. maiyum perra Uttiradattu-nal. As Soc. Bengal, Vol. XLI. Part I. p. 200) as a Hail! Prosperity! In the 1[6]th year of etc., contemporary of Parakramabahu of Ceylon (1153 to 1186 A. D.), does not appear to have been a which corresponded to the Saka year 1187,- on the day of the nakshatra) Uttarashadha, which reigning king, but a mere prince and general of a Pandya king Kulasok hara, whose predecessor was corresponded to Saturday, the third lithi of the a Para krama-Pandya, and whose snecessor was a second fortnight of the month of Simha. Vira-Pandya. That there was at least one still No. III. earlier Sundara, may be gathered from the inOn the same wall as No. I. scriptions of Rajendra-Chola, who boasts to have Svasti sri Sakara-yandu 118[7] perra Tiri. conquered the crown of Sundara" (South-Indian buvapasakkara varttiga! sri-visaiya-Kanda- Inscriptions, Vol. I. p. 99; Vol. II. p. 108. Gopaladevarkku ya u*]du [6vadu) Simha E. HULTZSCH. nayarru apara-pakshattu tritiyaiyum Sani-kkila After the above note was in type, I received a muiyun perra Uttirattadi-na. letter from Mr. S. B. Dikshit, dated Dhulia, 11th Hail! Prosperity! In the 16th] year of etc., March, in which he states that Saka 1182 expired which corresponded to the Saka year 118[7],- is the only year that answers for the details of on the day of the nakshatru) Uttara-Bhadrupada, the inscription of Sundara-Pandya. which corresponded to Saturday, the third tithi E. H. of the second fortnight of the month of Simba. Nundidroog, 16th March 1892.
Page #131
--------------------------------------------------------------------------
________________ APRIL, 1892.) BOOK NOTICES. 123 NOTES AND QUERIES. ECLIPSE-CUSTOMS IN MADRAS. son has never stolen anything. If she has lied A peculiar sanctity is attributed to eclipses into her uncle, let her be convicted before the general. Among the Brabmans it is considered panchayut. Conveyour welfare. Katak bads most sacrilegious to take food during the period of panchami, St. 1934 (Oct. 1877). Witnesses to the eclipse. The food should be taken generally the good conduct of Jamni Bhaubhuji's son: fully eight hours before the first contact, and at Thakursi Patel, Baldeve Patel, Dungarsi Patel, first contact everybody, including children, should Bhagwana Patel. Signed by Channa Patwari: the bathe. A bath in the sea or a river is considered above statement of Jamna Bhaabhoji is correct." the most efficacions. Previous to bathing, the Noxt comes a small scrap of paper giving the family priest generally goes through certain rites name of eighteen persons, all Hindus, who owed with a view to washing away all the sins of the the writer Rs. 40-4-0 between them, in sums vary. party. After the bath, alms are freely distributed ing from 12 annas to Rs. 5. to the poor, and when the last contact is over, or after the clearance of the eclipse, there is a second Lastly is a short daily " account of expenditure bath, and then the worshippers may take their with one Ali Bakhsh from Asauj (Sept.) nudi food. 13mi, St. 1934 (1877)." It is in five columns, headed respectively flour (a), pulse (del), ghi A peculiar feature in eclipse customs is, that molasses (gu) and tobacco, with an occasional when the eclipse falls on a day, the presiding note of cash borrowed, and extends from Arauj nakshatra of which is the same as that of a sudi 13mi to Katak badi 8mi, or 11 days. person's horoscope, there is fear of its having an evil influence on his futurity. To ward off this On Asauj sudi 13mi the owner must have laid the priest has to perform counteracting cere in a stock, for we find him proeuring :- tita, 10 monies, and to distribute alms freely to the poor, sers: del, 1 ser : ghi, 1 ser : gur, 1 xer: tam.ikhu, or break a few of both ash-coloured and white 6 pdf : paisd, 3 pii. He bought his utii, dil, and gourds. The person influenced for evil as above ghi regularly every day thereafter, and his gur is also advised to tio round his forehead a small and tobacco occasionally only. Money he seems palmyra leaf, on which are written a few Sanskrit to have borrowed in very small quantities. He verses, in expiation of his or her sins, as the case bought his id alternately 1 ner 8 chitiks, and 12 may be. chitaks : his del nearly always 6 chituks: and his K. SRIKANTALIYAR. gur nearly always 3 chituks. Including his stock on Asauj sudi 13mi, he purchased altogether ata, 35 sers, chitaks : dal, 6 sers, 12 chitaks : ghi GLIMPSES INTO A BHIL'S LIFE. 4 sers, 3 chitiks : gur, 2 sers, 10 chitaks. He I once purchased a quiver, filled with arrows, also bought 6 chituks of sugarcane. The ruling which had been in the possession of a Bhil of rates for these articles were atd, 16 sers : dal, some standing. In a pocket in the quiver were 10 sers: ghi, 3 sers : gur, 10 sers. His total found three documents in the vernacular, of which expenditure was Rs. 4-14-6, including 1 anna and I now give a partial rendering. They are very 3 pies borrowed in cash, in these eleven days, of characteristic of the people to whom the owner which nearly one-fourth was on the first day for belonged. some reason, leaving an expenditure of Rs. 3-12-0 First came a scrap of a letter to the following in ten days, or (say) Rs. 11-4-0 in a month; effect: - "In the Jert (3) District, Jamna | wherefrom it is to be assumed that our unknown Bhanbhaji's son is charged with theft from the friend was a man of substance in his village. house of Manga Mina. She states that so far her R. C. TEMPLE. BOOK-NOTICES. HANDBOOK OF TAE HAKA OR BAUNGSHE DIALECT Opteresting qualities, but solely to their persistent THE CHIN LANGUAGE, by LIKUT. D. J. C. MACNABB, and inveterate habit of raiding. These raids B. S.C., Political Officer, Haka." have taken place with entire impartiality, both That the wild Chins and other mountaineers against other hill-men living without the pale, on the Burman Frontier are at present receis. and against the more civilised inhabitants of the ing an especial measure of attention is due plains. As has been pointed out by Mr. McCabe to the possession by them of no peculiarly in with reference to the cognate Naga tribes, each 1 Rangoon, printed by the Superintendent, Government Printing, Burma, 1891.
Page #132
--------------------------------------------------------------------------
________________ 124 THE INDIAN ANTIQUARY. [APRIL, 1892. village is frequently foreign country to its neigh- bours, and raid and counter-raid are carried on with little intermission and in the most bloodthirsty manner. This state of things could not, of course, be permitted to continue in the presence of a civilised power, and as nothing short of annexation was shown to have the slightest effect on these wild bill-men, their country has been received into the British Empire, and measures have been taken to establish in the hill country the Pax Britannica, which already prevails in the neighbouring plains. This bas, of course, necessitated the presence amongst the wild Chins of British officers, who, in accordance with the wise foresight of the Government, have been encour. aged to make themselves familiar with the language of the people whose destinies they control. The present manuai, which is designed for the use of military and other officers in Haka and its vicinity, is the work of Mr. Macnabb, the Political Officer stationed at that place, and is one of the first results of the new regime. The language is that known as the Baungshe or Haka Chin, which language we are told in the Preface is spoken over a considerable tract of country. Slight dialectic variations, it is true, occur in different parts, but these do not appear to be so important as one might be lead a priori to suppose. One direct result, indeed, of the internecine warfare referred to is the creation of many petty dialects, which, in the case of the Manipuris, have caused travellers to state that the language spoken in certain villages is unintelligible to their neighbours twenty or thirty miles away. Whilst, however, admitting that the conditions of life in the wild forest.covered mountains of the Arakan Yoma are favourable to the propagation of petty dialectic changes, it may reasonably be doubted whether there is much real divergence in the language spoken by different villages of the same tribe. Slight variations in the pronunciation of certain vowels, or in the retention or elision of final consonants, will frequently make alterations in words, which, though sufficiently small in a written language, will often render sentences unintelligi. ble to obtuse savages, and even to educated Europeans, who are not well versed in the language. Of course, also, the absence hitherto of books or writings amongst these savages is eminently con. acive to the growth of different dialects, but again there is a strong counteracting tendency in the pertinacity with which the Mongoloid races retain intact the root words of their languages.' In the present case it may be taken that we bave before us the language spoken by a large and important body of these bill-men, and the information concerning it, now for the first time brought to the public eye, cannot fail to throw an interesting light on the ethnic relations generally of the Chine and their cognate races. Before however examining the philological aspects of the Baungshe or Haka Chin Language it may be well to point out a few apparent errors in the book before us. I shall do so in no cavilling spirit, being well aware of the difficulties and pitfalls which await him who for the first time reduces a foreign language to writing; but without laying claim to any knowledge of the language itself, a comparison of the sentences and vocabulary in this book with those already published of Lushai and its cognato dialects will show, that there are a few mistakes, which may with advantage be corrected in a second edition. Mr. Macnabb has, in writing Chin, wisely chosen the Roman character in preference to the Burmese one, and has selected with slight alteration the Government system of vowel transliteration. This is a most fortunate circumstance, as it both facilitates comparison of the language with others, and enables the learner to grasp at once the vari. ous sounds used in speaking. It is to be hoped that the same course will be followed by pioneers in the other hill languages and dialects, and that the error of the American Missionaries in using a garbled version of the Burmese alphabet (itself drawn from Aryan sources), in writing Karen, will not be repeated. Objection may be taken to two divergences from the Government system, namely the transliteration of short o as in ' upon' by 6, and of short a, as u in fall,' by . In the former case it would obviously be preferable to write the o without any mark at all, since the sound in 'upon' is simply that of the ordinary short o, (not found in Burmese.) The transliteration of the undefined vowel by is unquestionably wrong and misleading. This vowel is etymologically a, as is shown, for instance, by the words for "rupee' (tunka), 'reward' (luk-saung), and 'path' (lumb), which are the deriva. tives respectively of the Hindustani word tanka, the Burmese lak-s'aung (let-s'aung), and the ? (e. g., the Hindt bantnd is the Panjabt vann, words instantly recognizable as the same on paper, but not so in speech. -ED.) "[The experience of British officers in the Chin Hills is clearly that of those who have to deal with savage Janguages generally. E. 9., the remarks of the late Bishop Pattison on the languages of the Pacific Islands, and the experience of Mr. Man in the Andamans.-ED.) . [The representation of o in upon' by 8 is, of course, clearly misleading, but I think it requires & diacritical mark nevertheless. "Ordinary short o" is usually understood to have the sound of o in opaque,' found
Page #133
--------------------------------------------------------------------------
________________ BOOK-NOTICES. 125 APRIL, 1892.] Tibeto-Burman root lam. If it is considered the word for fowl' is given throughout as necessary in writing to distinguish this vowel arr, but primd facie it would seem somewhat from that in the word 'man' some simple diacri- doubtful whether there is any r sound in this tical mark such as would probably suffice, or word, which is obviously a corruption of the wideperhape Mr. Sweet's Anglo-Saxon aeh might do. spread root wa, meaning a bird or fowl. In no Again, is it correct to talk of t preceding or cognate language has this root a final r, nor is as an aspirate P The latter expression is usually there anything to show that the ra suffix which has applied to a breathing of some kind, and indeed been pointed out by Mr. Hodgson in Tibetan the sounds referred to are simply inchoate and other languages occurs in Baungehe Chin. palatals and not aspirated sibilants. Without, therefore, presuming to lay down how It is doubtless through an oversight that such these people pronounce the word, we would pre-Hunterian words as 'a-leen,' warm,' 'a suggest that it is possibly a pronounced in the keek,' 'cool,' tlike,' 'to catch,' occur in the 'heavy tone,' as it is called in Burmese. The book. These should apparently be written alan, fact also of its being a shortened or cut down akik, and tlaik. form of the original root wa lends probability to On examining the vocabularies in the book, one its being pronounced in this tone. of the first things to strike the eye is the pre- It may here be remarked that no mention is fixing of k'to all verbal roots, which seems at made of tones in this book, but this can hardly be first strange, as no known cognate language because they do not exist in Baungahe Chin. It possesses this peculiarity. A comparison, however, would, indeed, be scarcely credible that this lan. with Lushai, (which will be shown to be the guage, surrounded as it is on all sides by those language most nearly related to Baungshe using tones, should be destitute of these adjuncts, Chin), shows that this k' or ka is in reality the which are indeed universal amongst the Southshortened or reduplicated form of the first Eastern Mongoloids. At the same time the subject personal pronoun kemi. This particle is, of course, of tones presents unusual difficulties to the Euroa distinct word, and has nothing to do with the pean, whose ear can frequently scarcely distinverbal root; and it is, therefore, unfortunate that guish between words in different tones, unless it should have been confused with the latter. The the fact of that difference is specially brought error has doubtless arisen from the difficulty, to his notice. Moreover, little has been done which has been pointed out by Professor Sayce, as yet towards solving the question of the in "getting a savage or barbarian to give the best method of rendering tones when using the name of an object without incorporating it into Hunterian system of spelling; so that in a handa sentence or bringing it into relation with some- book like the present one it was perhaps as well thing else." It is, indeed, demonstrable that Mr. to avoid the subject. At the same time we should Hodgson, though aware of a precisely similar have been glad to be informed positively as to construction existing in Gyarung and other the existence of tones in Baungshe Chin, and if languages, has, in the case of vocabularies of so, how many could be distinguished. Similarly, dialects cognate to Baungehe Chin, been it would be interesting to know whether these misled by this very particle ka, which he has Chins ever modify their vowels similarly to the mistaken for the well known ka prefis found German umlart. The use of modified vowels throughout the Tibeto-Burman family. In the is very common amongst the Mongoloid hill-men, present case the confusing of the pronoun ka not to speak of the Tibetans, and a priori it with the root has led to several mistakes in the would seem probable that they exist in the sentences; e. g., on page 6:"Have you ever met Baungshe dialect. In their case no difficulty me" should be kemi na mii-bal-maw, and not exists in writing, since the forms a, e, i, o and i k'mu: and on page 22:4" You are lying" should are universally understood. Possibly the word be nangma na hlen or na hlen, and not na k'hlen. shert 'to build,' (a stockade), should be written in Burmese, and not the sound of o in upon.' The late of Andamanese, owing to this very cause. The savage Mr. A. J. Ellis in his report on the Andamanese Lan- will always say my leg,' your leg,' his leg' in preguage (Presidential Address, Philological Society, 1882) ference to 'leg.' and when he speake, as the Andamanese denoted o in upor' by e.-ED.) do, of darchagda, ugarchagda, and archagds for the above [Mr. Ellis used a in writing Andamanese. But expressions, and then proceeds to drop the final da in the Andamanese have five a sounds, and unless Chins composition, the unassisted learner is apt to be puzzled; ere blessed with an equal number I would suggest a more eepecially when, as in Andamanese, there are seven for a in 'man.'-ED.) varieties of these prefixes, having but little in common & The Science of Language, Vol. I. (I can endorse this with each other and the ordinary words for 'I, you and from personal experience. It took Mr. Man and myself he.'-ED.] about a year to discover the poouliar pronominal prefixes Mongolian Affinities of the Circassians.
Page #134
--------------------------------------------------------------------------
________________ 126 THE INDIAN ANTIQUARY. (APRIL, 1992. shot, for it is very unusual, if not quite unknown, to Chin, in which these relations are not distinin this class of languages, to find an r prefixed to a guished by separate words, according as they are final consonant. Similarly it may be surmised that older or younger than the speaker. swark, to come out' should be written swak. Before leaving the subject it may be as well to In the list of the first ten numerals given at the point out that in a few cases the Chin sentence, end of the book the prefis pa occurs before each as given in the manual, does not eorrespond with number. A reference to the text, however, shows the English, even according to the freest transitthat this pa is, as in Lushai, merely a numeral tion. Thus, on page 20 :- Hi bye hi ta-temai co-efficient, the China and Lushais placing its obviously means "Is this word (or saying) true." between the noun and the number, instead of last. and has nothing to do with the English sentenco of all, as is the case in Burmese. The prefis fan "I wish to get true information about this." before kal or kwe, 'twenty,' is apparently n numeral Similarly in the next line : - Nangma pakat-te Cu-efficient for some special class of nouns, as on bye-sin kan du should apparently be translated page 25 there occurs the expression mi-pa-kre "I wish to speak to you alone," and not "Do for twenty men.' It would seem not improbable you think your information is true?" there are other numeral co-efficients in Baungshe With regard to the place of Baungshe Chin Chin besides pa and fan. The suffixing of in the Tibeto-Burman family, it must plainly be these particles immediately to the noun is, it may grouped with those of the other hill-mea inhabit. be remarked, a favorable example for Dr. Bleek's ing the Arakan Yoma Boantuins from Manipur to theory of the origin of grammatical gender. their southern extremity. The principul languages To pass to particular words, the translation of or dialects comprised in this group are Manipiri. kut as arm' is apparently wrong. since in Lushai | Lushai (Dzo), Kami, Shandu, and the languages and other cognate dialects it means Land,' and, of the Wild and the Tame (or Southern) Chins. in fact, in the Vocabulary at the end of the book Professor Sayce in his Science of Language the word aban is given for forearm. Similarly has, it is true, adopted another classification, niakon the same analogy it seems open to doubt ing two groups of them and including Burmese whether the Baungshe Chins do not possess a and Karen in the second group. A comparison, distinct word for ' leg' apart from ke, foot." however, of the vocabularies and grammar of these The word pa which properly means 'father is hill tongues shows them to possess many special given for man,' both on page 3 and in the Voca points of resemblance, which differentiate them, bulary, but a reference to the Sentences shows as a whole, from the Burniese. the word used for 'man' is mi, an extremely wide These tribes are, in fact, in all probability a later spread root. Pa is possibly used, as in other immigration than the dwellers in the plains, and languages of the Tibeto-Burman family, is a are more closely connected with Sul-Himalayan tribes, such as the Limbu, than is the case sufix meaning 'male.' with the Burmans. The Maniporis, having for The word nga, given in the Vocabulary on page some time past masqueraded is Hindus, bave 15, evidently means to know and not to say, altered their language more than is the case with and in practical use it would seem to correspond the hill-tribes south of them, but they neverthewith the Burmese tat. Burmese and Chin, are, less belong to the same group. Of the different of course, far from being the only languages, languages spoken in it Baungshe Chin has a which use the verb to know' in the same senso markedly close affinity with Lushai, as the as to be able.' following list of words identical in both proves :Exception may be taken to the giving of differ. Bear vom Day tsun ont adjectives (such as those of colour, deep,' &e.) Beat vel Dog in the form of nouns, i. e., with short a prefized. Before 'mai Door in-ka In the Tibeto-Burman family there are no Behind 'nu Eye myit such things as true adjectives, their place Bird Fall tlat being taken by verbs; and the fact that in certain Bite shi Fire me languages they are suffixed to the noun makes Blood Fish nga no difference. boar (wild) ngal Fly The words given respectively for brother' and Burn Fowl sister' probably denote either elder or younger Cold shik Go kal (kul) brother or sister,' as it would be difficult to point hun Good ata to any language in the remotest degree cognato | Daughter fanu Hand kut * Compare also mark, 'to divorce' with the Lashai mak. ta kang
Page #135
--------------------------------------------------------------------------
________________ APRIL, 1992. BOOK-NOTICES. 127 asi in rul Son ti Weep Head Seed High asang Sit t' House Slave shal (shil) Inside sun Snake Iron tir afa Luoking-glass kla-lung Stone lung Make Sweet aklum Many tam (tim) Thatch Near anui This Necklace Tooth ha Nose nga tap Old ali Well (be) dan Pumpkin mai Which koi Rain ruu shuur Widow nu-me Reap Wish du Red shen Yellow eng Ripe min You nangma See mu In addition to the above list, which is taken unat at random and is very far from being exhaustive, there are many other words, such as Trimu ani kwei, I, which cliffer very slightly. Both from the number and nature of the allied words and from the character of their resom. Wances, it is apparent that the Baungshe Chins and Lushais must at no distant period have formed one race. Words like those for brass, gong,' looking glass,' &c., which are the same in Lushai and Baungsho Chin, can only have been in. corporated into these languages recently, whilst the fact that the Chin word for 'rupee,' tanki,is derived, like the Lushi, direct from the Hindustani and not through Burmese, points to the inference that when first introduced to this coin these Chins were probably living to the west of their present habitat; i.e., in the Chittagong Hill-Tracts, where the Luslais still reside. At the same time it may be in- ferred, from the words for gun' in Chin and Lu. sliai being different, that they had already separated when fire arms were brought to these hills. It is noteworthy, also, that these Chins have an indi. genons word for 'sea,' which would hardly be the cuse if they had resided long where they now are. One of the points, in which Baungsho Chin agrees with Lushui, is in the use of the sound of f in certain words, this being a somewhat rare sound in Tibeto-Burman phonology. The sound of f is also used in Kami, which language together with Lushai, possesses the peculiar guttural breathing known in Arabic as 'ain. No mention (I would, however, be cautious as to this assumption on philological grounds only.-ED.] 10 [It should be remembered, however, that the sound of is seldom properly taught in India, with the result that the ears of the majority of Anglo-Indians are not so attuned as to catch it in learning new langunge.ED.) of this latter sound is made in Mr. McNabb's work, so it may be that it is not found in Baungsho Chin. The sound f would seem to correspond with the varga ch, ts and s in the other Tibeto-Burman languages. Both the f and 'ain sounds are very sparingly used, and it is possible that they are foreign sounds introduced into the dialects, in which they occur by contact with some Muhammadan race. The terminals 1,r, and p still exist in Baungah Chin, as in Lushai, though it is curious to note that, amongst the former, finall is not unfrequently clided. The example of the Chinese and Burmans shows that, with increasing laziness of pronunci. ation, these letters as terminals are apt to disappear. One of the most noticeable points in the grammar of Bauungsho Chin is that the present tense of the vers consists of the nakod root without even i euphonical sutis. It is, of course, open to doubt whether this omission is due to a really primitive method of conjugation, as in Chinese, or whether there was formerly some suffix, which has come to bo olided. Perhaps the latter hypothesis is on the whole the more probable, as no other case appareatly exists in the Tibeto-Burman family of this want of a suflis, and it can scarcely be contended that Baungal: Chin las alone retained the earliest form of conjugation. The future particle is lai, which is, curiously enough, almost the same as that (lail) used in Southern Chin to denote compulsion, 'must.' The latter is, however, compounded of the verb lii must'andail, the future particle, in the same way as the Burmese ra-man (yu-mi). In one sentence', indeod, on page 19, na ngai-lai is given for you must obey.' but it can hardly be supposed tliat the particle of the future of compulsion has been given throughout in mistake for the simple future. The termination in Lushai is, it may be remarked, ang. The negative interrogative particles are respectively lo and mate, as in Lushai. The latter of these is evidently the Chinese mo, but the only analogy to the former outside this special family of languages is apparently the Dravidian illei or alla. The present participle lyo in Baungshe Chin is probably allied with the Burmese lyal (lyet). It does not seem to have analogies in the other hill languages. 11 The Kami afi 'tooth' is probably identifiable with the Tibetan 80, Burmese . 12 It is curious to note that the use of the pronouns with the noun and verb is the same in Banugaho Chin as in Ancient Egyptian : though in the latter language they were suffixed and not prefixed. (But is this a remarkable peculiarity ?-ED.)
Page #136
--------------------------------------------------------------------------
________________ 128 THE INDIAN ANTIQUARY. [APRIL, 1892. The Bufix a (the same as the old Burmese Generally speaking it would seem very extrapostposition a) seems to have a wide range of | ordinary that the Baungshe Chins, who probably meaning. Thus, after a noun it means 'by,'' at'or at no distant epoch formed one tribe with the 'to.' On page 16 after a verb it is used for ' in order Lushais, should yet have retained a different root to.' On page 29 it is similarly used for when.' from the latter for so common a word as 'water.' In the examples in this latter case, under the In the matter of prefixes we have, in the word head of "Imperfect Tense," there would, however, rul for snake,' an example of the throwing off the appear to be some confusion in the use of the a pa prefix (of. Tibetan brul or prul), and, in that particle, unless indeed we are to understand that for butterfly,' plip, an example of its addition, Baungshe Ohin is destitute of a particle to express (Cf. Burmese lip-pya, (lek-pya.) conditions of time. In this case, the sentence -"When I saw him he was running away," would In 'ruk, 'mad,' we see the simple root ru, (yd), read literally in Chin "I saw him, ho was run. (as in Burmese), altered first by the aspiration of ning away :"-a sufficiently primitive method of the initial semi-consonant, and secondly by the expression. addition of the suffix. An example of the suffix is seen in rit heavy' compared with the On page 36 the form given as a perfect Burmese le. If kleng 'to exchange' be the same tense passive, I have been brought,' is, if correct, as the Burmese le, we have in one word both the a very remarkable one ; since the passive ke prefix and a nasal suffis, which alterations, how. meaning is given by infixing a particle di between ever, as Mr. Hodgson has so ably pointed out, are the root and the ordinary perfect suffix sang. common enough in this family of languages. Ren, The formation of a passive in this manner is, "to bind," may be identified with the Burmese however, so contrary to the genius of the Tibeto. krart' (chan), and is a good example of the close Burman languages," that we may be excused in relation between h and k or kh (k) in these languadoubting the correctness of this form, which ges: as also is kld, to release' or to send,' cf. Burapparently does not occur in the Chin sentences. mese 'Iwat ('lut) with the same meanings.1. In the No example is given of the relative parti word for ' pony' (rang) the Baungshe Chins have ciple which presumedly exists in Baungahe Chin, dropped the initial nasal of the Burmese mrang but on page 20 there is an example of a curious (myin); and the same is scen with the word for construction instead of it, the expression 'the men elephant' wi, as compared with the Akyab Chin who come and go' being translated mi-klung, mwi. An example of vowel change is the Baungshe Chin bye (Kami be), speech' compared mikul, literally 'man-arrive, man-go.' with the Burmese pyaw, whilst the word ra for In conclusion, a few words in Baungsha Chin bamboo' shows that the Burmese rod possessed may be selected for notice. Amongst those speci formerly an initial semi-vowel r. ally allied to Manipuri are lamb 'a path' and It is easily seen from a comparison of words tral to fight,' which correspond with the Mani that Baungshe Chin in many cases prefers k puri lambe and lul. The retention of the b where Lushai has t, and indeed it would appear suffix is especially noticeable, since although the from other cases that these mountaineers generally root lam is widely diffused in the Tibeto-Burman are as prone to confuse these sounds together family, there are apparently no other examples in as the South Sea Islanders. it of this particle being suffixed to it. In comparing the Baungshe klang var with the Baungahe Chin has, like Magar and Karen, the Lushai tlang-val'a bachelor'we find, in addition form ti for water, as compared with the Lushai to the above interchange of k, one of the semi. til-i. It seems, however, unreasonable to regard this, with Captain Forbes, as a separate root, for vowels r into l. A further instance of the latter appears in the Baungshe ri and the Lusbai le, a simple throwing forward of the accent in the again.' In the Chin kuk as compared with the word tu.i would probably suffice to alter it into Lushai k up a knee,' we see that a phonetic ti. Further we have a precisely analogous altera. tion in the word for 'to laugh,' which in Lushai is corruption has taken place precisely similar to tliat in colloquial Burmese. -i, but in Baungshe Chin ni, and in this case there can be no doubt that the root is the same. R. HOUGHTON, C. S. 18 This construction is, however, used in Turkish, e.g. ser-it-mek to be loved.' 1Compare also Baungshe Chin klan (to lose) with Lusbai 'lo, and te 'to fear' with the Limbu ke. The Manipari hum three' is probably connected with the Baungshe tun, through a lost kin; since, though the equntion t-k-h holds good in these languages, there is no example of t changing directly into h.
Page #137
--------------------------------------------------------------------------
________________ MAY, 1892.] ANOTHER INSTALMENT OF THE BOWER MANUSCRIPT. 129 ANOTHER INSTALMENT OF THE BOWER MANUSCRIPT. BY PROFESSOR A. F. RUDOLF HOERNLE. THE THE first instalment of the Bower Manuscript was published by me in the Journal of the Asiatic Society of Bengal for 1891. The portion which I now publish I have chosen for the second instalment, because it represents another of the subjects which are treated of in the several treatises comprising the Bower Manuscript. So far as I can make out at present, these treatises deal with three different subjects, viz., medicine, divination and conjuration. On medicine there are (apparently) two distinct treatises; a long and a short one. The latter I have published in the Journal A. S. B., as a specimen of medicine. On divination or fortune-telling there are two short treatises; one of these I publish in the present paper. On conjuration, or the use of magic spells, there is one short treatise. This I hope to publish as my next instalment of the Manuscript. The portion now published consists of five leaves. Their shape and size are exactly like those of the portion previously published; that is, the leaves are a narrow oblong, measuring 11 by 2 inches. A specimen, being the obverse of the second leaf, is published in the lower part (No. II.) of Plate I., issued with the April Proceedings of the Asiatic Society of Bengal. The treatise to which it belongs is referred to in my paper "On the Date of the Bower Manuscript" (ante, p. 29)1 as the "second portion, called B." I have there ascribed the writing of this portion, which is in a fine, ornate hand, to a scribe distinct from him who wrote the portion given in my first instalment. The most striking differences are the two following. In the first place, the palatal e is made in the form of a square with a circular loop at the lower left-hand corner, exactly like the modern Nagari m (4), while in the portion given in the first instalment that letter has a rounded top, and no circular loop, but a minute forked tail. The latter is the older Gupta form, while the former already closely approaches the form shown in the Horiuzi M8. and in the Sarada alphabet, in which the letter is also square, but the loop is replaced by a dot. Both forms may be seen on Plate I, above referred to. In the second place, some letters, (especially a, k, g, r, and occasionally t, bh), are provided with a very distinct hook at the bottom of the main perpendicular. This hook looks exactly like the mark of the vowel u, as attached to other letters, such as m, 8, p, &c. Accordingly, when the vowel t is to be joined to those hooked letters, it assumes a different shape, that of a more or less large curve, turned to the left. Examples may be seen on the same plate. Though written on five distinct leaves, the work inscribed on them only occupies eight pages. The obverse of the first leaf contains, as I have already stated elsewhere, the concluding portion of a medical treatise, but whether of the long one, or of some other, I am not, as yet, quite certain. At the bottom of this obverse page, there is the remark ity-atra svete eveadhipatye batasy-adhikarane svaha, the meaning of which I do not understand. It is in larg cursive letters, in a hand distinct from that which wrote the medical treatise, as well as from that which wrote the treatise on divination; which commences on the reverse of the leaf. It seems to be, however, the same handwriting as that which is seen in some other portions of the manuscript. The most natural conclusion that one can draw is, that the treatise on divination was written after the treatise on medicine, as it commences on the back of the latter. The fourth leaf is inscribed only on the obverse. It consists of no less than four layers of bark, but they are all so thin and flimsy, that a considerable portion is broken and frayed. Even the obverse is only partially inscribed, and the reverse is probably thought by the scribe to be unfit for writing on. In any case nothing of the text is lost. That part of it which commences on the obverse of the fifth leaf, follows immediately after that which is written on the obverse of the fourth. In fact, the material used for this portion of the manuscript 1 Also in Journal Asiatic Society of Bengal, Vol. LX., Part I., pp. 80, 81, * See Proceedings Asiatic Society of Bengal, for April 1891, p. 5
Page #138
--------------------------------------------------------------------------
________________ 130 THE INDIAN ANTIQUARY. (Mar, 1892. is of the same (if not more) inferior description as that employed in the first portion, previously published. This also explains why only one half of the reverse side of the second leaf is inscribed. For here, too, no material portion of the text is lost. The lenves are of varying thickness. None of them consists of less than four layers; but the second is of extraordinary, thickness. It is difficult to count ite layers; but there certainly do not seem to be less than twelve. The part of the manuscript which I now publish is practically complete. The entire treatise which it contains must have consisted (as I shall show later on) of sixty-four verses. Of these the manuscript gives fifty-nine. Three of the missing verses should have been on the reverse of the second and the obverse of the third leaves. On the former page a "vahula," numbered 234, is omitted ; on the latter page two "bhadras," numbered 412 and 124 are missing. There should be altogether six "yahulas" and six "bhadras"; but there are extant only five "vahulus" and four "bhadras." However, the numeral mark 412 is given in the manuscript (sce Al. 3a), though the corresponding "bhadra" verse is missing. It seems quite clear from these circumstances, that the omission is merely an error chargeable to the scribe of the manuscript. The tiro other missing verses should have been at the end of the manuscript. They should have been the two "kharis," nambered 211 and 121. If they ever existed in the present copy, they must have been written on the obverse of a sixth leaf; for the extant "khari" Terse 112 closes the reverse of the fifth leaf. In that case, one leaf of the manuscript is lost, and this leaf might have contained the usual colophon, giving the names of the work and its author. But it seems to me doubtful whether a little work of this kind would have contained the usual colophon; and it is not improbable that the manuscript is complete, and that the omission of the two last verses is chargeable to the scribe, in the same way as the loss of the other three verses. The last words on the reverse of the fifth leaf are written in the middle of the line, leaving sufficient blank space to write more matter, if the scribe had intended to write any more. Moreover the whole is followed by a scroll, apparently indicative of the end. All this seems rather to suggest the alternative of the omission being due to the scribe; probably the original, from which he copied, was already incomplete. There are many other points to show that the manuscript was not written with much caro. Thus on f. 2a* and 2a5 the words prathama mali ant tritiya mali are omitted ; on fl. 5a. and 5a3 we have dvitiya for tritiya; on f. 5b4 the scribe has cancelled the words tritiya panchi 212, though they were correct, and repeated them on f. 5b5, where they are out of place: another blundered case occurs on f. 156. Not unfrequently tnere occur padas, or quarter-verses, which are short by one syllable. Generally it is the 3rd pada (5 times: fl. 281, 226, 36, 4a3, 5b4): twice it is the 4th pada (A. 2a4 and 3a8); once each it is the 1st (A. 5a5) and 2nd padas (A. 5b3.) In most of these cases the fault is certainly due to the carelessness of the scribe. Thus in A. 36 probably kalena should be read for kule, in fl. 5ad vipula for pula. But one or two cases are doubtful: in them the fault may be due to the anomalous nature of the language. Thus in f. 2a6 chaiva artha should be read for (sandhi) chaivartha; again in f. 2at the synonymous nityatah should be read for nitydt. Occasionally the opposite case occurs, of a pada having one syllable in excess. This always occurs in the 4th pada, and in all probability is one of the anomalies of the language; (see below). There is only one exception; it is in fl. 5b5, where the excess occurs in the 3rd pada, and is undoubtedly only a blunder of the scribe; as the sense of the verge shows that he should have written asubha instead of subhasubha. Undoubted clerioal errors of another kind are the following: A, 1b4 sva for spaha; f. 2a3 kalyani for kalyani; A. 2aB artha for artho ; A. 2a6 nayam for nuyam; A. 2a6 prapsasi for prap. syasi and arthas-cha for arthan-cha; A. 2bl dharmmasya for dharm masya; . 2b3 *muktas for See Journal Asiatic Society of Bengal, Vol. LX. Part I. p. 187. The first number refers to the loaf, the letter to the page of the lenf, and the raised number to the line of the pago; thus 20 = 2nd leaf, obverse page, 5th line.
Page #139
--------------------------------------------------------------------------
________________ MAY, 1892.] ANOTHER INSTALMENT OF THE BOWER MANUSCRIPT. 131 muktds ; f. 3al chanunayishyasi for chanunayishyasi; fl. 3a1 *vrittischa for vritt&s=cha; fl. 3a1 # na for na; f. 3a6 sarvvaritha for saruvatha ; A. 3a6 * sameshyasi for sameshyati; A. 3a7 sahayes for sahayais; A. 4a2 karane for kupane (here shown by the metre); A. 4aya for yd; A. 5b4 dharmma for dharmmarh; A. 5b+ vandhas-cha for vandhanh=g=cha. Those cases, however, which are marked with an asterisk, may also be due to the anomalous character of the language. Occasionally the scribe noticed a mistake and corrected it by interlinear insertions in minute and hastily drawn letters. Thus in fl, 3a4 na sanhiaya, Al. 4a3 api, f. 4a6 si cha, f. 593 bha are added interlinearly. Ordinary corrections, by alterations of already written letters occur; e.g., in in f. 27, 5b3 and elsewhere. The language of the manuscript in the early extra-scholastic Sanskrit of NorthWestern India with all its usual anomalies in orthography, grammar, prosody and vocabulary. Of these I have noted the following instances : 1. In Orthography: spelling: Al. 1b5 singha for sinha, A. 2a6 avi for api, fl. ta3, 5al, &c. dukkha for duhkha: confusion of sibilants; f. 24 samanvita for samanvita. Doubling of consonants : before r: throughout with t; e. g., f. 1b6 sattravas, f. 2a6 yattra, &c.: before y: gattyakarana (for yati-akaranai): before v; fl. 5al addhvanari. Sandhi; : fl. 2b2 dvitiyo kubah for dvitiyah kutah, fl. 4al grihaiva for griha eva (grihe eva), t1, 225 tatottamuh for tata utlamah (tatah uttamah), fi. 5b2 suhrideva for suhridaiva (suhrida eva). Omission of final consonants : 3hi kinchi for kinchit, 153, 2a3, 2b+ karana for kuranat (abl. sing.). Omission of visarga : before *: A. 3a7 sumittrai saha for sumittrail, A. 3a7 devatai spriha for devutaih ; f. 2a2 nishphala so or nishphalah; before p: fl. 168 prasaka and yukta patantu. Neglect of sandhi : fl. 216 dpisyate agamo, A. 2b3 vijeshy asi ripusi, f. 3a8 arthah aniruvedai. 2. In Grammar: declension: nom. sing. : f. 161 name achary@bhyah: often visarga omitteil. in pausa; fl. 2a6 uttama, 2b1 priti, A. 2b1 atiparikshaya, Al. 524 sandeha, f. 5a3 labha, f. 569 samupasthita : nom, neat. ; l. 362 janman, A. 4a2 karmai: acc. sing.; A. 362 pratyarthin (for pratyarthinaw): acc. plur. masc. ; (as a rule ending in an, etc.) f. 2a4 bhogari, fl. 2b3, 5a2 tipuri sarrviii, fl. 5a6 bhogari vipularn, f. 5b2 kaman, fl. 5b4 yajnan, but regular in fl. 5b4 vividhan : instr, sing. fem.; f. 162 shashthiye (for shash hyal): gen. plur. ; f. 1b3 sarovavadinan (for 'valinum): loc. plur.; A. 164 rishishu (for rishishu). Conjugation : imp. for pres.; fl. 4a1 bishtha (tor tishihasi): atm. for parasm.; A. 2a, 3b6, 4a3 prapsyase (bat A. 35 also prapsyasi), fl. 2a3. 3al, 3b5 chintayase : parasm. for atm.; A. 247 pratiksha (for pratikshasva). Syntax : exchange of cases: nom. for acc.; A. 2a6 prapsase (for prapsyase) n-ayam uttama (for na imam uttamam), H. 3a6 so 'rthah prapsy ase (for tam arthan), f. 4a6 lanbhas-tu lapsyasi, f. 2a6 arthasacha grihya : nom, for instr. ; f. 3b4 visrijyas-tvar (for tvaya), fl. 386 sa same shyasi (for tena: but see above): nom, for gen.; A. 3a1 vrittis=cha kshayah (for vritt&s=cha: but see above); acc. for gen.: fl. 2al janir=upadravar (for upadravasya): gen. for dat.; A. 1b2 marutanari namah: loo. for dat.. A. 2a4 labhase (for labhasaya). False ooncord : neat, and fem. ; fl. 1b* vritis=satyam (for satya); A. 3a7 viruddhai spriha (for viruddha): masc. and neat.; A. 1b6 nichochchan bhayah (for nichochho), A. 3a8 upasthitasi visishlas-te (for visishtarn): perhaps sing. and plur.; A. 2a5 mahan=artha (for artho), f. 268 muktas=tkilvishd (for muktas). 3. In Prosody: occasionally the fourth pada has one syllable in excess; see A. 261, 4a), 4a6, 5a6. 4. In Vocabulary: new words or new meanings : karitra 'tools' (?), A. 2a6. charnga clever,' A. 2b3 (for changa, perhaps false reading). deva 'god,' A, 2al (for daiva). devata deity,' A. 164, 3a7 (for daivata). putratvatasonship', 4. 2a7 (with double abstract sufix).
Page #140
--------------------------------------------------------------------------
________________ 132 THE INDIAN ANTIQUARY. [May. 1892. praguna safety,' f. 5a* (but also pragunya ibidem ; perhaps a false reading). vsiti diagram,'' a dice-board,' f. Ib4. spriha desire,'' envy,' fl. 27 (for sparha or spriha). To these words should be added all the technical names of groups of verses or throws of dice; thus: navikli 'an eulogy', f. 166 (a vernacular form of Skr. naviku, from nava; see my Gaudian Grammar, $ 195). paltabandha 'a decoration,' 'investiture,' fl. 2al. kalaviddhi 'the regulation of time,' fl. 2al, (apparently a synonym of vidhi; other wise it would mean the piercing'). oapala 'imprecation,'' abuse,' A. 2a, (a bye-form of sapa). mali 'garland,' f. 2a4 (a vernacular form of Skr, malika, cf. Prikrita Prukasa V, 21, Hemachandra III, 32, 34, and my Gaudian Grammar, $ 195). vahula 'manifoldness,' A. 2a5. kuta fa puzzle' (?), f. 261. Dhadra cow,' fl. 263. sakti power,' f. 3a2. dundubhi 'kettle-drum,' A. 3a6. vrisha 'bull,' 364 preshya 'maid-servant,' f. 8b6. vili "yellow sandal,' A. 4a3 (in the smaller Petersburg Dictionary; or perhaps for vili 'a ball'). karna 'ear,' f. 4a5. saja 'armoar' (?), f. 5a2 (perhaps for sajja). kana or kunatantra, f. 5a4 and 1. 5ad (or kanatantra fl. 5ab), one eyed,' also a crow.' chuchuna, meaning unknown, A. 561 (see below). . panchi, fl. 5b3 or panchi A. 5b4 consisting of five' (see below). khari 'she-ass,' 4. 565. As we shall see presently, all these words are technical names of certain throws of dice and of corresponding groups of verses. The meanings above given are merely the original meanings of the words, and in some cases they are doubtful: probably it matters little what the meanings were, or why the throws were so called. The main point is, that the words are names of certain throws of dice. Dundubhi is the only one among them which I have found noted in Sausktit dictionaries in that sense : in the Petersburg Dictionary it is given as "the name of certain throws in games with dice.'' The subject of the manuscript I believe to be divination or fortune-telling by means of dice. The work is a small treatise or handbook for instruction, or for the guidance of adepts, in the art of prognostication. This art is to be exercised, as the introduction of the treatise shows, with the help of dice (prasaka), of which there are three, respectively named, or probably marked, with the figures of a pitcher (kumbhaka), a discas or wheel (arin), and an elephant (mnatanga). They are thrown on a diagram or board (oritt), divided into fields, which are marked with one of the four numeral figures, 1, 2, 3, 4. There must have been twelve fields, of which three were marked with the figure 4, three with 3, three with 2, and three with 1. So far as I can make out, the order in which these fields where arranged was immaterial. Every * Panchi or panchild is at present used as the name of a game played with five-dice, and chufichult is given in the s akrit dictionaries AB game of hasard played with needs of tamarind, instead of dion,
Page #141
--------------------------------------------------------------------------
________________ MAY, 1892.) ANOTHER INSTALMENT OF THE BOWER MANUSCRIPT. 188 properly made throw of the three dice would, of course, indicate a group of three fields or of the corresponding inscribed figures. Of such groups there would necessarily be three different classes, according as the same number occarred in the group thrice or twice or once; thus the group might be 444, or 443, or 432. It follows that there would be 20 possible groaps, and that every throw of the dioe would indicate one of these 20 groups. Each of these 20 groups or throws is designated by a special name; and the list given below is that of these names. Further, within each group the numeral figures constituting it may be arranged in different ways; e. g., the group 443 admits of the three variations, 443, 344, 434. Again the group 432 admits of six variations, vix., 432, 423, 342, 243, 234, 324. In fact, every group, containing the same figure twice, admits of three, and every group containing the same figure only once, admits of six variations; while s group, containing the same figare thrice, admits only of one arrangement. Now, there are four possible groups of the latter kind (444, 333, 222, 111); but there are twelve possible groups containing the same figure twice, and four possible groups, eontaining the same figure only once. It follows that the number of possible arrangements or variations of the 20 groups is 64, (i.e., 4 x1 + 12 x 3 + 4 X 6, or 4 + 36 +24). All this is shown in the First Table below. The groups are arranged in the order in which they would naturally suggest themselves. In the second Table I have given them in the order in which they follow one another in the manuscript; and this order is also shown in the First Table, in the second column, enclosed in brackets. The bracketed numbers in the fourth column give the summations of the figures which compose the several groups. I.--Table of Groups and Variations. Classes of Groups, Serial Number of Groupa. Names of Groups Figures of Groups. No. of Total No. Total No. of Variations. of Groups. Variations. With the same figure thrice. 444 (12) 833 (9) 222 (6) 111 (3) 443 (11) 442 (10) 41 (9) eo C c O O With the same figure twice. Chantayanta (?)...... IL Navikki ............... Pattabandha ......... IV. (IV.) Kalaviddhi ............ (V.) S&pata ............. VI. (XII.) Vrisha .......... VII. (VILI.) Kata ............ VIII. (VI.) MAI ............ (XIV.) Vitf ............. (XVII.) Kana.............. XI. (XIII.) Preshya XII. (XVI.) Saja ................. XIII. (XIX.) Panicht ............. XIV. (XV.) Karna ............... XV. (XVIII.) Ohnnchuns ........ XVI. (xx.) Khart XVII. (VII.) Vabula ... XVIII. (IX.) Bhadri ............. XIX. (X.) Bakti .................. XX (XI.) Dundubht............ 15 12 36 O O O O 113 SOS O O With the same figure oroe. 432 421 () 341 321 O O Total.. ...
Page #142
--------------------------------------------------------------------------
________________ 134 THE INDIAN ANTIQUARY. [MAY, 1892. II.-Table of Order of Groups in MS. 1. 444 12 II. 333 9 III. 222 6 IV. 1113 v. 443 11 VI. 334 10 VII. 4329 30 VIII. 441 9 IX. 4217 X. 341 8 XI. 3216 30 XII. 442 10 XIII. 224 8 XIV. 3328 xv. 114 XVI. 2237 XVII. 3317 XVIII. 113 5 XIX. 221 5 XX. 1124 As already remarked, each (properly made) throw of the dice would indicate three fields, or one group of three figures ; but in most cases, it would not show what particular variation of the group was to be understood by the throw. Some mark would be needed to show in what order the figures indicated by any particular throw should be read. It is for this reason that the three dice are marked by the emblems of a pitcher, discus and elephant, and that the order of these three emblems is laid down in the introduction. The direction intended to be given in the introduction (as I take it) is that the dice should be thrown on the fields of the diagram, and then the throw read off in the order of the marks of the dice; that is, the figure indicated by the pitcber-die is to be placed first, that of the discus-die is to come second, and that of the elephant-die is to come last. With the aid of this rule, there would be no doubt as to which group and variation any particular throw indicated. The fortune-teller would first make his diagram or lay his board; he would then make a throw of his dice; from the throw he would know the group and its name, and from the order of the dice he wonld know the particular variety of the group. For every variety he would know a verse ; and the verses would suggest to him what he should prognosticate in any given case. I remember, some years ago, when I was spending my summer vacation in Darjeeling, a travelling Kashmiri (or Afghan) came to the hotel in which I was staying, and told the fortune of any one who wished to consult him by a somewbat similar procedure. I then took no particular notice of him, but I remember that he used a diagram and variously marked oblong dice, by the help of which he made his prognostications. Perhaps some who read this may be able to supplement my information, and tell us whether the same or similar practices in divination as those indicated in the Bower Manuseript are still observed anywhere in India or its northern borders. One point more may be noticed. The order of the groups in the manuscript is shown in Table II. It may be asked why the groaps should be arranged in that order in preference to the more obvious logical order shown in Table I. Perhaps there may be no better reason for it than accident; but the Table shows a carious fact which may possibly account for it. The first four groups may be regarded as the key-groups; and the total of the sams of the figares composing them gives a key-total of 30. Now, if the figures of the remaining groups are severally summed up, and the sums arranged in an order decreasing by 1, it is found that the key-total 30 is repeated four times : and in this order the manuscript arranges the groups. The arrangement, however, is not quite perfect: groap X. ought to precede group IX., and groups XVI. and XVII. ought to precede groap XV. This circumstance, though it may be due to an error of the scribe, prevents the explanation from having more than the character of a doubtful conjecture. The Nagari transcript gives the text as it stands in the manuscript, broken letters being
Page #143
--------------------------------------------------------------------------
________________ MAY, 1892.] ANOTHER INSTALMENT OF THE BOWER MANUSCRIPT. 135 printed in full. Aksharas which are wholly wanting, are indicated by dots, which are in numbers equal to the missing aksharas, Aksharas which are now wanting, but which were still extant when I first made my transcript, are enclosed within straight brackets. In the Roman transliteration, broken akaharas of the MS. text are indicated by round brackets, and entirely missing portions, by dots, or longs and shorts. Any restoration of missing text is enclosed within straight brackets. In the translation, conjectural portions or explanatory additions are indicated by round brackets. I. TEXT. Transcript. First Leaf : Reverse. 19 namo nandirudrezvarAya namo AcAryebhyaH namo IzvarAba-namo mANibhadrAya [namassavayo. 2 namaH sarvadevebhyaH zivAya namaH SaSThIye namaH prajApataye namaH rudrAya namaH namo vaizravaNAya namo marutAnAM namaH prAsa3 kA patantu imasyArthasya kAraNA hili 2 kumbhakArimAtajanyuktA patantu yatsatyaM sarvasiddhAnAM yatsatyaM sarvavAdInAM tena satyena satyasamayena naSTa vinaSTaM 4 ma lAbhAlAbha jayAjayaM zivAnudarzaya svA-satyanArAyaNe caiva devate kaSISu caiva sasvaM mantraM tissatyaM samakSA patannu svAhA satyaM caiva tu draSTavyaM ni.......... . mantrauSadhInAM ca nimittavalamamantaram sRSatAyA devataM viSNunavikAyAM caNDayANTa // D // 444 namaH puruSasiGgastha prasannaste janArdanaH 6 nihatA zacavassarve yadipsasekam navikkI 333 na te zoko na vAyAso nIcoca na ca te bhayaH Second Leaf : Obverse. 1... .......... psasi phbndhH|| 222 sarvakAmasamRddha pi pakhaM janirupadravaM utpane tataM caiva devaM zamaya te bhayam kaalviddhiH|| 111 pArehIyate se buddhiH 2........: Arambhazcintito yaste niSpala sa bhaviSyati // zApaTaH 43 vyAdhibhirmAkSyase zimaM sukhaM vA prApsyase tathA nAtyucaM nAtinIdhaM ca phalamAsArayiSyasi // vitIyazApaTa / 3.34 bhAyAso dRzyate ghoro yebhyazca tava vigrahaH niSphalaM dRzyate kArya pRcchase yasya kAraNA- tRtiiyshaapttH|| 44 samAgarma cintayase kalyANi na ca yjyte| 4 na te zarIrasantApo bhogAM caivopalapsyasi + 343 sarvArthasiddhisaMpadakAmabhogaH samAnvitaH aciraNeva kAlena bhaki vyati sa nisyAt dvitIyA mAlI-334 ayaM sapuNyo labhase 5 hyAnandaH prItivarddhanaH atvarAsumahAnarthA tvarito ye na lapsyasi // 433 ayaM tvayA mahAnacintito ryastatottamaH pravAsaM kSemagamanaM vAndhavaizca samAgamaH vahulaH 324 6 dIrghamAyurmahAnarthaH prApsase nayamuttama dhanadhAnyaM karivaM ca bhogAnavica prApsasi dvitIyo vahalaH 32 dRzyate Agama yaca svayA suparinizcitaH AtmAnaM caivArthazca sato gRhyAgamiSyasi 7 vRtIyo bahulaH 243 vahulaM dRzyate kArya vahupucavatAM ca te pratIkSAmamAtmAnaM sarvametadavApsyasi-catuyA vahula: 423 'bahulo vijayastubhyaM muSTA micagaNAca te spRhe sati parastabhya Second Leaf : Reverse. maparA spRhaviSyasi-pasamo bahala:342 snehAgamasya te cintA saMsiddhezva parA tava anyonyAbhihatA prIti-kimA ___gamiSyati gamyatA kUTa: 14 rAjatI vigraho stIti dharmAsyAti parikSaya 'labdhaM caiva phalaM tasmA dharmameva cariSyasi dvitIyo kUTaH 144 calAcalamidaM sthAnaM na mukhaM prItivarddhana vipramokSati deve tigRhIto pi na saMzayaH tRtIyaH kUTaH 441 asti kSemaM bhayaM nAsti 3 vijayo pyaca dRzyate bhokSyase kAmacAMgAca kutazcinAsti te bhavam bhadrA-421 parikSINAyanarthAsve muktaste sarva kilviSA vijeSyasi ka sabbA lAbhaste samupasthitaH
Page #144
--------------------------------------------------------------------------
________________ 136 THE INDIAN ANTIQUARY. [MAY, 1892. 4 ditIyA bhanA-214 manasA cintAviparasya tu kAraNA kizcitkAlamuvIkSasta tato hastamupaiyati-hatIvA bhdraa-|| 142 B.vi. syasi kanyAM ve Third Leaf : Obverse. 1.cacanunaviSyasi prItisaubhAgyasaMyuktaM dhanaM dAsyanti devatAH caturthA bhadrA 241 vRttivanAmayassayoM devatebhyo na ke bhayam yathA kurvasi kurvANA 2.....Asyasi-412 // zaktI 341 paripahaM cintayase taca zIghramavApsyasi-arthakAmapradAtAra bAndharva prItidarzanaM dvitIyA shktii-|| 134 3 . . gama cintayase taba zIghra sameSyati-ammIne. kRtAlekhA navyA na bhaviSyati tRtIyA zakI 115 upasthita viziSTaste tathA lAbhazca +dRzyate kuTuMve cAtulavRddhirbhaviSyati na saMzavA-caturthA zaktI 314 ekacchA mahIM kRtsnA rAjA nihatakaNTakaH Akramya bhokSyase zacuM gaNessamuditassadA 5 paJcamI zakti-143 na cecchasi samicaM tvaM sumice rAmyase saza-kRtAkRtAca te micA zatvaM yAsyakAraNaM / / 6 SaSThI zakti 31 samAnamaM cintayase sarvathA sa sameSyasi kAle prApsyase so rthaH anivedaM tathaiva ca dundubhI 121 _ yatte naSTaM vinaSTaM vAM corerapahataM ca yat 7 parahastagataM vApi na cirAttavApsyasi-dvitIyA dundubhI 213 vimuktastvaM sahAyestu sumice saha vartase labdhabbAtha priyA parthA viruddhaM devatai spahA / / Third Leaf: Reverse. 1. . yadundubhI 132 paritoSaH zarIrasya dRzyate tava sAmpratam devatAnAM ca pUjAyAH nittiApalabhyate-caturthI kundubhI 231 bhasti se kalahaM ghoraM cubhissaha dRzyate na taca lavsthase ke pradhi ca vijeNyasi-paMcamI dundubhii-||312 uttamo dRzyate sambhaH pucajanma tathaiva ca-IpsitAMcaiva kAmAM 3 prApsvase nAca saMzayaH SaSThI dundubhI 123 paribhramati buddhiste sthAnaM caiva calAcalaM mAsamAcamuvIkSasva tataH sukhamavA psyasi4 prathamo vRpaH yattavAsti gRhe kici gAvo dhAnyaM dhana tathA visavyastvaM dvijAtivaH vRddhiste samupasthitA5, . . . 244 samAgamaM cintayase dUrastha caiva te pivaH samRddhaM sarvakAmeSu na cireNa sameSyati batIyo papaH 6 . . . . dhana prApasyase ghoraM puna sthAnaM ca prApsyasi bhaviSyAta phalaM caiva nirvRtizca bhaviSyati-prathamA preSyA Fourth Leaf : Obverse. 1. . . . . . . . tavA vA viyAM vA yadi vAcase gRhaiva niratastiSTha saya hi tava niSphalaM vittIyA pressyaa-|| 252 bastvayA cintito yarthaH 2 . . . . . . ta hi na pUrayati tatkarma yasya pRcchasi karaNe-tRtIyA preSayA-242 va tvayA cintitA vAcA taparthasva kAraNA vidhyatyarthalambhaste 3... pAca saMzayaH prathamA kTiI-152 sAtatvaM tvanirAkAsaH karmaNyazcApi jIkteina tvaM prApsyate dukavaM prava. vibhizca vijeSvasi-hiMtIbA viDI4 325 na yujyase phalArthena nivedana ca yujyase bhanyaca tvarito gaccha lapsyase sukhamuttamamtRtIyA viTI 233 dRzyate te abhiprAyo vipadakAraNA sameSyati te tatvena marutasya vaco yathA-prathamakarNaH 114 saMpUjya 6 sarvakarmANi saubhAgya nirupadravaM rAjalambhasta lapsvasena cirASika bhaviSyati ritIyaH karNaH 141 vaindharveNa paribhraSTA samaprazcApi . si Fifth Leaf : Obverse. ........... ....vitIyaH karNaH 41. bhaDAna gamanaM cintA puskhena ca samAgamaH sApazeSaNa kANa
Page #145
--------------------------------------------------------------------------
________________ MAY, 1892.] ANOTHER INSTALMENT OF THE BOWER MANUSCRIPT. 137 2 . . . . na saMzayaH prathamA sajA-322 vijeSyasi RpUM savA pratyArthI valavAMzca te lapsyase prathama sthAna pazcAccho kamavApsyAsa3 dvitIyA sajA-232 na ca jAnISe kAryANi pazcAttapena yujyase bhaviSyati ca te lAbha sumukhastava devatA-dvitIyA sajA4 223 zarIre tava sandeha samatIto durAsadaH devatAnAM prasAdena prAguNyaM tava kevalam prathamaH kANa 331 prAguNante zarIrasya 5 lAbhazcAryazca prAptaye upasthitaM ca te kalyANaM marutasya vacI yathA-dvitIyaH kANaH tantra 313 ArogyaM pulAMbhaM ca prekSyase nAca saMzayaH lapsyase sarvathA bhadra 6 bhogAMzca vipulAM tathA tRtIyaH kaNatantraH 133 miSyA vadasi yatkicci micaM dviSasi nityadA devatAnAM prasAdAbA tiSThata zreyo bhaviSyati - Fifth Leaf : Reverse. 1 prathamacakSuNaH 311 bhogAnAM viprayogaste na cireNaiva dRzyate anyaM saMprApsyase sthAnaM mA viSAda. kariSyasi-dvitI yacakSuNaH 131 arthasiddhiya caiva 2 kalasthAnaM tathaiva ca prApsyase sarvakAmAMzca marutasya vaco yathA-tRtIyacakSuNaH 113 vipramuktastvamaya yo micaizca suhadeva ca utthAnaM cintayAnastha 3 udvima iva dRzyate-prathamA pAcI 221 calAca . . daM sthAnaM dRzyate samAkulaM naca nArambhase kArya dukavena ca vimucyase-dvitIyA paccI-122 4 dizaH sarvA samArakAmtA kAladharma kuruSvatI sukhaM te na kAryante te na teSu kadAcanaH [hatIvA paccI)-212 pazu bandhAzca yajJAM vai vividhAnyakSase tathA 5. . jica samRddhAne dAsyase nAca saMzayaH tRtIyaH paJcI 212 prathamA kharI 112 atikrAntA pariklezA dukkhaM caiva samAnataHhAbhAzubhAdviprabhuko si lAbhaste sa6 mupsthit-|| II. Transliteration. First Leaf : Reverse. 1 Om Namo Nandi-rudr-esvariya - namo Achiryebhyah namo tsvariyn - namd Mani(bhad)r(Aya) [namas=sarvva-Yakshebhyab] 2 namali sarv va-De vebhyah "Sivaya namah Shashthiye namah Praja pataye namah Rudraya namah namo Vaisravanaya namo Narutanam namah prasa3 ka patantu imasy-Arthasya karane hili 2 kumbhak-ari-matanga-yukta patantu yat=satyam sarvva-Siddhanam yat=satyam Sarvva-vadinam tena satyena Batya-samayena nashtam vinashtam 4 [ksb]e(m)-ak[sh]emim labh-alabham jay-lijayam Siv=Anudarsaya svir -Satya narayane ch-aiva devate Rishishu ch=aiva satyam mantram vsitis satyam samaksha Patantu svaha satyam ch-aiva tu drashtavyan ni5 .......... mantr-aushadhini cha nimitta-valam-am-antaram(r) mrisha_tayam devatam Vishnu navik lyam chantayinta | 444 Namah purusha-singhasya prasannas=te Janarddanal 0] 6 nihata sattravas-sarvve yadi psase kamno [11] Navikki 333 Na te soko na viyese nich-ochcham na cha te bhayah [0] 1 2 * The bracketed portion is crossed ont in the original. * Read valam-antaran; am is superfluous. Read audha. * Reading of the fourth pada is corrupt.
Page #146
--------------------------------------------------------------------------
________________ 138 THE INDIAN ANTIQUARY. (MAY, 1892. Second Leaf : Obrerse. 1 .... - -.1.... (pra)psasi [11] Patta-bandhah || 222 Sarvva-kama samriddhe pi sukharn janir=upadravam [1] utpanne tatam ch=aiva devari 3 snmaya te bhayam [11] Kala-viddhih 11 111 Parihiyate te buddbih 4 2 ........ (0) Ararbhas-chintito yas=te nishpalali sa bhavishyati [11] Sa patah 443 Vyadhibhir=m=mokshyase kshipram sokham va prapsyase 5 tatha ) n=ity-uchcham n=kti-nicham cha phalamrasadayishyasi - II Dvitiya-sa pata 11 3 [4](34) Ayaso drisyate ghoro yebhyas-cha tava vigrahah [V nishphalan 6 dpisyate karyam prichchhase yasya karana - | Tritiya-sapatah 11 344 Samagamam chintayase kalyanis na cha yuchyate [] 4 na te sarira-santapo bhogan ch=aiv=opalapsyasi + 1113 343 Saryv-artha siddhi-sampada-kama-bhogah sam-anvitah [] achiren=aiva kalena bha- 8 vishyati sa nityat15 (1) Dvitiya mali - || 334 Ayam sa-pungo labhase 9 5 hyvinandab priti-varddhanah (0] atvar&t=su-mahan-arth416 tvarito vai na 10 lapsyasi - 1117 433 Ayam tvaya mahan=arthas-chintitorthasutatot. tamah [0] pravasam ksheraa-gamanam vandhavais=cha samagamah [11] Vahalah 324 6 Dirggham=ayur=m=mahan=arthah prapsase n-ayam-attama [1] dhana-dhanyam 11 karittram cha bhoganavi cha prapsasile [11] Dvitiye vahulah 432 Driayate Agam(6] yattra tvaye sa-parini chitah [] Atmanam ch=aiv=a 12 rthas=cha 20 tato gpihy=igamisbyasi [lt] 7 Tritiye vahulah 243 Vahulam drisyate kiryam vahu-puttratvatam cha te U 13 pratiksha subham=atma(n)amsar vam-etad=avapsyasi21-[11] Chaturtho vahulah 423 Vahulo vijayas-tublyam tushta mittra-ganas-cba te D] 14 sprihe sati paras=t[o]buya[m] Second Leaf: Reverse. 1 na para sprihayishyasi-[11] Panchamo vahulah 342 Sneh-ingamasya te cbinta samsiddhes-cha para tava U anyony-abhihata priti - kimagamishyati 15 gamyati22 (11) Kutah 414 Rajato vigrah st-iti dharmmasy23-ati. 16 parikshaya[1] 2 labdhan ch-aiva phalam tasma dharmmam-eva charishyasi - [W] Dvitiye 17 kutah 144 Chal-achalam=idam sthanan na sukham priti-varddhanam [1] vipramokshasi deve tignibito pi na samsayah [u] Tritiyah kutah 18 441 Asti kshemam bhayan nasti 3 vijayo py=attra dnisyate ] bhokshyase kema-chamgas=cha kutas-chin=n=asti te bhayam (11) Bhadra - 421 Parikshina hyanarthis=te muktas=24te 19 sarvva-kilvisha (0) vijeshyasi ripum sarvvum labhaste samapasthitah [li] 4 Dvitiya bhadra - 214 Manasi chintita chintadipadasya tu karana ] kin. 20 chit=kalam=udikshasva tato hastam-u paishyati - [11] Tritiya bhadra - 11 142 5 [par]i[prap]syasi kanyanir vai 10 In the chird pada one syllable is wanting. Perhaps read satatanh. 11 Read nishphalah. 12 Read kalyan. 18 Here insert Mali. 1. Probably read samanvita 16 The fourth pida is short by one syllable ; read nityata. 16 Read arth8. .17 Here insert tritiya mali. 18 Read nadyam. 19 Read prapoyasi. 30 The third pada is short by one syllable. Read artha-cha. 21 The fourth pada in the original is rather indistinct, through corrections having been made in it by the original seribe. * The fourth pada has one syllable in excess. 28 Read dharmmasya. - " Read muktas.
Page #147
--------------------------------------------------------------------------
________________ MAY, 1892.) ANOTHER INSTALMENT OF THE BOWER MANUSCRIPT. 139 Third Leaf : Obrerse. 1 milttra[m] ch-anunayishyasios (0) priti-saubhagya-samyuktam dhanam dasyanti devatah (11) Chaturthabhadra 241 Vittis=cha na 26 ksbayas=sarvvo 22 deyatebhy6 na te bhayam [] yathi kurv vasi kurv van(a) 2.... [a] vapsyasi - [11] 412 | Sakti 341 Parigraham chintayase tach=cha 23 sighram=avapsyasi - [1] artha-kama-pradataram vandhavam priti-darsa nam [11] Dvitiya sakti - 11134 3 [Sama](ga)ma[m] chintayase tach-cha sighra sameshyati[0) asminai, ktita 24 lekha naeshya na bhavishyati27 [11] Tritiya sakti 413 Upasthita 25 visishtasute tatha labhas-cha 4 driayato kutumve chmtula-vriddhir-bhavishyati na samsaya28 Chaturtha sakti 314 Eka-ch-chhattram mahim kritsnam raja nilata- 26 kantakah [1] Akramya blokshyase sattrum ganais-samuditas=sada - 11 5 Panchami sakti -- 113 Na ch=echch hasi su-mittram tvari su-mittre 27 ramyase sada ( - ktit-akritas-cha te mittra satrutvam yatty-akaranam - 11 6 Shashthi sakti 431 Samagamam chintayase sarv vamtha30 sa sameshyasi 8 kal@33 pransyase so rthah anirvvedam tnth-aiva cha [91] Dundubhi 321 Yat=te nasltan vinasham va chorair=apahritan cha yat [1] 2: 7 (para-ha)sta-gatai vrapi na chirat-tad=avapsyasi - [1] Dvitiya dundubhi 213 Vimuktasrtram sahiyeg33-ta sa-mittrai saba varttase O lab30 dhavyasacha priya hy=artha viruddham devatai spriha 11 Third Leaf : Reverse. 1 [Triti]y[a] (dundubhi) 132 Paritoshah sarirasya dtisyate tava sampratam (0) 31 devatanam cha pujiyah nivsittir=upalabhyate -[11] Chaturthi dundubhi 231 Asti te kalaham ghoram 2 sattrubhis-saha drisyate (0) na tattra lapsyase klasam pratyarthiin cha rijeshyasi -- [11] Pamchami dundubhi-11 312 Uttamo drisyate lambhah 32 puttra-janmam tath=aiva cha - 0 fpsitan-s=ch=aiva kamar 3 prapayase neattrut sambayah (11) Shashthidundubhi123 Paribhramati buddhistesthanam ch-aiva chal-Achalan U masa-mattram=udikshasva 34 tatah sukhan=avapsyasi -- [11] 4 Prathamd vsisliah 442 Yat-tav=isti grihe kid-chi gavo dhanyain dhanan 35 tatha r isrijyasetra dvijatibhyah vriddhiste samupasthiti - (01) 5 [Dvitiyo vsi]sbah 244 Samagama .chintayase durastha ch=aiva te 36 priyah [0] samriddhar sarvra-ka meshu na chirona sameshyati [11] Tritiyo vpishah 6 [424 V]andhana pripsyase ghoram puna sthanam cha prapsyasi [1] 37 bhavishyati phalam ch-aiva nirvsitis cha bhavishyati - [11] Prathama preshya - Fourth Leaf: Obverse. 1 [422] . . . . . sava va vidyan va yadi yachase [] grih=aiva niratas=tishtha 38 sarvvam hi tava nishphalar (] Dvitiya preshya - H 242 Yas-tvaya 39 chintito hy=arthah * Read ch-anurayishyasi, i.e., cha anunayishyasi. * Bead upittes-cha, perhaps alao na. 11 The fourth pada is short by one syllable. The words na samayd were originally omitted, and have been inserted interlinearly. - Perhaps : ne-mitratuan. The first anusvkra is uncertain. >> Read sarvvatha, 31 Bead sameshyati; cf. verse 24. >> The third pada in short by one syllable. Read kilona, m. c. * Read sah yais.
Page #148
--------------------------------------------------------------------------
________________ 140 THE INDIAN ANTIQUARY. [MAY, 1892. 2 ...... ta hi [1] na prayati tat-karmmar yasya prichchbasi karand34 [11] Tritiya preshya - 224 888 traga chintita vacha tad-arthasya tu 40 karana (0) vishyaty=artha-lambhaste 3 ... n-ittra samsayah (1) Prathama vitt - 332 Satatvam tva[n] ni(r)ayasah 41 karmmanyas-ch=&pi7 jivite ( na tvan prapeyase dakkham praty arthibhis-cha vijeshyasi38 - (11] Dvitiya viti - 4 323 Na yajyase phal-arthena nirvvedena cha yajyase [] anyattra tvarito 42 gachchha lapsy ase sukham-uttamam - [11] 5 Tritiya viti 233 Dsibyate te abhiprayo dvipada[s](ya) [t](a) karaga (1) 43 sameshyati te tatvinas maratasya vacho yatha - [11] Prathama-karnnah 114 Sampdjys 6 sarvva-karmani saubhagya-nirnpadrava 0 raja-lambhasta lapsyase na chirad-iha bhavishyatiso [11] Dvitiyah kargnah 141 Aisvaryega pari. 45 bhrashta samagras-ch=pi - si cha [1] Fifth Leaf: Obverse. 1 ..... .....ch ..v . sh. [W] [D]y[i](tt)yah karnah 41[1] 46 Addhvan(at) gamanam chinta dukkhena cha samagamah [] s-avaiesben karyena 2.... na sambayah [11] Prathama saja322 Vijeshyasi ripam sarvva 47 pratyarthi valavam=s=cba te lo lapeyas& prathamam sthanam paschach chhokam-avapeyasi-- [11] 3 Dvittya saja 232 Na cha janisha karyani paschattapena yajyase (1) 48 bhavishyati cha talabha" su-mukhas-tava devata - [11] Dvitiya*6 saja 4 223 Sarira tava sandeba samatito dur-sadah (1) devatanan p rasad na 49 pragunyam tava kevalam [11] Prathamah kana 331 Pragunan=te 50 sarirasya 5 labhas-ch=arthas-cha praptayd Ol] upasthita cha to kalyanam (maruta)aya vacho yatha - (0) Dvitiyah kanah tantra 313 Arogyam pol-am- 51 bham cha 6 prekshyase n=kttra sansayah [0] lapsyase sarvvatha bhadran 6 bhogem-s-cha vipular tatha (1 Tsitiyah kana-tantrah 133 Mishya vadasi 52 yatekid chi mittram dvishasi nityadh O devatana m prasad&d=va tishthata srey8 bhavishyati"7 - 11] Fifth Leaf : Reverse. 1 Prathamas-cburichunah 311 Bhoganam viprayogasete na chiren=aiva dpisyate [] 53 anyam samprapsyase sthanam me vishadan karishyasi - [6] Dvitiyas= chuchunah 131 Arthasiddhi[r]-d-dvaya[m] ch=(ai)va 54 2 kula-sthinam tath-aiva cha 0 pra psyase sarv va-kamam=swcha maratasya vacho yath-[n) Tritiyase-chuchuoah 113 Vipramuktas-tvatarthe. 55 bhyd mittrais-cha suhrid-eva cha m utthanam chintayanasya # Read kdrand, or perhaps karana. >> Read y. * Perhape read statyan or satatan. 97 Api is added interlinearly. * The scanning is here irregular, the third pAda is too short and the fourth pada is too long by one syllable. Moreover, the sense of the fourth pada requires prathyartith cha; of. verse 32. * Read tattuena; the reading of ti te is not quite clear. The fourth pada has one syllable in exoon, * The last two syllables (si cha) are added below the line. Read Tritiyak 43 Pratyeshyasi may be supplied. The syllable bha is inserted below the line. 45 Read trilly 4. # The first pada is short by one syllable ; read vipullo; or perhaps puna labhanh. The fourth pada has one syllable in ex0e88. Read tishtha. Originally writton tritiyaf, afterwards corrected to tritiyaf.
Page #149
--------------------------------------------------------------------------
________________ MAY, 1892.] ANOTHER INSTALMENT OF THE BOWER MANUSCRIPT. 3 udvigna iva drisyate-[11] Prathama panch!-221. Chal-icha[lam-i]dam 56 sthanam driyate samakulam [1] na cha n-arambhase karyam dukkhena cha vimuchyase-[1] Dvitiya pancht-122 4 Disah sarvva samat-kranta50 kala-dharmma51 kurushva ti [1] sukham te na 57 karyamn te te na teshu kada-chana: [] Tritiya panchi53 212 Pasuvandhascha yajnam vai vividhan-yakshase tatha [1] 5 [arghyan]i cha samriddhani dasyase n-ittra samsayah [1] Tritiyah panchi 212 [1] Prathama khari 112 Atikranta pariklesa dukkham ch=aiva 59 samanatah [1] subh-asubhad-vipramukto si55 labhas-te sa 6 mupasthita II 141 TRANSLATION. First Leaf: Reverse. Om! Salutation to Nandirudresvara! Salutation to the Acharyas! Salutation to Isvara! Salutation to Manibhadra! Salutation to all Yakshas! Salutation to all Devas. To 'Siva salutation! To Shashthi salutation! To Prajapati salutation! To Rudra salutation! Salutation to Vaisravana! Salatation to the Marutas! Salutation! Let the dice fall for the purpose of the present object (i. e., of soothsaying)! Hili! Hili! Let them fall as marked by the pitcher, discus and elephant! By the truth of all the Siddhas, by the truth of all Schools, by their truth and true consensus let Siva declare what is lost and perished, peace and trouble, gain and loss, victory and defeat, svaha! By Satyanarayana, the Devata, and by the Rishis, true is the oracle, true is the diagram. Let the dice fall openly! svaha: Let the truth be seen! 58 (The efficacy of oracles and medical herbs..... is far from untruth. In praise of the Devata Vishnu.56) (Verse 1) 444: Salutation to (thee) excellent man! Janardana is well-pleased with thee. May all thy enemies be killed (if thou so desirest ?)! Second Leaf: Obverse. (Verse 2.) A Navikki: 333: Thon experiencest neither sorrow nor fatigue; nor hast thou any fear of either high or low; thou wilt receive. (Verse 3.) Even in the midst of the full enjoyment of all desires, one's happiness engenders molestation; (but) when it arises, God will ever allay thy fears. (Verse 4.) A Kalaviddhi : 111: Thy intelligence is at fault; which thou contemplatest will be fruitless. ; the undertaking (Verse 5.) (The first) Sapata: 443: Thou wilt quickly be delivered from all diseases, and thou wilt also obtain happiness; (but) the advantage which thou wilt attain, will be neither very great nor very small. * The second pada is short by one syllable. Perhaps read drisyate te. 50 Probably read samakkranta. 61 Read dharmmam. (Verse 6.) The second Sapata: 434: I see a terrible effort57 (against those) with whom thou hast a conflict, (but) the work will be fruitless on account of which thou enquirest. 52 Either read karyam te or kiryan te. The third pada is short by one syllable. 53 The italicised words are crossed out in the original. 54 Read vandham-s-cha The third pada has one syllable in excess. Omit subha and read only afubhad. The bracketed portion is mutilated in the text; and not quite intelligible to me: Of the syllables chantayanta. I can make nothing. They should represent the name of Mantra 444. 81 i.e. the throw of the dice indicates to me the effort thou art making.
Page #150
--------------------------------------------------------------------------
________________ 142 THE INDIAN ANTIQUARY. [MAY, 1892. (Verse 7.) The third sapata : 344 : Thou contemplatest a meeting, (bat) the fair-one does not join thee; thy body is heated with desire, (but) thou shalt obtain no enjoyment.58 (Verse 8.) (The first Mali): 343 : The peaceful59 enjoyment of pleasure and wealth, and the fulfilment of all desires will, in a very short tiine, be thine, and that for ever. (Verse 9.) (The second Mall): 334: This is a valuable thing to ask,60 viz., happiness that promotes good will; by patience that great object (will be attained), but if thou art impatient, thou wilt not obtain it. (Verse 10.) (The third Mall) : 433 : This is considered a great object by thee; (but) there is a much better object than that : a safe journey into foreign parts and a (safe) return to one's friends, (Verse 11.) (The first) Vahula: 324 : Long life is a great thing; thou wilt not obtain this (which is the best, (bat) thou wilt obtain wealth in money and grain, and tools, and also enjoyments. (Verse 12.) (The second) Vahula : 432: I see a place where thou hast determined to go from thence thou wilt safelyel return with thy goods. (Verse 13.) (The third) Vahula: 243: Manifold, I see, are the things thou doest in order to obtain many sons (?); (but) look forward to thy own happiness; thou wilt obtain all that. (Verse 14.) (The fourth) Vahula : 423: Manifold are thy successes, and all thy friends are ploased; while others62 envy thee; Second Leaf: Reverse. thou wilt not envy them. (Verse 15.) (The fifth) Vahula : 342: Thou expectest the return of thy friend, and thoa feelest sure of success; (bat) love is entertained reciprocally; why should be come ? thou shouldst go. (Verse 16.) The first Kata : 414: There is a quarrel with the king, and that quite ruins thy dharma; (but) thou hast obtained thy advantage; therefore thou shouldst solely attend to thy dharma. (Verse 17.) The second Kata: 144: Unsteady is this thy place, nor comfortable, nor a source of pleasure; (but) thou wilt get free of it, even if thou art held fast by a deva64: there is no doubt about it. (Verse 18.) The third Kata: 441: There is comfort; there is no fear; I see here also success; thou wilt enjoy women accomplished in the arts of love, from nowhere hast tbou anything to fear. (Verse 19.) The first Bhadra : 421: Thy evils have disappeared; thy offences are removed ; thou wilt overcome all thy enemies; thy gain is imminent. (Verse 2..) The second Bhadra: 214: In thy mind thou hast conceived a plan for the purpose of obtaining the first place : (bat) wait some time; then it will fall into thy hands. (Verse 21.) The third Bhadra : 142: Thou wilt obtain a virgin, Third Leaf : Obrerse. and wilt conciliate thy friend; the dovatas will give thee wealth together with affection and good luck. 68 The negative particle is practically misplaced ; it must be constructed with the fonrth pada. I take suma in sam-invita to be the same as samya; or it may be a misspelling for sama. 6. Labhas? I take to be the locative singular of labhasa "one who saks." 61 lit., "taking thyself and thy goods." I read arthai-cha. The third pada is short by one syllable, which may be mended by resolving the sandhi and reading ch-aiva arthaf-cha. I take paras as an adverb " on the other side," and part as the abl. sing., for pardt. Or, para may be taken as a verbal prefix with sprihayish yasi. << Para, nom. sing., scl. chinta. Perhape road div&bhi (dvebhih) by the devas.'
Page #151
--------------------------------------------------------------------------
________________ Mar. 1892.] ANOTHER INSTALMENT OF THE BOWER MANUSCRIPT. 143 (Verse 22.) The fourth Bhadra : 241: Thou sufferest no loss whatever in thy business ; thou hast no cause of fear from the devatas; as thou doest thay duties, thou wilt receive (thy desires). (Verse :-) (The fifth Bhadra :) 412.65 (Verse 23.) (The first) Sakti: 341: Thou art planning a marriage, and thou wilt soon accomplish it, and obtain an affectionate relative who will bestow on thee wealth and pleasures. (Verse 24.) 'The second Bakti : 134: Thou art planning a union, and that will soon come to pass; the order has gone forth from the Asvins,67 nor will it be anything unpleasant. (Verse 25.) The third Sakti : 413: I see that something extraordinary is at hand for thee and also a gain; in thy household also there will be an unequalled increase : there is no doubt about it. (Verse 26). The fourth Sakti: 314: As a king who has overcome all obstacles thon wilt, well farnished with troups, conquer thy enemy and constantly rule the whole earth under thy single sway. (Verse 27). The fifth Sakti: 431: Thou mayest not desire to have any friend, or thou mayest always delight in having a friend ; (but) whether thou makest or dost not make friends, enmity comes without any cause. (Verse 28.) The sixth Sakti: 431 : Thou meditatest a meeting; that will certainly come to pass; in its proper time that object will be attained, and there will be no disappointment. (Verse 29.) (The first) Dundubhi: 321c.: What thing of thine is lost or perished, or stolen by thieves, or passed into other hands, that thou wilt recover after a not very long time. . (Verse 30.) The second Dundubhi: 213: Whether thou art forsaken by friends, or whether thou art supported by friends, thou wilt obtain thy favourite objects, in spite of the envy of the devatas. Third Leaf : Reverse. (Verse 31.) The third Dundubhi: 132: I see that thou enjoyest health of body at the present time; from the worship of the devatas thou obtainest this rest. . (Vurse 32.) The fourth Dundubhi ; 231 : I see that thou last a grievous quarrel with thy enemies; (but) thou wilt suffer no harm from it, and wilt overcome thy adversary. (Verse 33.) The fifth Dundubhi : 312 : I see that thou wilt make a very good acquisition; moreover a son will be born to thee; thy wished for desires thou wilt obtain : there is no doubt about it. (Verse 34.) The sixth Dundubht: 123: Thy mind is much perplexed; thy position is unstable ; only wait one month; then thou wilt obtain happiness. (Verse 35.) The first Vrisha : 442 : Whatever there is in thy house, cattle, grain and money, thou shouldst distribute amoag the Brahmans; thy advancement is (then) near at hand. (Verse 36.) The second Vrisha : 244 : Thou art planning & meeting, and thy beloved is far away ; (but) the fulfilment of all thy desires will come to pass in a not very long time. (Verse 37.) The third Vrisha : 424 : Thou wilt suffer grievous bondage, but thou wilt regain thy place; thou wilt bave thy reward and wilt also have peace. (Verse 38.) The first Presbya : This verse, being Mantra 412, is wanting in the MS. 66 Parhaps parigraha may be intended to be more general: "possossion of things.' 67 Aiminai I take to be intended for 4svinai, the lost akshara may be supplied by reading either afvin-aiva (i.6., avini dua or a fvinair-akrita. As the Asvins are always two, probably the latter reading is oorreot, though an unusual formation. The Abving are givors of luck. L'kh refers to the writing of a man's fato on his skull.
Page #152
--------------------------------------------------------------------------
________________ 144 THE INDIAN ANTIQUARY. [MAY, 1892. Fourth Leaf : Obverse. 422 : If thou desirest knowledge or ......, (but) sittest idly at home, thou wilt be altogether unsuccessful ! (Verse 39.) The second Proshy& : 242 : The thing that thou hast thought of, ......... ., it will not accomplish that business with regard to which thou enquirest. (Verse 40.) The third Preshya : 224 : The speech which thou hast meditated for the sake of that thing, it will bring to pass the acquisition of the thing for thee : there is no doubt about it. (Verse 41.) The first Viti: 332 : Thou hast never to take any trouble, and art clever in thy business; thou wilt not suffer any misfortune, and wilt overcome thy adversaries. (Verse 42.) The second Viti : 323 : Thou wilt not meet the object of thy advantage, and wilt meet with disappointment; (but) go quickly to another place, (and) thou wilt obtain very great happiness, (Verse 43.) The third Viti: 233 : I see thy purpose; it is with reference to some biped (inan?); it will come to pass for thee as surely as the edict of the deity. (Verso 44.) The first Karna : 114: Thon wilt be honoured with all ceremonies; and yood fortune, peace and the requisites of a king thou wilt obtain ; it will take place after a not very long time. (Verse 45.) The second Karna: 141; By the act of God it has been destroyed, and thy whole property ........... Fifth Leaf: Obverse. (Verse 46.) The third Karna : 411: Thou meditatest going on a journey, but thou wilt meet with misfortune; (thou wilt return) with thy business unfinished : there is no doubt about it. (Verse 47.) The first Saja: 322: Thou wilt defeat all thy enemies, but thou hast (one powerful adversary; thou wilt first meet with suceess, (bat) afterwards thou wilt suffer sorrow. (Verse 48.) The second Saja : 232: Thou dost not understand business, and thou wilt suffer regret; but there will be a gain to thee, for thy devata is favourable. (Verse 49.) The third Saja : 223: A most serious danger of thy life has passed away; thy safety is solely due to the favour of the devatas. (Verse 50.) The first Kana : 331: The safety of thy person, profit and wealth are within thy grasp, and prosperity is at hand as sure as the word of God. (Verse 51.) The second Kana Tantra : 313: Thou expectest health and abundant power : there is no doubt about it; thou wilt certainly obtain prosperity, and abundant pleasures also. (Verse 52.) The third Kana-Tantra : 133: Thou speakest the untruth sometimes, and thou showest always ill-will to thy friend; but wait, and by the favour of the devatas there will be prosperity. Fifth Leaf : Reverse. (Verse 53.) The first Ohunohuna : 311 : I see that after a not very long time thou wilt be deprived of thy pleasures; (but) thou wilt obtain another suitable place; do not give way to despondency (Verse 54.) The second Chuchuna : 131 : Wealth and perfection : these two, and also family and rank, and all thy (other) desires thou wilt obtain, as surely as the word of God. (Verse 55.) The third Ohunohuns : 113: Thou art deprived of thy money and (forsaken) by thy friends and well-wishers; it appears to me as if thon wert troubled in thy mind about relief.
Page #153
--------------------------------------------------------------------------
________________ MAY, 1892.] THE INSCRIPTIONS OF PIYADASI. 145 (Verse 56.) The first Panoht : 221 : I see that thy position is unsafe and troubled; never mind I thou shouldet undertake some business, and thou shalt be delivered from thy misfortune. (Verse 57.) The second panohi : 122 : All regions are attacked alike; observe thou a seasonable line of conduct; otherwise thou wilt not have either happiness or business in them at any time.68 (Verse 58.) The third Panohi : 212 : Animal sacrifices and many other sacrifices thou wilt sacrifice; and complete oblations thou wilt give : there is no doubt about it. (Verse 59.) Thy first Khari: 112 : Thy troubles have passed away and thy misfortune likewise, thou art delivered from thy unlucky star; thy prosperity is at hand. THE INSCRIPTIONS OF PIYADASI. BY E. SENART, MEMBRE DE L'INSTITUT DE FRANCE. Translated by G. A. Grierson, B.C.S., and revised by the Author. (Continued from page 106.) CHAPTER IV. (continued). THE AUTHOR AND THE LANGUAGE OF THE INSCRIPTIONS. PART II. - THE LANGUAGE (CONTINUED). II. - THE GENERAL CHARACTER OF THE LANGUAGE; ITS HISTORICAL POSITION We have now passed in review the majority of the grammatical phenomena which are presented by the inscriptions of Piyadasi, in their different versions. But that is not sufficient. It is on account of the light thrown by them on more general facts, that these particular data more especially claim our interest. We have now reached a stage at which we can investigate these larger problems. Two points of view at once present themselves to us, according as we consider, either directly the condition of the language of which specimens are supplied by the inscriptions, or indirectly the general question of the linguistic state of affairs at the period, to which our texts bring us back. The first problem, again, may be looked at in two 68 The reading here is corrupt; but this meaning seems to be plain. 1 In the original French edition I stated at the conclusion of this study, and I now beg to repeat it at once hero at the beginning, that I never intended, when writing these chapters, to examine under all their different aspects the vexed questions about Sanskrit and its history to which they refer. I only wished to bring to light number of facts - either directly derived from the most ancient epigraphic records or at least connected with them which to my mind are indeed highly important and which possess direct bearing upon the final settlement of these problems. While proceeding along this track, I considered it useful to advance resolutely to the ultimate conclusions to which it seemed to me to lead, without dwelling, at least for the time, on the difficulties to which they might give rise, or the conflicts with other lines of argument in which they might result or appear to result. No one, I hope, will contend that the conflict escaped me, or that I meant to dispose of the points in question before having previously settled it one way or the other. But, on this occasion, I have not undertaken a tak so vast and Ho comprehensive. On a ground so thiokly overgrown, and so imperfectly surveyed, I fanoy it may be advantageous to pash on lines of reconnoitring straight forward, in what to some may appear a rather adventurous way. It is highly desirable that those who start from other points of view, and who propose to follow more direct or moro benton paths, should not be too dogmatio, nor dispose in too summary a manner of these side-explorations. These brief remarks have a two-fold aim. For one, I wish to prevent any misconceptions, and also to check oriticisms which, - probably by my own fault, the present essay has called forth, and which I cannot find to be justified or to be based upon an adequate, faithful rendering of my views. Seoondly, they will explain why, after several years, I have allowed it to appear again in its original tenor. Buoh changes as have been made in this translation concern only minor points, they aim at nothing but doing away with expressions which were either equivocal or too absolute, so as to mislead the reader as to what I really mean. Everyone knows how easily the prooooupation of one leading idea may carry even a cautious writer to an accidental use of expressions or statements which may distort in some way his real thought, and let it appear too Affirmativo, or too exclure. hATO tried my best to obviate this danger in the present, in the main, unaltered reproduction of two
Page #154
--------------------------------------------------------------------------
________________ 146 THE INDIAN ANTIQUARY. [MAY, 1892. different ways. And, to sum up, we have to examine; (1), whether the monuments dis. closa differences of dialect in the strict sense of the word ; (2), if beside dialectic peculiarities properly so called, they do not exhibit other peouliarities based on differences in the systems of orthography; and () if it is possible to draw, from the philological facts supplied by our texts, oonclusions regarding the contemporary condition of the religious or learned, the Vedio or Sanskrit language. This would be the most logical order in which to deal with the matter, but I propose to discuss the second point first; so as to render the explanation, I hope, both clearer and shorter. About one fact there can be no doubt :-Our inscriptions do not pretend to invariably represent in their integrity the sounds of the spoken language. Proofs of this abound. The most general is that nowhere do they observe the rule of doubling homogeneous consonants. It cannot, I think, be donbted that the doubling of consonants, resulting from assimilation, e.g., tth in atthi for asti, vva in savva for sarva, &c., was really observable in pronunciation. It must have been the case no less at this epoch, than in the more recent period when it was graphically represented. Moreover, in the case of doubling a nasal, the duplication is duly marked by means of anusvara, as in dhaima; and in several words, the sporadic prolongation of the preceding vowel, as in dhama for dharma, kusali for *karshyati, vasa for varsha is only an equivalent method, largely used to the present day, of expressing a real duplication. The same procedure is followed in texts of more recent date, as at Kanhorid (No. 15), where, in a single inscription, I find dhama, pavata, sava, ddha. But this is not all. The inscriptions in Indo-Bactrian characters, whether of the time of Asoka or subsequent to him, do not distinguish graphically the long and the short vowels. This omission might be explained by the want of appropriate signs, but these signs would have been easy to create in an alphabet which has formed itself with the aid of so many conscious and learned additions. If these signs have not been added, it is certain that but small importance was attached to rendering exactly the various shades of pronunciation. The necessary signs existed in the Southern Alphabet, though neither at Khalsi, nor, I believe, at Bairat or Rupnath, were they used for the i or for the it. So far as regards Khalsi, this might be accounted for by the influence of the north-west, which manifests itself here in several phenomena; but the fact would none the less remain that this practice shows not an exact imitation of the pronunciation, but an orthographical system which, at least in some measure, neglects it. Even the versions which do distinguish the long vowels, display so many inaccuracies that they themselves bear witness to the little care which was taken in making the distinction. One of two things is evident. Either the distinction bet.veen long and short vowels survived in the current language, and the texts noted it insufficiently, or it had become lost in speech, and they endeavoured to restore it in writing. Both hypotheses would thus indicate a lax attention to the exact representation of sounds, and the second also a characteristic tendency towards a learned orthography, Other inconsistencies lead us to an analogous conclusion. The diphthong ai has disappeared in all the Prakpit dialects with which we are acquainted, and it is no less & stranger to the inscriptions of Piyadasi. Yet Girnar gives us an example: thera, Skr. sthavira, is there written thaira, and in one passage trayodasa is spelt traidaca. Can we believe that the diphthong, lost elsewhere, has survived in these two unique instances ? Must we not clearly recognize here a half-learned orthography, inspired by the memory of the etymological origin ? * Unless otherwise stated, I cite the care inscriptions by the numbers of the Archwological Survey of Western India, Vols. IV. and Y.
Page #155
--------------------------------------------------------------------------
________________ MAY, 1892.) THE INSCRIPTIONS OF PIYADASI. 147 It is a universal rule in the Praksit, both in the dialects of the inscriptions and in the literary languages, that before anusvara a long vowel becomes short. In four or five instances, however, the long vowel of Sanskrit is retained : yatan (VIII, 1), susrusatan (X, 2), anuvidhiyatam (ibid.), samacheran (XIII, 7) at Girnar. It is plain that we have here purely and simply an orthography influenced by the learned language. These last instances are mere accidents, but they enable us to judge better regarding those in which variations of orthography more nearly balance each other. In a certain number of consonantal groups composed of a mute and an t, instead of the disappearance of the r, compensated for by the doubling of the mute, we find at Girnar the etymological spelling, pra, tra, sra, rva, instead of pa (ppa), ta (tta), sa (sea), va (vva). This spelling is by no means fixed, -as may be seen from a reference to the text of any single edict, and it would be of little interest to quote here all the instances, one by one. It will be sufficient to state that we have the spelling pra about 45 times, as against the spelling pa 25 times : for tra, 30 times ta, 20 times tra: for rua, rva and va each about an equal number of times : for bra, once bra, against 6 or 7 times ba: once sra (for rsa, raa), against once sa. Is it possible to contend that such an indifference represents the real spontaneous condition of the popular idiom, and that pronunciations corresponding to such different stages of phonetic decay, and that side by side in the same words, belonged actually to the same period of the normal development of the language ? If it were possible to have any doubts on the point, it would be sufficient to refer to later facts in the linguistic history. When we read, in Hindi, priya beside piya, putra beside puta, brahmana beside bamhana, we have no hesitation. We know that the first of each of these pairs is an instance of learned orthography: that it is only a tatsama, that is to say, a word borrowed direct from Sanskrit, and restored to the current of the language. When in an inscription of the 24th year of Vasithiputa Pulamayi (Karli No. 22, A. S.), we meet side by side the spellings puttasya, sovasakasya, vathavasya, and budharakhitasa, upasakasa, praja, parigahe, we are confident that these genitives in asya, this spelling of praja, cannot, at such a period, have represented the true pronunciation of the people; that there also they are tatsamas. How can we avoid drawing the same conclusion from facts which, although more ancient, are none the less strictly analogous ? It is therefore certain that these sanskritized forms do not represent the actual stage of the contemporary phonetic decay. One point, however, appears to be open to some doubt. The tatsamas of the modern languages actually enter into circulation, and that with either the ancient pronunciation, or with an approach to it. They are words of special origin, but at the same time real words of the current speech. The tatsamas of Mixed Sanskrit are, on the other hand, purely orthographical, for they belong to a purely literary language. That is to say while, in the modern tongues, the loans from the ancient language only deal with bases, and consequently have no effect on the grammar, in the Sanskrit of the Gathas, the imitations extend even to the inflexions, i. e. to elements which would escape any arbitrary action of the learned in a really living language. In which of these two categories are we to class the tatsamas of Piyadasi? We must, I think, consider them in the same light as those of the dialect of the Gathas, and recognise them as 'orthographic' tatsamas, The examples given above show that little heed was paid to accurately representing the pronunciation and that the etymological form was readily adopted in cases in which the vulgar pronunciation must have been markedly different That is in itself a strong reason, but we shall see, besides, that the classical language had not yet been so developed into practical application at this epoch as to allow us to assume that it could have penetrated into the stream of popnlar ase. Moreover, in the different versions of the texts, the proportion of these tatsamas is very unequal. If it were a case of forms readopted into current spoech, such an inequality would be surprising; it is more easily explained by a I shall refer to the dialect of the Gathus or Mixed Sanskrit in the following chapter.
Page #156
--------------------------------------------------------------------------
________________ 148 THE INDIAN ANTIQUARY. [WAY, 1892. local predominance of a special orthographical system, or rather of special orthographical tendencies. The observations which still remain for me to make are of a kind to add further proof to these conclusions. The orthography of Kapur di Giri, as in Sanskrit, distinguishes the three sibilants, 8, 6, sh, Is it really the caso that the dialect of this region retained a distinction which, if we are to judge from the parallel versions, was lost everywhere else? It is sufficient to record the irregularities accumulated in the distribution of these sibilants, to convince the reader that nothing of the sort occurred. We read e instead of sh in manuka (II, 4; 5) beside manusha (XIII, 6), and in the futures which are formed in sati for shyati. We have s'for sh in yesu (XIII, 4), arabhiyisu (1, 2), beside mikramishu, &c., in abhisita, which is never written abhishita ; and for sin anusichano (XIII, 2); sumachariya (XIII, 8), ssta (1, 2): sh for sin pashshashu (ILI, 6), shashni (XIII, 8); < for sin anusasana (IV, 10), antiabisciati (ibid.). It cannot be imagined that this confusion may be referred to the real usage of the local dialeet. It can only be accounted for by one theory, the only one which explains analogous mistakes, whether in manuscripts or in more modern Sashkpit inscriptions. The error of the engraver or of the scribe arises in both cases from the fact that he has before him a learned spelling, in the application of which he cannot be guided by the usage of the current dialect, because the distinctions he has to deal with are strangers to it. The locative pashshashu, '& clamsy imitation of locatives in eshu, is very characteristic as illastrating the way in which the sibilants were used at Kapur di Giri. The fact mast not be lost sight of that this method of writing is not an isolated example ; it is borne witness to by other parallel ones, which leave us in no doubt as to what conclusions we are to draw from it. It is certain that the distinction between the sibilants did not exist in the dialect of the western coast; yet that does not prevent as finding all three at Nasik (Nos. 1 & 2, A. 8. iv, 114), in dedications, which in every other respect are couched in pure Prakrit, not even in mixed Sanskrit. As at Kapar di Giri, a mistake, saka sa for sakasa, is there to warn as as to the trae character of this use. It is the same in No. 27 of Kanheri (A. $. v. 85), in which the pretension to learned orthography leads to such forms as dunhanaik, sarvvabatvinas. In the instances whicb we have just passed in review, we may perhaps be allowed to hesitate as to the origin of the spelling, though not as to the sound which it represents or is intended to represent; the problem becomes more thorny when we consider certain orthographical phenomena, which express accurately neither the learned form, nor the form adopted in popular usage; which can, in some respects, be considered as intermediate between these two poles of linguistic movement. Dr. Pischel has correctly pointed out that, at Kapur di Giri, the words which I have, according to precedent, transcribed as dharma, darsi, darsana, karmaye, varsha, purva, &c., are really written dhrama, draiana, &c., the r being joined to the consonant dh, d, &c. He adds that hore, as in the coin-legends which observe the same method of spelling, this writing certainly represents a dialectio peculiarity, and that the people for whom the tables of Kapur di Giri were inscribed, actually pronounced the word as dhrama, pruua, &c. At this point I am unable to agree with his daductions. He bases his argument specially on certain readings, such as mruga, equivalent to mriga, in the first ediot of Kapar di Giri, graha and dridha, equivalent to griha and dridha in the 13th, pariprickha, equivalent to pariprichchha in the 8th, vrachhe, equivalent to vriksha, in the 2nd edict of Girnar. He compares the forms ru, ri, ra, taken by the vowel 'pi in several modern dialects. * Gotting. Gel. Anteigen, 1881, p. 1916.
Page #157
--------------------------------------------------------------------------
________________ THE INSCRIPTIONS OF PIYADASI. MAY, 1892.] that I think that this comparison, unless I am much mistaken, goes directly contrary to his conclusion. Modern forms like graha, grika, mraga, mranga, mriga, by the side of which we also find others such as mirga, &c., are in no way direct derivatives of the Sanskrit. mriga, but are tateamas; that is, nothing but simple equivalents of the form mriga, griha, which itself is also used in the modern languages. They are only instances of such approximate spelling as could be realized with the elements really existing in the popular language, instead of borrowing from the learned language a special sign, corresponding to a special pronunciation which has ceased to exist for more than two thousand years. In both cases, the situation is not only analogous, but is identical. I offer for both, one and the same explanation, which is incontestable for the more recent one: in mruga, graha, dridha, vrachha of the inscriptions, I can see, as in mriga, graha, dradha, vraksha or crackha of existing languages, only tatsumas, loans really taken from the learned language, but represented by an orthography which, by the absence (whether voluntary or not is of little importance at the present stage of the inquiry) of the sign for the vowel ri, was condemned to tentative and approximative devices. These examples in no way argue against my method of treating the groups dhr, pr, &c., in the words which I have quoted. On the contrary, they present certain precedents of a return towards the learned language, operating even at the price of imperfect orthographical expedients. It is exactly in the same light that we must consider the spellings which now occupy us. 149 In the first place, the state of affairs at Kapur di Giri, so far as concerns consonantal compounds including an r, strongly resembles that which we have established for Girnar. We find there pati beside prati (also prati and patri), save, savatra, by the side of sarve, sarvan, sarvatra, &c. Without attempting to compile exact statistics, the fact is, in a general way, indisputable. It is natural to deduce from it the same conclusions as those to which we have come with regard to Girnar. We must not, therefore, treat the orthographical peculiarities of this language with absolute rigour. If the r in the words which we are discussing, is taken from the learned language by an arbitrary artifice of writing, why should we be astonished that the writers should have allowed themselves some liberty in the manner of representing it, when they have just as often taken the liberty of omitting it altogether? In Hindi the spellings dharama, karama, gandhrava, in no way correspond to any peculiar phonetic phenomena, but are merely equivalent modes of writing the tatsamas dharma, karma, gandharva. Mr. Beames (Compar. Gram. I, 321) has quoted in the ancient Hindi of Chand, spellings such as erabba (= sarva), dhramma (= dharma), sovranna (suvarga), brana (= varna), brannana ( varnana), prabata (parvata), kramma (= karma), krana (: karna), &c. I do not think that these examples can be appealed to against the argument, which I here maintain. It is more than clear that all these spellings were, at the time of Chand, loans taken from the vocabulary of the learned language. The doubling of the consonant in irabla, kramma, &c., sufficiently proves that the true pronunciation of the people was sabba, kamma, &c. Different motives, metrical or otherwise, may have suggested these spellings, but they prove nothing as to the real pronunciation. Far from being contrary to my opinion, they supply, at a distance of some fifteen hundred years, a phenomenon, strictly comparable with that which we have shown to exist at Kapur di Giri. This resemblance of methods is explicable by the resemblance of the conditions which called them into being. In each case we have a language, which, not having as yet a regulated system of spelling, attempts, with groping and uncertainty, to approximate itself, by the simplest means available, to the practice of a language which enjoys a higher degree of reverence. If we consider the facts by themselves, would this change of dharma to dhrama, of purva to pruva, of karma to krama be likely or probable? I think not. Alongside of pruva, there is at least one passage (VI, 14), in which it seems clear that we must read purva. So also we find that coins wrote varma alongside of dhrama; that by the side of drasana at Kapur di Giri, we have, at Girnar, an example of darsana. The form which all these words have invariably taken in the popular pronunciation, dhashma, puvva, kahma, vassa or vasa, &c., depends uniformly on
Page #158
--------------------------------------------------------------------------
________________ 150 THE INDIAN ANTIQUARY. (MAY, 1892. a former pronunciation, dharma, and not dhrama, rarea and not vrasa &c. If people said arvu, why should they have said pruva ? We should doubtless be glad to discover with certainty the cause of these inconsistencies; but oor hesitation in this respect proves nothing against corclusions, which appear to me to be Hatisfactorily proved. It is no use counting all the variations in the mode of writing : by the side of sarva, we frequently have sava; mita beside mitra, puta beside putra, &c., &c.; we find written Icirti, and vadhati, vadhita, &c. It is not surprising that, in an orthography which is the arbitrary imitation of a learned pronunciation, a certain approximation should have appeared sufficient. The example of Girnar proves that we must not take the phonetic value of the signs too strictly. It is clear that in d and in the same character 6 signifies at one time, vra, and at another time rra. Reasons of graphic convenience may have had their share of influence. A cursive sign for r following a consonant bad been fixed at this epoch but they had not fixed one for an r preceding one. It is easy to prove this in the more recent inscriptions. Tiney retained the first sign, and invented a new one for the second case (of. the inscription of Sue Vihar.) The direct combination of the characters and 7, 4 and was sufficiently easy and symmetrical, but the combination of with u; 3 &c., being more complicated, gave greater opportunities for confusion. Without doubt such a consideration can only have been a secondary one, but the special conditions under which, as I have pointed out. this spelling was applied with its etymologioal tendency, are precisely such as to make its action admissible. They rendered much less urgent both the invention of a new sign, and the use of compound letters which might be awkward to engrave. We are thus led to recognise in certain cases a graphic method, which not only does not faithfully represent the real pronunciation, but which in endeavouring to approximate itself to etymological writing, treats it with a certain amount of freedom. This forms a very useful basis from which to judge, what is, in my opinion, a more difficult case. I refer to the groups kod, and at Girnar, regarding which I regret to find that my conclusions did not meet with the concurrence of Dr. Pischel. This difference of opinion renders it necessary for me to completo the observations outlined on pages 20 and 29 of the Introduction to Vol. I. of the original work. It is quite clear, as Dr. Pischel allows, that the appearance of the group & will not help us to decide between the transcription pta, and the transcription tpa. Every one agrees in reading & 8! and ck st. The exact position of the sign is therefore irrelevant. All the more bas the question embarrassed the various commentators, and they have successively proposed various readings. The arguments invoked in favour of pta are far from convincing me. I cannot admit that the form appa for atman presupposed an intermediate apta. The group pt regularly gives tt in Prakpit, as in gutta. It is to which gives pp, as in uppala. Now apa is the very form which the most modern inscriptions of the west, near Girnar, regularly give us for atman, and I do not think that any one would suggest a pronunciation apta as necessarily intermediate between atma and atta. It is in the same way that chattaro is derived directly from chatcaro, like satta from satva, and atta from atva for atma. If, under the influence of 1, the v of atva can have become a p, the same phenomenon is equally explicable in chatparo for chatvary, and arabhitpa for drabhitva. For example rya. We catch, I think, this new notation in course of formation in instances such as the Bigo 4. rkhe (arkheviyasa) of the coins of Archebios (cf. Sullet, Die Nachf. Alexanders, p. 113). Note by translator. The following extracts from the statistical portion of this chapter, previously published, see ante, pp. 3 and 10. will assist the reader in following the argument. GIRNAR.--em becomes tp in upas, XII,3,4,5,6. tv becomes to alichapi, XIV, 6: Grabhitpa, I, 3; chatpiri, XIII. 8: darayitpa, IV, 1; hitalpa, VI, 11 ; pievit fitpd, 3, 4; tad ltpany, x, 1; it becomes t in satiyaput II, 2. KAPUR DI GIRI.--tm becomes t in ata, XII, passim. te becmest.
Page #159
--------------------------------------------------------------------------
________________ MAY, 1892.) THE INSCRIPTIONS OF PIYADASI. 151 This being said, while I uphold the transcription tpa, after Burnout and as Dr. Pischel very properly reminds me) Signor Ascoli, I admit that I can produce no decisive facts to prove that this spelling represents something different from its apparent pronunciation. Neither the use, which Dr. Kern has pointed out, of the Javanese spelling of the group tp to express simply the sound it, nor the analogous instances, have any demonstrative force. Nevertheless, the phonetic conditions which Girnar displays in other respects are not such as to lead us to believe that at this epoch, the contact of two mutes, like tp, could have been tolerated by the language without assimilation. Several traits, which would seem to prove the more archaic character of the language of Girnar, disappear if we consider them in their true light as simple graphic restorations, and it would be very improbable that a language which so invariably assimilates mutes when they are primitive, as in samata, guti, &c., should bave, at the same time, preserved their original power for groups of secondary mutes, resulting from an earlier phonetic alteration. Without, therefore, being in a position to furnish categorical proof of my opinion, I cannot refrain from being impressed with this belief that the group tp ut Girnar represents pp as its real pronunciation, the etymological origin of which is shadowed forth in the writing by an artifice, which has, so to speak, been arrested half way. As regards the groups st, st, I have the same good fortune to be in accord with Signor Ascoli, and the same regrets that I cannot agree with Dr. Pischol. I know, and I have expressly stated, that Hemachandra (IV, 290, 291) teaches in Magadhi the spellings 8! for !!a and sh! of Saitskpit, and at for sth and rth.7 Dr. Pischel draws attention to the fact that the Mrichchha. kati has forms like bhaslaka, chistadi. I do not wish to insist upon reasons which depend somewhat on individual impression; but I cannot easily believe in dialectic forms such as pusga for patta, asta for artha. They are phonetic modifications so isolated, as far as I can see, on Hindu soil, that it seems to me very difficult to admit their existence; but I recognize that such a scruple has no demonstrative force. We shall at least see from what I shall have occasion to say regarding the Prakrit of the grammarians, that they are entitled to but very weak authority as regards the exact state of the popular language, above all at the epoch with which we are now dealing ; and here, for example, the evidence of Homachandra may very well be taken as only indicating the more or less' accidental retention, the more or less arbitrary application, of an archaio spelling. At the same time it must be remembered that the facto thus quoted, agree but imperfectly with those with which it is desired to compare them. Hemachandra mentions this spelling as peculiar to Magadhi, and we are asked to recognise it again at the other end of India, in Surashtri; we do not find it anywhere in the other versions of our inscriptions, which, owing to several significant traits, the nominative in e, the substitution of 1 for r, may fairly claim relationship with Magadhi. This is not of a nature to give strength to the authority of the grammarians, at least as regards their geographical terminology * Note by translator.-As this is not printed together with the statistical portion of the ohapter which has already been given ante, pp. 3, 4 and pp. 10, 11, the following extracts from that portion will assist the reader to understand what follows. GIRNAR, - tth becomes st in ustana, VI, 9, 10. rth becomes th, as atha, passim. shtr becomes st: rastika , 5. shth becomes at: adhistana, V, 4; slate, IV, 10; niatana, IX, 6; tistants, IV, 9; tisteya, VI, 13. st is preserved : asti passim, &c. ; - it becomes of in an asti, VIII, 4, al. sth becomes at in gharastani, XII, 1; - and st in stita, VI, 4: KAPUR DI GIRI. tt becomes cerebralised into t under the influence of an t-sound, in dharmavutan, XIII, 10; nivatiya, IX, 19. tth is written both th and th in uthana, VI, 15. oth usually gives us th (a!ha, passim), but also th fatham, IX, 20; anatheshu, v, 12). shtr is written st in rastikanan, V, 12. shth is written th in sretha IV, 10;th in titha, ix, 20, adhithan, V, 13; and at in srieta, 1, 2, and tistiti, IV, 10. at remains unchanged, whether written with the special alga to'which Dr. Bahler appears to have given itu true value, or with the group st as in samstuta, IX, 19. sth becomes th: chirathitika, V, 18 grantha, XIII, 4; and also th, grahathani, XII, 1.
Page #160
--------------------------------------------------------------------------
________________ 152 THE INDIAN ANTIQUARY. (MAY, 1892. The groups which the grammarian expressly writes , with the dental. (cf. Sutra 289), the Msichchhakali, extending the use of the palatal e peculiar to Magadhi, writes all, and the verb tishtha ti, for which the spelling chishthadi is expressly enjoined by Satra 298, is written in the drama chitadi (Pischel, loc. cit.). Between the grammarian and our inscriptions there is a still wider discord : !! is no more written 8! at Girnar, than rth is written st. The mere observation of facts such as those which exist at Girnar would be sufficient to awaken our scruples. I find it difficult to believe, as Dr. Pischel has ingeniously suggested, that the absence of the aspiration in stita and sesta, are a direct inheritance from the primitive period which existed before the birth of the secondary aspiration of Vedic Sanskrit. Should we farther conclude that the word sresta at Kapur di Giri (1st edict) is also a witness of this same period, when the sibilant sh and the other cerebrals. had not as yet developed ? As for claiming the same antiquity for the Pali form affa (equivalent to arta) for artha, the uniform use of the aspirate in all our versions is far from favouring this conjecture. In any case, the Pali spelling atta being uniformly absent from all our inscriptions cannot be relied npon as a basis for the archaic origin of the I in otita. I therefore consider that I am right in doubting whether the popular pronunciation had really eliminated the aspiration, in a case in which, as everyone knows, as everyone can judge by a reference to Praksit orthography, the consonant is invariably aspirated, even when the aspiration is not original, 1.c., when Sanskrit does not write it as aspirated. Is it really to be believed that the people pronounced matuna (Girnar, VI, 9, 10), when the assimilated form utth dna is the only one used, even in the learned language and in its system of etymological spelling? If they really did pronounce stana, sita, can ustdna be considered as anything but a parely orthographical approximation to these words, guided and determined by the feeling of etymology P The forms anusasti (for anusasti, the only probable one) beside sashstuta, gharastani (instead of afani), beside stita, and at Kapur di Giri, sresta (instead of brefa) by the side of br&than (IV, 10), tistiti beside tithe and adhithana (V, 12; al.), dipista beside afha (= ashtau) are as many errors which it would be hard to explain if we considered the orthography as an actual expression of the existing pronunciation. Now, Girnar is comparatively near the tract which furnishes us numerous inscriptions for the period following. Would it not be surprising that in none of them, not even in the most ancient, at Sabchi and at Nanaghat, has a single trace of so significant a dialectic peculiarity been discovered ? What we do find is at Sancht (No. 160), the proper name dhamastkiri, while in all the analogous instances, sethin, &c., the assimilation is carried out. Again at Karli (No. 22), in a text of the time of Vasithipata San takani, we find hitasughasth[i]tay[d, beside nithito. In this instance forms such as puttasya, sovusakasya beside budharakhitasa, wpasakasa, leave no doubt as to the nature of the spelling. We have here a text couched half in Prakrit, half in mixed Sanskrit, and we know, without any hesitation, that the spelling sthiti is a tatsama, or, which comes to the same thing, an instance of learned orthography. Does not all analogy, every probability, compel us to accept the same conclusion for Girnar ? It is true that this mode of writing, at and Page #161
--------------------------------------------------------------------------
________________ MAY, 1892.) THE INSCRIPTIONS OF PIYADASI. 153 this point of view, anomalies like ustana and anususti can be easily explained. ustana is only another way of spelling ufhana. The cerebralization, for which anusasti supplies no pretext, could creep into the pronunciation of anusatthi under the influence of the analogy which it suggests with forms like sillha, anusit tha. A practice of this kind, extending even to words in which it has no etymological justification, is certainly not without example in Hindi usage. I content myself with quoting the use of the groups gr, tr in Jain Prakrit,to used to represent merely a doubled 'g or t, and that even when it is not justified by otymology, - in pograla, i. e. poggala (pudgall), as well as in udagra. Prof. Weber has not on this account dreamed of suggesting that the pronunciation ugra, wagra has been preserved, but very rightly concludes that we must everywhere read gga. The preceding remarks do not exhaust the instances in which wo are permitted to infor that the orthography of the Edicts of Piyadasi is not strictly phonetic. Other spellings deserve, from this point of view, to be noticed here. Some are significant by their very character and by their inconsistencies; others, either better preserved or altered more than the mean level of phonetic decay permits, reveal in turn either an accidental imitation of the cultivated idiom, or the contemporary existence of a popular language into which the mode of writing of our inscriptions artificially introduces a regularity unkuown in practice, In the first category is contained the use of t. This brings me again to Dr. Pischel's remarks. I must confess that I can no longer hold to the opinion, originally expressed by me, tbat the sign tat Khalsi was only another form of +. I admit that this sign, literally kya, corresponds to a special shade of pronunciation, although it does not appear to be easy to define it. The concurrence of the forms kalingya, kaliingyesu, kalingy dni, which Dr. Buhler has been the first to identify at Khalsi (XIII, 5, 6,), does not throw much light on the problem ; but to whatever conclusion we are led, it will remain none the less certain that the engravers have displayed a singular inconsistency. According to Dr. Pischel himself, beside seventeen instances in which the suffix ika is written ikya, there are seven in which the spelling ika is retained. It is very clear that one or other of these two methods of writing does not accord with the exact pronunciation. What are wo to say about the Dehli inscriptions, in which we find PS in two isolated examples, in ambavydikd and qdhakosikani (Col. Ed. VII-VIII, 2), whereas everywhere else the suflix invariably retains the form ikea ? I confess that I find some difficulty in avoiding an explanation, which, at the first glance, will appear singular and rash. In various coins of Spalngadama, of Spalirisos (Sallet, p. 154), and of Gondophares (p. 169), we find dharmiasa side by side with the ordinary form dharmikasa. On the other hand, the coins of Lysias (ibid, p: 154) have alternately lisikasa and lisiasa. The pronunciations ika and iya do not appear to have belonged to the same period of phonetic development, and it is tempting to conclude that the popular pronunciation was iya, (or ia, which is the same thing), of which ila represents the learned spelling; that, in fact, people read the latter iya, as seems to be proved by the writing lisikasa for lisiyasa. The sign t ought hence to be considered as a compromise between the real pronunciation, indicated by the y, and the tatsama orthography represented by the k. The spelling alikasadala must be explained by some play of etymology, which, in order to lend to the foreign name a Hindi appearance, seems to have sought in the first portion of the word for the Prikrit alika, aliya, correspond ing to the Sansktit alika, I do not underrate the difficulties of this solution. If it were certain, it would lend a singular confirmation to my method of considering the orthography of our inscriptions, but I recognise that it is in no way certain. I only put it forward as a conjecture, which is, in my opinion, a likely one, and I do not propose to take advantage of it elsewhere for any more general conclusions. If we neglect it, and content ourselves with a simple statement of the facts, we find at all events that, at least in this particular point, the 1. cf. Weber. Bhagavatt, pp. 387 and ff.
Page #162
--------------------------------------------------------------------------
________________ 154 THE INDIAN ANTIQUARY. (MAY, 1892. spelling of our inscriptions, not being consistent with itself, does not endeavour to accurately present the pronunciation.11 Kapur di Giri in several instances poes j and y, the one for the other: ja[w] (equivalent to yal),.,11; anija, VI, 16; samaya, I, 2; kanboya, V, 12; XIII, 9; raya, V, 11; VI, 14; jx, 18; X. 21, XI, 23 ; XIII, 1, beside raja, VIII, 17, &c. Perhaps even at Girnar we find an analogous case, if we must really really read (XI), 7) sruneju, for srundju, equivalent to sruneyu. At any rate, nayasu for niyasi, is purely sporadic, contrary to analogy, and, to all appearance, an arbitrary spelling. These exceptional spellings follow a double direction. Several bear witness to an effort to approach the etymological forms. For instance, sudvisati, against all analogy, retains its final consonant. No one can doubt that Dhauli and Jaugada represent exactly the same dialect, and the same pronunciation, and hence ekatiya at Jaugada (1, 2) and saimyapalipati (IX, 16), as compared with ekucha and summa at Dhauli, can only be taken as kinds of tatsamas. So also with forms like akusma at Dhauli. Adhigichya, equivalent to adhikriya, for adhigicha, at Bhabra, shews us an orthography which is undecided and hesitating. In other places the writing betrays by inadvertencies that the phonetic level of the spoken language has already fallen below that which is usually marked by the ruling habits of the written one. I refer to softenings like adhigichya for adhiksitya at Bhabra, libi alongside of lipi at Dehli, 18ga, logika, laheyu at Jaugada, or, inversely, to irregular hardenings such as kunbocha at Dhauli, palipatayati at Jaagada, padha at Kapur di Giri, or, again, isolated inflexions like janao at Khalsi, mahidayo at Girnar. It would not be impossible to increase the number of indications of this nature; but, neither the condition of the monuments, nor the accuracy of our facsimiles, would allow us to attain to complete statistics. I stop myself here, and proceed to sum up. 11 The translator ventures to take the liberty of appending the following note by him on this character, which originally appeared in the Acaderay for October 1890: This character has excited considerable controversy. It is admittedly & compound of the sign for k and the sign for y, and, graphically, it representa kya. In the Khelai inscription it is substituted (but by no means uniformly) for the k which we should expect in the tormination ikd; and it also oocurs in the foreign word alikyasadale. It is also found twice in the Delhi columnar inscription. All scholars agree that no completely satisfactory explanation has been given for this form. It seems to me that the following is not unreasonable. The spelling of Piyadasi's inscriptions prononte several instances of false analogy. M. Sopart has given strouw reasons for believing that when Piyadasi at Girnar wrote af, he meant to represent the sound th. It was a mistaken attempt to revive an old-fashioned spelling. The seribe knew that Sanskrit aht became th in Prakrit, and benea wrongly assumed that every Prakrit tth was derived from sht. Therefore, to shew his learning, whenever he came to th, he wrote it , even in Ossee when a represented not ahs, but sheh. I think that this skya is a similar instance of false analogy. The Magadhi Pr&krit termination ikd is liable to have its ponultimate vowel lengthened, thus, fkd. Then, by a well-known role, the can again be shortened, the Consonant following being at the same time doubled in compensation, thus, ikka. Instances of this sro aot uncommon in literature; and, judging from the modern languages of India, must have been extremely common in conversation. Prakpit examploy will be found in 6 203 of Dr. Hoornle's Gardian Grammar and I need not quote them here. As tho Khalsi and the Delhi inscriptions were written in Piyadasi's Magadhi dialect, we need not be surprised if we find this doubling occurring in them too. Now Sanskrit ikya doos become ikka in Prakrit; and I believe that the seribe, coming upon an ikka with totally different derivation of which he was ignorant, and wishing to show his learning, represented that ikka also by ikya, just as his brother at Girnar represented tth by sht, even when it had nothing whatever to do with that compound. If we assume, as sdgrosted by M. Senart, that the soribe endea youred to connect the foreign word Alikyasadala with the Sanskrit allka (an instance of a common kind of word-play in Sanskrit literature), we find an additional confirmation of my suggestion. The fin allka is long its being shortened shows that the word must have been pronounced alikker in Piyadasi's time. Accordingly, the engraver, coming upon another kk, followed his custom and wrote it kya. It will be observed that this accounts for the want of uniformity with which bya appears in Piyadasi's inscriptions. M. Senart shows that at KhAlai ikyd ooours seventeen and id seven times. At Dolhi there are only two instances of iky4, ikd being used everywhere else. So, also, in Magadhi Prekrit both the terminations ikkd and kd appear to have been concurrently and indifferently used, just as at the present day a man of Magadha will say in the same breath, chhotakd and chhotakka, tanild and tanikku, tanud and tanukka.-G. A. G.
Page #163
--------------------------------------------------------------------------
________________ MAY, 1892.] THE INSCRIPTIONS OF PIYADASI. 155 It is certain that the orthography of our inscriptions does not always exactly reflect the actual pronunciation. It is unequal to the task when it neglects to notice dooble consonants or long vowels, and it overshoots the mark when, at Girnar, it retains a long vowel, either before an usvara, or before a group of consonants. Besides this, it elsewhere gives evidence, as, for example, in the notation of the groups which contain an r, of a significant indifference in regard to phonio expressions which belong to diverse periods of the development of the language. It is, therefore, sure that this orthography, in a certain number of cases, obeyed (as we call them) learned historic influences. Like the modern languages, like the mixed Sansktit of the Gathas, it is full of words or methods of writing, which constitate so many graphic tatsamas, and which consequently form an artificial and learned elemeni. There is no ground for citing against this proposition the ignorance of the engravers. They may be responsible for certain material errors, for certain inconsistencies, but not for a system of orthography. They applied that system, it is true, but, however imperfect it may have been, it must have been founded by persons who were educated, skilled men, Even at the present day, it is evidently the learned caste that takes these loans, which, entering the popnlar language, gradually oxtend themselves to the most ignorant. In its generality, therefore, the principle appears to me to be unassailable, and those facts, which are certain, justify by themselves important conclusions as regards the light in which we should consider the language of our inscriptions. Other facts, such as those which concern the groups st, 81, tp at Girnar, allow more room for contradiction, and I only claim probability for my opinion regarding them. I have merely one more observation to add. It is specially at Girnar and at Kapur di Giri that we meet these semi-historic modes of writing. If my interpretation of them is accepted as correct, they will add seriously to the balance in favour of the conclusion to which the undisputed facts tend. This conclusion has a corollary. It implies that the differences of dialect between the popular languages, which are reflected by the various versions of our inscription, are less decided than we should at first be induced to consider them, judging from the appearance of the orthographies. If they are really separated by some characteristics, they have, in general, arrived at nearly equivalent stages of phonetic corruption. The more prominent points of difference, which attract our attention at first sight, have their origin in tendencies, more or less accidental, of word-borrowing or of modes of writing, - in the greater or less use of tatsamas. This result is in itself a priori so probable, that it might almost be invoked in favoor of the conclusions which I have endeavoured to establish. It is, assuredly, scarcely probable that, by its mere natural movement, by its spontaneous development, the same language should, in the same time, have reached, in neighbouring provinces, stages of decay so unequal as a comparison between the orthography of Girnar and, for example, that of Khalsi would suggest. The views which I have put forward explain this anomaly. For inadmissible inequalities of phonetic development they substitute the very simple notion of different orthographic systeme in parallel use in different regions. If, as everything tends to shew, the epoch to which our inscriptions belonged was still, so far as regards the art of writing in India, a period of feeling the way and of uncertainty, if it is anterior to the regalarisation or at least to the general expansion of the Sanskrit orthography and to the codification of the literary Prakrits, the parallel existence of these divergent imperfectly established systems is easily explained. I shall shortly indicate what circumstances seem to have conduced to favour their geographical distribution in the manner to which witness is borne by the evidence of our monuments. These circumstances equally concern the distribution of the dialectic differences properly so called. (To be continued.)
Page #164
--------------------------------------------------------------------------
________________ 156 THE INDIAN ANTIQUARY. [MAY, 1892. BHADRABAHU, CHANDRAGUPTA, AND SRAVANA-BELGOLA. BY J. F. FLEET, Bo.C..., M.R.A.S., C.I.E. In the first fifteen pages of the Introduction to his Inscriptions at Sravana-Belgola (published in 1889), Mr. Rice has arrived at the conclusions, that the settlement of the Jains at that place was brought about by the last of the Sruta-K&valins, BhadrabAha, and that this person died there, tended in his last moments by the Maurya king Chandragupta, - the Sandrokottos of the Greek historians, - the grandfather of Asoka. These conclusions, if they could be accepted as correct, would possess considerable interest. And it is worth while, therefore, to examine the grounds upon which they are based. It is clear that there are local traditions, of some antiquity, connecting the names Bhadrabahu and Chandragupta with Sravana-Belgola. Thus: - Of the two hills at 'Sravana-Belgola, the smaller one, Chandragiri, is said to derive its appellation from the fact that Chandragupta was the name of the first of the saints who lived and performed penance there (Introd. P, 1). On this hill there is a cave which is known as the cavo of BhadrabahusvAmin; and also a shrine which is called the Chandragupta-basti (ibid. p. 2, and map). Two inscriptions, said to be of the ninth century, found near the Gautama-kshtra of the river Kaveri at Seringapatam, speak of the hill at Sravana-Belgola as having its summit marked by the impress of the feet of Bhadrabahu and the Munipati Chandragupta (ibid. p. 2, note 6). At Sravana. Belgola itself, inscription No. 17, of about the seventh century A. D., mentions "the pair Bhadrabahu, together with the Munindra Chandragupta." And inscription No. 71, of considerably later date, refers to worship being done to the foot-prints of Bhadrabahu. So far, we stand on safe ground, in respect of the names of a Bhadrabahu and a Chandragupta ; provided that we only bear in mind that, as yet, we have nothing to enable us to identify any particular Bhadrababu and any particular Chandragupta. We turn next to insoriptions at Sravana-Belgola, which undoubtedly mention Bhadrabahu, the last of the Sruta-Kavalins. No. 40, of A.D, 1163, speaks of "Gautama" (the first of the Kevalins], "in whose line arose" Bhadrabahu, the last among the Sruta-Kavalins; his disciple was Chandragupta, whose "glory was such that his own gana of Munis was worshipped by the forest-deities :"I and then, after a break, it takes up & line of succession, placed in the lineage (anvaya) of Chandragupta, beginning with the Municv..ra Kondakanda, whose original name was Padmanandin. No. 54, of A. D. 1128, again mentions Gautama, the Sruta-Kevaline, Bhadrabahu (apparently the Sruta-Kevalin of that name), and Chandragupta, "who, by being his disciple, acquired such merit as to be served for a long time by the forest-deities;" and then, like the preceding, after a break, it takes up the succession beginning with Kondakunda. No. 105, of A. D. 1398, dealing similarly with the succession from Kondakunda, enumerates, before him, a number of teachers, in respect of whom, for present purposes, it is only necessary to say that the Kevalin Gantama, and five Sruta-Kevalins, ending with Bhadrabahy, are mentioned, but the name of Chandragapta does not occur at all. And No. 108, of A. D. 1433, mentions Gautama; in his line, the Yatindra Bhadrabahu, the last of the Sruta-Kevalins; his disciple, Chandragupta ; and, in the line of the latter, the Munindra Kundakunda, whose succession is then continued, as in the other records. It may be mentioned, in connection with an altogether different matter of some interest, that, in the further succession of disciples, this inscription mentions one whose original name was Devanandin; who was called Jinendra baddhi, on moount of his great learning; who was called PajyapAda, because his feet were worshipped by gode; and who composed the Jainindra-grammar. I give this name as it stands in Mr. Bioe's texts, - Kondakunda, in Nos. 40, 54, and 105, and Kundakunda in No. 108. The variation in the vowel of the first syllable is not material. There is a question as to the proper consonante in the second and fourth syllables. For several varianter of the name. see Dr. Hultasch's south-In. Vol. I. p. 158, note 2. In the pallavall of the Sarasvati-Gachohhs, it appeare an Kundakunda (ante, Vol. XX. Pp. 851, 856).
Page #165
--------------------------------------------------------------------------
________________ MAY, 1892.) BHADRABAHU AND CHANDRAGUPTA. 157 These inscriptions undoubtedly mention Bhadrabahu, the last of the Sruta-Kevalins, and allot to him a disciple named Chandragupta. And all that we have to note here, is, that, except through the connected mention of a Chandragupta, they afford no grounds for identifying him with tho Bhadra bahu of the inscriptions quoted in the last paragraph but two above; that they furnish no reasons for aserting that the Sruta-Kevalin Bhadrabahu ever visited Sravana-Belgola, or even came to Southern India at all, and that they give no indications of Chandragupta having been anything but an ordinary Jain teacher. And now we come to the actual reasons that led Mr. Rice to assert the alleged facts which, in the interests of plain and reliable history, it is desirable either to substantiate or to disprove. They are to be found, partly in a compendiuin of Jain history called the Rajavali. kathe, and partly in Mr. Rice's rendering of another inscription at Sravana-Belgola, No. 1 in his book. The essence of what the Rajavalikathe tells us is this (loc. cit. pp. 3-6): - "The " Bhadrabahu who came to be the last of the Sruts-Kovalins, was a Brahman's son, "and was born at Kotikapura in Pundravardhana. He interpreted sixteen dreams of "Chandragupta, the king of Pataliputra; the last of which indicated twelve years of "dearth and famine. On the commencement of the famine, Chandragupta abdicated in " favour of his son Simhasona, and, taking initiation in the Jain faith, joined himself to " Bhadrabahu. Bhadrabahu, having collected a body of twelve thousand disciples, migrated " to the south, and came to a hill in the Karnataka country. There he perceived that his "end was approaching; and so, giving upadesa to Visakhacharya, he committed all the dis"ciples to his care, and sent them on to the Chola and Pandya countries. He himself remained " on the hill, and died in a oavo there, tended only by Chandragupta, who performed the " funeral rites, and a bodo there, worshipping the foot-prints of the deceased saint. After a "timo, Sitbhasena's son, Bhaskara, came to the place, and did obeisance to Chandragupta, and " built the city of Belgola near the hill. And eventually, Chandragupta himself died there." In connection with this account, the value of which most people will be able to appreciate for themselves, - it is sufficient to point out two things. One is, that, whatever may be the sources on which it is based, this Jain compendium is a composition of the present century (loc. cit. p. 3). And the other is that, by a further extract from the same work, we learn (ibid. p. 9) that the Chandragupta in question was not the well-known grandfather of Aboka, - the Sandrokottos of the Greeks,- at all, but a son, otherwise quite unknown, of Asoka's son Kunala. Mr. Rice hitaself noticed this little difficulty, and got round it by suggesting (ibit. p. 10) that the introduction of two Chandraguptas seems to be due to some confusion in the traditions, and is an annecessary variation, perhaps intended to conceal the dofection of Asoka (from Jainism to the Buddhist faith). But, by snoh a process as this, - accepting as reliable an account that is perfectly valueless for historical purposes, and then directly perverting its statement, on a point of leading importanoo, by deliberately substituting a man's grandfather in the place of his grandson, - almost anything whatever in the way of imaginary history might be evolved. It is unnecessary to follow Mr. Rice through the process by which, using what seems to be an actual fact, viz. that Bhadrabahu, the last of the Sruta-Kevalin, was a contemporary of the great Chandragupta, he arrived (loc. cit. pp. 12, 14) at about B. C. 297 for the date of the events recorded, on his interpretation, in the inscription that still remains to be considorodi or through the steps by which he established a connection of the real Chandragupta with Southern India through the Early Guptas, the Mauryas of the Konkan, and the Gatta chieftains of the Kanareso country (ibid. pp. 10-14). We will turn now to the inscription itself. The real purport of the inscription, No. 1 in the Sravana-Belgola volume, is as
Page #166
--------------------------------------------------------------------------
________________ 158 THE INDIAN ANTIQUABY. (KAT, 1892. follows: "After the time when the Jain Tirthankara) Mahavira attained parinirvana, there "was a certain Bhadrabahustamin, who belonged to a lineage that had been made illustrious " by a succession of great saints who came in continuous order from the venerable Paramarshi "Gaatama, and his disciple Loharya, and Jambu, Vishnadeva, Aparajita, Govardhana, Bhadra* babu, Visakha, Prosthbila, Krittikarya, Jayana man, Siddhartha, Dhritishena, Buddhila, and "other Gurus. At Ujjayini, the Bhadrabihusvamin, thus introduced, mastered the science of "prognostication, became a knower of the past, the present, and the futare, and announced a "period of distress that would last for twelve years; and the entire sangha set out from the "north and migrated to the south, and, by the directions of the saint, came to a country "containing many hundreds of villages, and rich in people, wealth, gold, grain, cows, buffaloes, "and goats. Then, on the mountain Katavepra, the Acharya Prabhachandra, perceiving " that the end of his life was very near, and being much afraid of journeying any further, "dismissed the whole szivha, with the exception of one annamed disciple, and engaged in "sasinydea until he died." In interpreting this record, Mr. Rice made two important mistakes. (1) He took the Bhadrabahusvamin who announced the period of distress, to be identical with Bhadrabahu I., the Sruta-Kevalin, who is mentioned in his proper place between Govardhana and Visakha. But, according to the inscription itself, seven of the Dusa-Pirvins, and after them a break of unspecified duration, intervened between the two Bhadraba hus, - in perfect accordance with the lists of Northern India. And (2), in conseqnence of a mislection in line 6, he translated the inscription as meaning that the Acharya who died at Katavapra, was Bhadrabahusvamite himself, i. e., as the result of his identification, Bhadrabihu I., the Sruta-Kerclin, and that the disciple who tended him was Prabhachandra ; to which he attached a note that Prabhachandra was explained to him as the clerical name assumed by Chandragupta. Bat all this is distinctly not the case; the reading, in line 6, is, - not acharyyah Prabhuchandrenadmaavanitala", "the Acharya, with Prabhachandra ulan, (dismissed the saragha, and engaged in sarinyasa till he died]," - but ucharyyah Prabharhandrs nam=lranitala", "the Acharya, namely Prabhachandra, (dismissed the samgha and engaged in sannyasa till he died]." In short, so far from recording that the Sruta-Kevalin Bladrabahu died at Sravana Belgola, tended by a disciple named Prabhchandra, who might be assumed to be king Chandragupta of Pataliputra, the inscription simply states that an Acharva named Prabhschandra died there, during or shortly after a migration of the Jain commanity to the south, which was caused by an announcement of famine made, at Ujjain, by a certain Bhadrabahosvamin who came after an interval of unspecified duration, - but plainly a long one, - after the Sruta-Kavalin Bhadrabahu. And thus the only possible substantial foundation for the fabrio reared up by Mr. Rice ceases entirely to exist. We may now proceed to examine the real historical bearings of this inscription. It Mr. Rice gives "Kshatrik Arya," I do not overlook the fact that the name occurs "Kshatriya" in No. 105 in Mr. Bioe's book, and in tho extract from the Maghanandi-Brdvakachdra giren anto, Vol. XII. p. 22, and MA Kattiya," explained by "Kobatriya," in the pattavalt of the Sarasvati Gachohha (ante, Vol. XX. p. 348) But Mr. Rice's lithograph distinctly has the namo that I give. - Sipoo writing these remarks, I have seen im pressions of the inscription, which I owe to the kindness of Dr. Hultzsch. They shew that the name really is Kittikarya. The original saya," on this mountain named Katarapra": i. e. on the hill on which the itscription is engraved 1. e. on Chandragiri itself. 5 See also Introd. PP. 6, 7, where, however, be saya only that, "according to No. 1," i.e. the present inscripfron, Chandragapta" appears to have taken the naine of Prabhachandra on retiring from the world, in conformity with chatom. The passage was supposod' to include the word ans, in the sense of saha. The inscription was Arat brought to notice by Mr. Rice in 1874, in this Journal, Vol. III., p. 153 (see also Mysore Inscriptions, pp. lxxxvi., lrxxvii., 302) : and the first extract from the Rajavalikathe was also given. But Mr. Rice did not then find the name Prabbechandra in the inscription And in respect of the extract from the Rijavaltkathe, he then wrote - "This is a strsage story. How much of it may be accepted as historical is not easy to say."
Page #167
--------------------------------------------------------------------------
________________ MAY, 1892.) BHADRABAHU AND. CHANDRAGUPTA. 159 is not dated. But the lithographic Plate which is given by Mr. Rice, shows that the engraving of it is to be allotted to approximately the seventh century A. D.: it may possibly be trife earlier; and equally, it may possibly be somewhat later. And, interpreting the record in the customary manner, viz. as referring to an event almost exactly synchronous with the engraving of it, we can only take it as commemorating the death of #Jain teacher named Prabhachandra, in or very near to the period A.D. 600 to 700. Who this Prabhachandra was, I am not at present able to say. But he cannot be Prabhachandra L. of the paljavali of the Sarasvati-Gachchha (ante, Vol. XX. p. 351), unless the chronological details of that record, -20cording to which Prabhachandra I., became pontiff in A. D. 396, - are open to very considerable rectification. And I should think that he must be a different person, for whose identification we have to look to southern records not as yet available. As regards Bhadrabshusvamin, all that should have been of necessity plain at the time when Mr. Rice dealt finally with this inscription, is, that he is not the Sruta-Kavalin Bhadrabahu. Now that Dr. Hoernle has published the pattavali of the Sarasvati-Gachchha, he is easily capable of identification. He is andoubtedly Bhadrabahu II., the last but ono of the Minor-Argins who is represented as becoming pontiff in B. C. 53 (ante, Vol. XX. pp. 349-51.) The same pallavali enables us to looate properly the Chandragupta of the Sravana-Belgola traditions and inscriptions. Sach of them as make him & disciple of the Sruta-Kevalin Bhadrabaho, are plainly mistaken. He is evidently Guptigupta, the disciple of Bhadrabahu II., - otherwise named Arhadbalin and Visakhacharya, - who, according to the same record, became pontiff in B. C. 31 (ante, Vol. XX. pp. 350, 351). And this brings us to a point in which the local traditions are possibly more correct than the northern records. The pafiavali in question tells us that one of Guptigupta's disciples, Maghanandin, established the NandiSangha or Balatkara-Gana, as a division of the Mala-Satgha itself. Both names of the gana, as well as that of the Mula-Samgha, are of frequent occurrence, in connection with teachers belonging to it, in inscriptions in the Kanarese country; where, however, the gana is perhaps mentioned most often as the Balatkara-Gapa. This appellation for it is attributed by Dr. Hoernle to Guptigupta's name of Arhadbalin. Agana of his own is allotted to Chandragupta, i. e. to Guptigupta, by inscription No. 40 at Sravana-Belgola (see the words quoted from it, on page 156 above), which ultimately deals with the Dest-Gana as a division of the Nandi-Gana in the Mala-Sangha, placing it in the lineage (anvaya) of Kondakanda, just as the lineage of the latter is placed in the lineage of Chandragupta, i. e. of Gaptigupta. And the fact that the inscription with which we have been dealing, and others on the Chandragiri hill which similarly record the deaths of Jain ascetics, lie in such & position that they have to be read with the face directed towards the front of the so-called Chandragupta-basti, indicates plainly that gime peculiar sanctity or reverence attached to the person commemorated by that shrine. There can be little doubt that the ascetics in question belonged to the same sect with that person; that he was the traditional foonder of the sect; and that the tradition at SravansBelgola was that the Balatkara-Ghans was really founded by the Chandragupts of the inscriptions, i. e. by Guptigupta, the disciple of Bhadrababu II.8 Wbile recognising, approximately, the period to which the characters really belong, Mr. Rice (loc. cit. p. 15) arrived at the conclusion that, "il this interesting inscription did not provode the Christian era, it unyuestionably belongs to the earliest part of that ora and is cortainly not later than about 100 A.D." But there are no substantial grounds for this view, which depends chiefly apyn Mr. Rice's acceptance as genuine, of the spurious Western Gaiga grants. Unfortanately, much of what would otherwise be valuable work by him, is always vitiated in the same way. * In connection with division of the Nandi-Barghs, the body of saints of Guptigupta" is mentioned in the Kadab grant, which purports to be dated in Baka-Sat vat 735 (ante, Vol. XII. p. 11.). Ard inscription No. 105 ia Mr. Rioo's book, dated Saku Sath vat 1820, speaks o! Achadbalin, apparentiy establishing a four-fold division of the sathgh.
Page #168
--------------------------------------------------------------------------
________________ 160 THE INDIAN ANTIQUARY. [MAY, 1892. Tho migration to the south, whether it really started from Ujjain, or from elsewhere, may well be a historical fact. It may be open to argument, whether the inscription intends to imply that it was led by Bhadrabahu II. But at any rate this is not distinctly asserted. And I think that the contrary is indicated, (1) by the description of Bhadrababu as "a knower of the past, the present, and the future (traikalya-darbin)," which rather points to his predicting a future period of distress, than to his simply announcing the commencement of immediately impending distress; and (2) by the statement that the rich land at which the samgha arrived was reached by the directions of the saint (arshena = pishi-vachanena)," which points to instractions given at the time of predicting the distress, - or at any rate to advice given to people wbo were leaving him, - rather than to personal guidance. On the other hand, the inscription, whether correctly or not, does make the migration contemporaneous with Prabhachandra; for it says that, at the mountain Katavapra, he perceived that the end of his life was very near and became "much afraid of travelling any further (adhvanah su-chakitah)," and so dismissed the samgha and remained there till he died. If, then, the record does mean to imply that Bhadrabahu II. led the migration or even that it took place in his time, it is wrong, either in that respect, or in placing the death of Prabhachandra during the migration; because of the intervention of several centuries at least10 between the period of Bhadrabdho II. and the death of Prabhachandra as determined, with close approximation, by the palaeography of the record. FOLKLORE IN WESTERN INDIA, BY PUTLIBAI D. H. WADIA. No. 17. The Princess Malika-Jarika. There was once a rich old merchant who had seven sons. One day be called them to him and said :-"My sons, it is high time now that you were married and settled in life, for I am growing older every day, and am anxious to distribute my wealth among you before death calls me away from this world." The young men were notbing loath to do as their father desired, and jumped at his proposal, but the old man added : - "Not so fast, my boys, there is a certain condition to be fulfilled, and a certain test to be applied to you, before you come by your partners in life and obtain possession of my wealth. So listen attentively to what I say." "On a certain day, which we shall appoint, after consulting the astrologers, you all are to go with your bows and arrows to an open maidan outside the city, where each one of you is to shoot an arrow from his bow in whatever direction he likes best, and I shall trust to the hand of fate to guide it to the feet of the fortunate lady, who is destined to be the bride of the owner of that arrow." "Agreed," said the brothers, who were all eager both to display their skill in archery, as well as to come by their wives in such a romantic fashion. So they soon set about making preparations for that eventful occasion. When the day fixed by their father, with the aid of his astrologers came round, the seven young men and their father, accompanied by a number of their friends and relatives, went to the appointed place, sud when everything was ready and the signal given, the seven brothers, It appears to be mentioned also in the Upasarga kevaligala-kathe; see ante, Vol. XII. p. 99,-"the whole #pemblage of the saints having come by the region of the south, and having arrivod at the tomb of the venerable UDC, &c." 10 I assume that the paitavali of the Sarasvatt-Gachchha is at least approximately correct in respect of the date which it gives for Bhadrabahu II.
Page #169
--------------------------------------------------------------------------
________________ MAY, 1892.] FOLKLORE IN WESTERN INDIA; No. 17. 161 who had taken care to put their own particular marks on their arrows, shot them in sever different directions. After a long interval of anxious waiting, the arrows were one by one recovered and bronght back to their owners, along with tokens from the fair ladies at whose feet chance or fate had guided them; all except that of the merchant's youngest son. Long and vigorous was the search made for it not only all that day, but for many and many a day following, but to no purpose. The arrow bad flown over hill and valley and over river and ocean, for no trace of it could be found over the entire country. At last, when no stone had been left unturned, and all hope of finding the lost arrow was abandoned, the old man taunted his son about his ill-luck in not being able to procure himBelf a partner in life, and expressed his belief that he must be a very wicked fellow thus to have incurred the displeasure of God. The poor youth felt so humiliated at this that he quitted the land of his birth in despair, and became a wanderer in distant countries; whilst his father celebrated the naptials of his six sons with great pomp and rejoicings, and, regardless of his yotngest son's claims, distributed his large wealth equally amongst them. Our hero roamed about for days and months from one place to another in search of his lost arrow, but in vain, till at last he became a mere aimless and homeless wanderer, for whom life could have no zest or charm. One day, however, as he was thus roaming through a large forest in an unknown country, his eye chanced to fall upon a large iron ring fized to what appeared to be a door, and what was his joy to find, in close proximity to the ring, his own long-lost arrow entangled amongst some thorns and brambles that grew there! Naturally the youth's first impulse was to draw out the arrow from its place; but he soon changed his mind, reflecting that perhape it marked the spot where he ought to look for his bride. So he took hold of the ring and palled at it with all his might, and to his great joy the door yielded and revealed to his astonished gaze a dark and narrow passage, which evidently led to some subterraneous abode. Without any delay our hero boldly entered this passage, and soon found himself sliding downwards and downwards, as if impelled by some unknown power within. When he st last recovered the use of his legs, he found himself in the midst of a beautiful garden, so tastefully laid out and so well stocked with beautiful fruits and flowers of a strange kind, that he was for & while quite entranced, and felt certain that he could be nowhere but in fairy-land, for such things could not belong to the world he had lived in. He looked about him to see if he could find any traces of the inhabitants of that strange and most picturesque place, but nothing met his eye, far and near, save fruits and flowers, and butterflies and birds of rare plumage, while the only other living being he noticed there, was & solitary she-monkey, that was swinging herself to and fro amongst the branches of the trees. As he walked about in the garden, however, our hero saw in one part of it, a large and very beautiful palace, and on entering it, found it full of gold and silver jewels. Every piece of furniture in that noble edifice was made either of one of these metals or the other, and was, moreover, studded with diamonds and rubies. But go where he would in it, he could find no evidence of any living being, human or otherwise. As he was sitting, however, in one of the balls of this wonderful palace, be perceived to his great surprise, that a sumptuous feast was being spread before him by invisible hands, while a voice whispered in his ear-"Get up, take thy bath, and partake of these good things." He instantly turned round and looked about to find who it was that had spoken to him, but could see no one. So he got up, and, doing as he was bid, sat down to the repast, and did ample justice to the rich viands that were placed before him, having had no food all that day. By and by, the she-monkey he had observed in the garden oame in also, and began skipping about from room to room and making herself quite at home, just me if she were sole mistress of the palace.
Page #170
--------------------------------------------------------------------------
________________ 162 THE INDIAN ANTIQUARY. (MAT, 1892. Oar hero remained in this strange place for several days, and had nothing to do, but to eat and drink and enjoy himself. But at last he got tired of the monotony of his situation, for, besides the monkey, he himself was the only living thing in that palace, and she, he thought, was no company for a young man, notwithstanding that every now and then she went and sat by his side, looked wistfully into his face, and asked him by signs to follow her all throughout the palace and the garden, and to look at the wonderful things it contained. One day, therefore, he secretly ran up the passage, through which he had entered the garden, and lifting up the massive iron door made his way back to his father's country. When at last after a long and toilsome journey the long-forgotten Wanderer reached home, he received but * cold welcome from his father and brothers, and they all laughed at him, when he related to them where and how he bad found his lost arrow. So he thought it pradent not to say anything about the wonderful palace or the sbe-monkey just then, and kept his own counsel. The six brothers were all happy with their six wives, who were all clever and beautiful, and the old man, their father, extolled the virtues of his daughters-in-law to the skies, and ezultingly showed his son the nice and valuable presents the ladies bad brought specially for himself. Amongst them were some exquisitely embroidered little carpets worked by the ladies themselves, which the old man admired most of all, though our hero eyed them with contempt, as he compared them to the rare specimens of workmanship which he had seen in the underground palace. Not desiring under these circumstances to prolong his stay with bis father, our hero one day quietly left his home, and speedily retarted to the subterraneous palace, to which, it need not be mentioned, some strange power was canstantly attracting him. When he reached it the she-monkey again went skipping up to him, etre played and frisked about him with great glee. Bat onr hero's heart was sad to think that he should have only a she-monkey to welcome him in a place, which he felt was to him like a home, and one where he most loved to go, and he began to look at the 'unsightly animal with tears in his eyes. She seemed, he / ver, to understand what he felt, for going up to him she commenced to stroke his head and to shampoo his feet. But our hero turned away from her in disgust, and said in a rage, "Begone, thon ngly creature, I don't want thee to come so near me !" "Hold thy tongue," replied the monkey, all of a sudden speaking like a human being, "I only do as I am bid. If thou utterest one unkind word to me thou shalt have to rue it before long." The poor young man was non-plussed at this, and said nothing, but his heart grew sad to think in what an unenviable position he had been placed. "My arrow," he contemplated, "came all the way over to the gate leading to this strange place, in which the only living being I can see is this monkey, and since my arrow was destined to indicate the place, where I was to find my bride, am I to content myself with believing that this she-monkey is my lady-love and this fairy place her bower P" As this thought struck him tears began to gush forth from his eyes and trickled down his cheeks. The she-monkey observing this, looked very much distressed, and thus addressed him words of sympathy and comfort, "Do not lose heart and give way like that, my friend; only confide in me and tell me the cause of thy grief, and I shall do my best to help thee." But our hero had not the heart to tell her the real cause of his sorrow; 80 he said :"I am sorry I appear anhappy in a place, where no pains are spared to make me comfortable, but I am grieved, when I think how I am taunted by my father and laughed at by my brothers at every turn, owing to my not having as yet been able to secure & wife for myself. The last time I visited my father he showed me some rich and artistically embroidered carpeta, which he said had been worked for him specially by his six daughter-in-law, and
Page #171
--------------------------------------------------------------------------
________________ MAY, 1892.) FOLKLORE IN WESTERN INDIA; No. 17. 163 cast the cruel fact again in my teeth, that I had not as yet been blessed with a wife, much less with a clever one." "Is that all P" cried the monkey. "I doubt whether they can show anything like the carpets and other beautiful things you see in this palace." *Certainly not!" replied the youth: " nobody in my country has ever seen anything half 80 beautiful and precious; but my only regret is that not one of all these things can I present to my father as the handiwork of my own bride." << Oh! yes, you can," cried the monkey, picking out seven rich and beautiful carpets all studded with diamonds and rubies, out of a heap lying in one of the rooms, "take these to your father, and lay them at his feet as the resalts of the unaided efforts of your future bride." The youth was quite taken aback at these words. What could she mean by saying that the carpets had been worked by his future bride ? Could it be that they had been worked by herself ? No, the embroidery was too tine and tasteful to be done by a monkey! Surely there must be some beautiful fairy hidden away somewhere, at whose bidding the she-monkey was thrusting her odious presence npon him! However, he thought it wise to take the monkey's advice, and bidding her adieu, once more started back to his native country with the carpets and many other precious and beautiful articles besides. As was to be expected, the carpets were greatly admired by each and all of his relatives, and everyone who saw them desired eagerly to behold the fair lady, whose clever fingers had worked such superb specimens of embroidery. Our hero, instead of being elated at this, was downcast and dejected, for he could not, for the life of him, think how he was to produce his fatare bride before his father and his relatives, since he himself had not as yet had the pleasure of seeing her. So he said nothing more about the affair to them, and soon after quietly turned his back once more on the land of his birth, making a mental resolve at the same time never to return home without finding a bride worthy of himself. When he reached the underground palace he found the she-monkey in her usual place among the trees, and she began to question him as to how he had been received by his father this time. Our hero, however, was too much absorbed in thinking of the fair lady, who he imagined had worked the carpets, to give heed to the monkey's questions. He was wondering when it was destined that he should see her, when a strange voice thus whispered to him: "If thou wouldst see her at all, swear to forget thy parents, thy relations, and thy country, and to renource for ever all thoughts of ever returning to them, and promise to stay here for weal or for woe." The youth was surprised at this, but he nevertheless did as he was bid, and in the course of a few days his eye began to see in the palace living beings such as he had never seen there before. He could see male and female slaves flitting about from one room to another, as they did the household work, he could see gardeners tending the flowers and shrubs, and fair ladies waiting upon the she-monkey, who, to his despair, still appeared to be the mistress of all. His dislike, however, for the company of this creature began to wear off by degrees, and he tried to make himself comfortable, since some mystic power appeared to tempt him to stay in that place. A good many days passed away in this manner, when our hero one day again beard a voice that said to him: - "If thou wouldet like to wed thy bride, thou art at liberty to go and bring thy father and all thy kinsfolk to this place, when thy nuptials will be celebrated with great splendoar in their presence." "But must I not ask to see my bride first P" cried the youth in answer. "No, that cannot Le !" was the reply. "Thou must place implicit confidence in us, and in return we promise that thy parents and thyself shall behold as fair a princess as ever was seen by mortal eyes, but
Page #172
--------------------------------------------------------------------------
________________ 164 THE INDIAN ANTIQUABY. [MAY, 1892 that will be only when all thy kinsfolk have assembled, here to take part in the wedding ceremony, and not before." The youth was fain to put faith in these promises, so tempting were they. So he started off for his native country, and on arriving there, besonght his father and brothers to go with him to the underground palace, and witness his nuptials with the fair worker of those beautiful carpets, Accordingly, the old man and his sons sent round invitations to all their friends and relatives, and, fixing an auspicious day, they all set out to go, where the youth led them. The latter in his turn tried to look cheerful and composed in their presence, but at heart he was ill at ease, for he was not yet quite sure whether the bride he was going to wed would not after all turn out to be the she-monkey herself, and he shuddered to think what would be his discomfiture in such a case. After a long and toilsome journey the whole cavalcade of friends and relatives arrived at the door leading to the narrow passage, and on passing through it they all found themselves in that wonderfully laid-out garden. When they had gone about for some time and admired the beautiful fruits and flowers, with which the trees were laden, our hero took them into the palace, where things still more beautiful greeted their sight. But here, as well as in the garden, they were surprised not to meet with any human beings, when all of a sudden they heard a voice that bade them welcome, and told them to wash themselves and partake of the feast that was being spread out for them in one of the large rooms. As the guests were all very hungry they needed no second bidding, but sat themselves down and began to partake heartily of the sumptuous banquet provided for them by some unseen agency. While they were thus enjoying themselves & voice again addressed them thus : -"My guests, you are welcome to this feast. Eat and drink to your hearts' content, and when you have done, I request each of you to carry away the silver tray and the golden cap that has been placed before you to take your meals from, and to keep them as souvenirs of the memorable wedding of the fairy-princess Malika-jarika with a human being." On hearing these words all the guests began to look in different directions in the hope of seeing the fairy-bride, but no Malika-Jarika greeted their sight, nor any living being, save the hideous she-monkey, who was all this while moving about here and there with the air of an hostess, and seemed to be in the best of spirits, to the great consternation of our hero, who could not help associating her presence with the thought that she must be the Princess Malika-Jarika herself, who was going to wed him! His doubts, however, were soon laid at rest, for when the feast was nearly over, the she-monkey suddenly drew off from her person, what appeared like a coil or skin, and lo! there stood before the astonished gaze of all a very beautiful fairy, such as they had never even dreamed of! This lovely creature immediately went up to our hero and joyfully exclaimed: - "Bebold in me the fairy-prinoess, to whose abode fate led thy steps. My name is the Princess Malika-Jarika, and I am sole mistress of this beautiful palace and of all the land for miles around. I am ready and willing to marry thee, but on one condition, namely, that thou takest charge of, and guardest as thy own life, this coil or skin that I have just cast off, for know that, as long as it remains intact, so long only shall I go about in this my fairy form." The young man eagerly took the coil from her hands, and, carefully folding it, put it into a box, and locked it up for safety in one of the rooms of the palace. The wedding ceremony was soon after gone through amidst great rejoicings, and each and sll congratulated our hero on his having been blessed with such a very rich and beautiful wife The six brothers of the fortunate youth, however, felt jealous of him, and could not bear to see him so happy. So they went up to him while the fairy was away, and with an air of the grentout concern, expressed to him their fears regarding the coil, and told him to beware lest his bride should take it into her head to put it on again, and resume the hideous shape of a monkoy. His father and his relatives, too, when they heard this, shared the same fears, and
Page #173
--------------------------------------------------------------------------
________________ MAY, 1892.) FOLKLORE IN WESTERN INDIA ; No. 17. 165 they all joined in persuading the unsuspecting youth to destroy the coil. For some time he was firm, but at last, being unable to withstand the joint advice and entreaties of so many, he threw the coil into the fire ! No sooner, however, did the flames touch it, than the fairy, who was at . distance, attered a loud and piteous scream, came running up, and speedily thrusting her hand into the fire, drew out the burning coil, and as hurriedly put it on! All this happened in the twinkling of an eye, and the merchant and his sons and their guests suddenly found the scene around them transformed into a dense and dark forest, all traces of the fairy-palace and the garden having vanished before them. Our hero was beside himself with rage and grief at this, and swore never to return home, until he had found his beloved bride again. So, leaving him to indulge his grief in that lonely forest, his father and the rest wended their way homewards. When they were all gone the youth again saw the she-monkey jumaping from tree to tree, and uttering piteous screams. So he went up to her and besought her to forgive him, and to receive him back into her favour. But she wept bitterly, and said, "No, no, that is not in my power to do ; still, if thy repentance is sincere, leave me for the present, and let us hope some day to meet again." With these words she vanished from his sight, and there was nothing but darkness around. Just then & voice was heard to say, "If ever again you seek the fairy-princess, let this be your watchword :-*What about that affair p'" "Very well," muttered the youth thankfully, "I'll remember it to the end of my days," and then, in obedience to the will of the she-monkey, he made his way out of the forest. For many and many a month afterwards the unhappy youth wandered aimlessly about from country to country, for he hardly knew in what particular direction to turn, in order to go in search of his lost bride. At last, being fatigued both in mind and body, he sank down under the shade of a large tree, and felt that he was dying. As to the fairy-princess, having had the misfortune to touch a human being, the poor spirit had lost caste, and was no longer the light aerial being that all fairies are; moreover, she had contracted the odour of mortals by coming into contact with them, and the fairies would not let her mix with them, until she had gone through a sovere form of purification. This was nothing less than throwing seven hundred peils of water over hor body each morning, and remaining among the trees the rest of the day, so that she might be dried in the sun and cleansed of all impurities. This made the poor fairy very unhappy, and she passed her days in great sorrow. Meanwhile our hero, whom we had left tired and worn-out under a tree, remained there for some days, being unable to proceed any further. One day he heard a strange noise overhead, and looking up, saw that a very large serpent had climbed up the tree and was going to dovour the young ones of an eagle, which had its nest among the branches. So he went up the tree as fast as his worn-out limbs allowed and succeeded in killing the berpent before it could do any injury to the young eagles. Just then both the parent birds came up and were deeply grateful to the brave young man for having saved the lives of their little ones, and asked him to command their services in any way he wished. But the youth said to them with a sad smile: - "No, friends, it is not in your power to help me, since my only object in-life is to discover the fairy-princess MAlika-Jarika, and I am firmly resolved never to taste the sweets of life until I have found her." "Oh! is that all you want P" exclaimed the male bird, "then it is easy enough. I know the abodes of all the fairies; so you have only to ride upon my back and I shall fly with you to the country of the jins and fairies in no time." These words of the eagle gave new life to the disabled youth, and he fearlessly mounted the large bird's back, and in a few hours arrived at the country of the jins. At parting the good old eagle gave the youth a sweet sounding Afo, and said: - "By simply
Page #174
--------------------------------------------------------------------------
________________ 166 THE INDIAN ANTIQUARY. (MAT, 1892. blowing into this fife you will be able to produce music so sweet that all the fairies and jins will gather round you to hear it. The king of the jins will be so pleased with your performance, that he will offer to bestow upon you whatever you may ask for, on condition that you consent to stay with him for ever. But remember that you are not on any account to mention the name of the fairy-princess, or to utter the watcbword that has been given to you, or your bead will pay the penalty of your indiscretion. However much the king may entreat you to accept some present from him, you must only say that you require nothing and have to go back the next morning. He will then bring you gold and silver and rare jewels and also the most beautiful fairies you ever saw, but you must still remain firm and inflexible. Then at last he will bring forth to you some of the ugliest women in his kingdom, amongst whom will be one strikingly hideous in appearance, whom you will know by her coal-black complexion and her large projecting teeth. This woman you are to express your willingness to have, for underneath that dark skin and ugly features will be found hidden the beautiful princess, whom yon are so anxious to meet. The youth thanked the eagle and promised to remember all his instructions, when the good bird added : "Let us part now, but, before we do so, let me give you this feather of mine. If ever trouble comes over you, hold it before a fire and burn it, and I shall be immediately at your side." And go saying it flew away. Just then our hero commenced operations. He began to blow into the fife, and although he had no knowledge whatever of music, he produced from it such exquisite melody that, jast as the eagle had predicted, there gathered round him a large concourse of jins and fairies along with their king and queen, and the former offered to bestow upon him whatever he might wish for, if he only consented to stay with them. Our hero, however, acted his part admirably, and refused everything that was offered him in succession, until at last the ugly women were "brought before him. Then only did his eyes begin to sparkle, and he chose from among them the one the eagle had described to him, and she, to his great delight, soon turned out to be his own long-lost bride. The two young people lived very happily together for some time, and cared for nothing else besides each other's company. But at last the youth felt a longing to return to his native conntry and see his father. The fairy-princess, too, was willing to go with him, though her father stoutly refused to give them his permission, and they were thinking of stealing away unknown to him, when an unforeseen difficulty arose. How were they, especially our hero, who was only a mortal, to travel through the air, sinco no land or sea appeared to connect his father's country with fairyland ? In this dilemma the youth bethought him of the eagle, and forthwith burned its feather. The faithful bird speedily obeyed the summons, and without losing any more time, hoth the young people mounted its back. The good bird flew incessantly, till it placed its precious burden at the feet of the old merchant, now very feeble and living all by himself in the old house, neglected by his six sons, who were fast throwing away the money he had so thoughtlessly given them. The old man's joy knew no bounds at seeing his long-lost son and his beauteous bride once more. He entreated them to stay with him till death called him away, which he thought was very near. Both the young people readily consented to this, and lived with the old man till the last; and after his death returned to fairy-land once more, where they lived very happily for the rest of their lives. MISCELLANEA. THE DATE OF THE GRAECO-BUDDHIST | note on this unique record. He does not seem to PEDESTAL FROM HASHTNAGAR. have seen M. Senart's remarks on the same subject," Dr. Buhler has published in the number of this and, I think, it will be interesting to many readers Journal ante, Vol. xx., p. 394, an interesting to compare the views of these two scholars. * Notes d'Epigraphie Indienne, extrait du Journal Asiatique, III., Paris, Imprimerie Nationale, MDCCCXC.
Page #175
--------------------------------------------------------------------------
________________ MAY, 1992.] MISCELLANEA. 167 Dr. Buhler, having before him both the fac. a relief, and nothing is known of the artistic simile rubbing and the photo-etching, reads the merite of the statue which stood on the pedestal. inscription as follows : Very likely, it was executed in a much better " Sam II C II IX II I iv Postavadasa masasa style. I, therefore, give up the suggestion that diva) sammi pam(cha) 5[11]." the Saka era is referred to in the inscription. M. Senart, before the publication of the photo M. Senart is a firm believer in the early esetching, read ".... protbavadasa masasa tinction of the Arian or Khardahtrf alphabet, and di vase] pamchame, 4, 1." He doubted the remarks that "l'ere de Gondophares est donc existence of the symbol for one hundred, and read seule en cause, parmi celles qui nous sont actuelle. the remaining figures as 74, not as 84. Dr. Buhler ment connues." The exact date of Gondophares notes that the reading pothavadasa is linguisti is not known, but he lived somewhere about the cally possible, and would be good Prakrit. middle of the first century B. C. The probable date of the inscription is therefore approximately Both scholars, therefore, are agreed that the 284-50 - A. D. 234, or 274.50 = A. D. 224. month named is the Sanskrit Praushthapada By & slip of the pen M. Senart gives the date of (August-September), and that Sir A. Ounning Gondophares as "environ 50 apres J. C." ham was mistaken in reading Emborasmasa,' 'intercalary. That point may be considered as I have sent to the Asiatic Society of Bengal a definitely settled. fuller notice of M. Senart'e paper. V. A. SMITH. Now that the photo-etching is available, M. 7th February, 1892. Senart cannot well doubt the presence of the symbol for hundred." The date, therefore, is TAILA II. either 274, as read by Sir A. Canningham and The time at which Tails II. restored the ChaDr. Bahler, or 284. As to this detail M. Senart lukya sovereignty in Western India is fixed as observes: "Quant aux annees, dont le chiffre est being the Brimukha samvatsara, Baka-avat lu 274 par le general, il parait certain que c'est 896 current (A. D. 978-74), by a verse which is par 84 qu'il finit (je ne puis faire aucune differ given in an inscription at the temple of Viraence entre le troizieme et le quatrieme chiffre des dizaines)." Narayana at Gadag in the Dh&rwad District, and in another, based on the same model, at the The difference between the third and fourth temple of KAlinga at Kalige in the Tengali symbols for the tens (or rather the twenties) does, TAluka, Nizam's Dominions ; both records be however, exist, though it is very slight. The long to the time of Vikramaditya VI. fourth symbol is somewhat more slender and less I gave the verse, as far as it could be curved than any of the three preceding ones. I restored from the transcriptions given in Sir prefer, consequently, to accept 274 as the Walter Elliot's Carndtaka-Desa Inscriptions, correct reading. Vol. I. pp. 370, 415, in this Journal, Vol. XII. As to the era used, Dr. Buhler considers as p. 270. I am now able to give it in correct very improbable the suggestion that the Saka form, from an ink-impression of the Gadag stone era may be that referred to. My only reason for which I owe to the exertions of Mr. Daso Balwant making the suggestion was the inferior style of Bettigeri; and to annex the preceding portion the sculpture. But M. Senart has pointed out at the beginning of the inscription, the opening that the workmanship of pedestals is generally part of which is hopelessly unintelligible as it much inferior to that of statues. The inscription stands in the version given by Sir Walter Elliot's under discussion is on a pedestal adorned with copyist. The whole passage runs as follows: TEXT. Omn Svasti Samasta-jagat-prasater-bhbha(bbhagavato Brahmanah putrasy-Atrer=nnotrasamutpannasya yamini-kimini-lalama-bhatasya Somasy-Anvaye satya-tyaga-sauryy-&di-gunanilayah kevala-nija-dhvajini-java-kshapita-pratipaksha-kshitiga-vamsah sriman=asti Chalukya. vamsah | A varsado! Kanda 11 Sri-vallabhanwahita-jaya eri vallabhan=enisi Vikramadityanga. [1] Sri-vadhuvaeol=eseva Bontha devigay-dam tandbhavaria Taila-nfipa | * But, in his recently published work. Coins of Ancient India' (Quaritob, 1891), Sir A. Cunningham (page 37 refers to the Hashtagar Inscription being dated 84 only.
Page #176
--------------------------------------------------------------------------
________________ 168 THE INDIAN ANTIQUARY. [MAY, 1892. Vritta | Modalolu kitt'-ikki Rattaruppalaruman=adatan Murjanam komdu dor-gga rbbada gurbbim yuddhadolu Pamohalana taleyuman kondu Chalukya-rajy-- spadaman kai-kondu nishkamtakam=enisidan kamgadir Srimukh-&bdam modal-&g=irppattu-nalkur barisam-akhila-bhachakraman Taila-bhupa Il TRANSLATION. Om ! Hail ! In the lineage of Soma (the Moon), the forehead-ornament of the loving woman the night, who was produced from the eye of Atri, the son of the divine Brahman who was the procreator of the universe, there is the glorious Chalukya race, which is the abode of truth, liberality, heroism, and other virtuous qualities, (and) which has destroyed the races of hostile kings by simply the quickness of its bannered armies. In that race : (Verse):- To Vikramaditya (IV.), who was accounted the favourite of fortune (and) the favourite of the goddess of viotory over enemies, and to Bonthadevi who resembled the goddess Bri, there was born a son, king Taila (IL.). (Metre):- Having first plucked up and destroyed some Rattas; having killed the valiant Hunja; having, by the terror of the pride of his arm, taken the head of Panchala in battle; and having possessed himself of the regal dignity of the Chalukyas, - king Taila, unaided, caused the whole circuit of the earth to be considered free from troubles for twenty-four years, beginning with the year Srimukha. J. F. FLERT, NOTES AND QUERIES. THE EVIL EYE. SUPERSTITIONS AS TO CROWS IN MADRAS. A.-In Porsia. The crow is held in high estimation by the It is the custom in Persis to keep a wild boar in Brahmans of Southern India, as the following stable where valuable horses are kept, in order facts clearly show to keep the evil eye from them. In the same The Brahmans strictly observe the datly paja way almost every valuable horse has an amnlet or adoration of Siva. Towards the end of it the strung round his neck, to which may be also principal food prepared for the occasion is placed attached a boar's tusk, for the same object. in front of the god and by means of mantras he is S. J. A. CHURCHILL. invoked in order that he may partake of the Tehran. game, and for this invocation a handful of the food so presented is taken and kept aside. After B.-In Bihar. the pajd is over, it is pat on a tray in the open The ovil oyo or naar is very fatal to children yard and the crows are invited to eat it. This food is termed the baliannam, or the presented and animals. If a man looks steadily at any food. It is only after the crows have eaten it .child or animal, and asys or thinks how beautiful it is, it will soon die. A blue thread round the that the people of the house sit down for their animal or the child's waist will save it. Tiger's breakfast. claws and old coins are also a great protection. When a crow caws early in the morning in the It is not right to allow others to look on while open yard of the house, or when an unusual noise you are eating, - especially the hungry. The is heard in the oven of the kitchen, a guest is steady gaze of the hungry at a man eating causes always expected either for breakfast or dinner. indigestion or a disease in the stomach. K. SRIKANTALITAR. You must never put your feet on the table. Ootacamund. cloth (dastarkhari), nor permit a glass of water to be put on it. BAD OWENS IN MADRAS, The evil eye cast on food can be averted by If you hear anybody spoesing or you see any setting aside a spoonful of each dish and giving sudden putting out of a burning light jaat it to birds or to beggars, or simply by muttering at the time of contemplation there will be an * prayer. utter defeat. SAYYID KHAINAYAT AHAD. K. SRIKANTALIYAR. Gayd. Ootacamund. 1 First kirtr was engraved, sad then ther WM noolled.
Page #177
--------------------------------------------------------------------------
________________ SYSTEM OF TRANSLITERATION. The system of transliteration followed in this Journal for Sanskrit and Kanarese, (and, for the xilke of uniformity, submitted for adoption, as far as possible, in the case of other language Case of other languilges),- except in respect of modern Hindu personal names, in which absolute purism is undesirable, and in respect of a few Anglicised corruptious of names of places, sanctioned by long usage, - is this :Sanskrit. Kanarose. Transliteration. ! Sanskrit. Kannrese. Transliteration a jhn 4 al ergo omne 9 98 3 # # tha 4 53 & Who to the took two da dha na 3 3 3 & CC8&u eta udala d & 3 pa au pla Virarga ba Visargu Jihvimiliya, or old Visarga before bha and sya ma Upanthminiya, or old Visarga be fore and F Auusuvira Anusvira Annn isiku kla ga gha 4 AS ak 77 3 3 13 rM cha alala chha A single hyphen is used to separate works in composition, as far as it is desirable to divide them. It will readily be seen where the single hyphen is only need in the ordinary way, at the end of a line, as divided in the original Text, to indicate that the word runs on into the next line; intermediate divisions, rendered unavoidable here and there by printing necessities, are made only where absolutely necessary for neatness in the arrangement of the Texte. A double hyphen is used to separate words in a sentence, which in the original are written as one word, being joined together by the euphonic rules of sandhi. Where this double hyphen is used, it is to be understood that a final consonant, and the following initial vowel or consonant-and-vowel, are in the original expressed by one complex sign. Where it is not used, it is to be understood of the orthography of the original, that, according to the stage of the alphabet, the final consonant either has the modified broken form, which, in the oldest stages of the alphabet, was need to indicate a consonant with no vowel attached to it, or has the distinct sign of the virama attached to it; and that the following initial vowel or consonant has its full initial form. In the transcription of ordinary texts, the double hyphen is probably unnecessary; except where there is the sandhi of final and initial vowels. But, in the transcription of epigraphical records, the use of this sign is unavoidable, for the purpose of indicating exactly the palaeographical standard of the original texts. The avagraha, or sign which indicates the elision of an initial a, is but rarely to be met with in inscriptions. Where it does occnr, it is most conveniently represented by its own Devangavi sign. So also practice has shewn that it is more convenient to use the ordinary Devanagari, marks of punctuation than to substitute the English signs for them. Ordinary brackets are used for corrections and doubtful points; and square brackets, for letters which are much damaged and nearly illegible in the original, or which, being wholly illegible, can be supplied with certainty. An asterisk attached to letters or marks of punctuation in square brackete, indicates that those letters or marks of punctuation were omitted altogether in the original. As a rule, it is more convenient to use the brackets than to have recourse to footnotes; as the points to which attention is to be drawn attract notice far more readily. But notes are given instead, when there would be so many brackete, close together, as to encumber the text and render it inconvenient to read. When any letters in the original are wholly illegible and cannot be supplied, they are represented, in metrical passages, by the sign for a long or a short syllable, as the case may be ; and in prose passages, by points, at the rate, usually, of two for each akshara or syllable.
Page #178
--------------------------------------------------------------------------
Page #179
--------------------------------------------------------------------------
________________ June, 1892.) GRANT OF JAYADITYA OF VIJAYAPURA. 169 GORAKHPUR COPPER-PLATE GRANT OF JAYADITYA OF VIJAYAPURA. BY PROFESSOR F. KIELHORN, C.I.E.; GOTTINGEN. THE plate which contains this inscription was discovered in the Gorakhpur District of the 1 North-Western Provinces, near the river called the Little Gandhak. It was brought to Mr. John Ahmuty, Magistrate of the district, and by him commanicated to Captain Wilford, who presented it to the Asiatic Society of Bengal, in whose Library it is still deposited. The inscription was first edited in 1807, with a translation and a facsimile, by H. T. Colebrooke, in the Asiatic Researches, Vol. IX. pp. 406.12; and Colebrooke's paper was afterwards reprinted in his Miscellaneous Essays, Vol. 11. pp. 247-54. I now re-edit the inscription from an excellent ink-impression, made and supplied to me by Mr. Fleet: The plate is inscribed on one side only. It measures about 161" broad by 12%" high, not including an oval projection, with a raised rim, on the proper right side, on which is riveted a disc of the same shape, similarly with a raised rim, which contains a flat button about an inch in diameter; on the counterpunk surface of this button there is some emblem which may perhaps be an animal, but it is a good deal worn and damaged. The edges of the plate are fashioned thicker than the inscribed surface, to serve as rims to protect the writing. Towards the bottom, a small portion of the writing has suffered slightly from corrosion ; otherwise the preservation of the plate is perfect, and, with the exception of two aksharas in line 24, everything may be read with certainty. -The sise of the letters is about #". The characters are boldly and well drawn and deeply engraved. They belong to the northern class of alphabets. Of the same type as those of the Aphsad inscription of Adityasena, they show a further development of the northern alphabet in the direction of the ordinary Naguri, and may perhaps be assigned to the beginning of the 10th century A. D. Attention may be drawn especially to the peculiar manner of writing the diphthongs e, ai, 8 and au, when they follow a consonant, which agrees with the practice of some Kanheri inscriptions of the 9th century, described by me, ante, Vol. XIII. p. 133. It may also be noted that in the conjunct ry the sign for r is written on tho line, in paryanka-, line 3, and aryanari, line 23; and that the sign of an tsrara is several times placed after, not above, the akshara to which it belongs, e.g., in -salvanant, and varudhen, in line 15. - The language is Sanskrit ; and, excepting the symbol for or at the commencement of the first line, the whole inscription is in verse. As regards orthography,b is throughout denoted by the sign for v; the dental sibilant is used instead of the palatal in sasvat, line 9, and saevati, line 16, and the palatal instead of the dental in Sachivasya, line 21 (but not in sachirah, line 9); the dental n is employed instead of anusvara in sansdra., line 2, and pronsas (for punsas-, i. e. pusisas=), line 16; the vowel si occurs instead of the syllable ri in deritya, line 13; before r, t is doubled in tattra, line 6, and bhrattra, line 22; and the word duh kha is (correctly) spelt dushkha, in line 5. In respect of grammar and lexicography I may point out the unusual and incorrect word utkhatin uprooting' or 'extracting,' in line 3; nripadkani for rajadhani, in line 6; the employment of susita, in line 12, in the sense of 'given as a grant;' and the ungrammatical use of the gerund doritya, in line 13. Opening with four verses in honour of the deities Siva, Brahman, Vishnu, and Parvati, the inscription (in lines 4-11) relates that at the royal residence of Vijayapura, on the declivity of the northern mountain (uttaragiri), there was the king Jayaditya, a son of the king Dharmaditya, and that his minister was Madoli, a son of the minister, the great samanta Ksitakirti. And it records (in lines 11-12) that this Madbli gave the village of Dummuddu. maka, which he had obtained by the king's favour, as a grant to the goddess Durga. Lines 12-18 glorify the liberal, admonish future rulers to respect this grant, and deprecate its resumption. Further, three verses in lines 19-22 state that the preceding prasasti of the minister was composed by the Kayastha Nagadatta ; and another verse adds that the verses referring to 1 See Asiatic Researches, Vol. IX. p. 406. * See Mr. Fleet's Gupta Inscriptions, Plate xxviii.
Page #180
--------------------------------------------------------------------------
________________ 170 THE INDIAN ANTIQUARY. (JUNE, 1892. Nagadatta, who was too modest to speak of himself, were composed by his younger brother Vidyadatta. And the inscription closes with another verse, the purport of which appears to be to record that this poem was composed, or the donation made, at Jivanapalli, another village which the minister owed to the royal favour. - The only point of interest, not contained in the preceding, is, that the king Dharmiditya is compared to a Bodhisattva, and the poet Nagadatta to Sugata, or Buddha; which would tend to show that the authors, if not Buddhists, were at any rate favourably inclined towards Buddhism. The inscription is not dated; and the princes mentioned in it do not seem to be known from other records. Of the localities mentioned, Vijayapura was by Colebrooke suggested to be the place of that name near Mirzapur on the Ganges, on the northern declivity of the Vindhya hills; but he has himself stated that uttaragiri-katake in line 6 would rather signify declivity of the northern mountain,' and that this interpretation would point to the range of snowy mountains, i, e., the slopes of the Himalaya. On Dummuddumka Colebrooke has the note that a village of this name is situated in the district of Allahabad, within twenty miles of Bijaypur on the Ganges; but that the name is not uncommon, and may belong to some place nearer to the northern mountains. I myself am unable to identify either Vijayapura or the villages Dummuddumaka and Jivanapalli, TEXT. 1 Om*[11] Kshity5-Adi-yajaman-anta-murttaye visvage-atmane muninam dhyana gamy(A)-ya samasta-vya pine ta(na)mah | Ajayelya) 2 jagad-utpatti-sthiti-pralaya-karine sansara7-sigar-ottara-pota-samsmpitayo namah 11 Namo=stu Larkshma(kshmi)-pa3 taye Sa(sl)sha-paryanka-skyine I trailokya-kantak-otkhati-Vishnsve visvarupine 11 Name(m)stu nirjjitacesha-Ma4 hish[a]sura-gh[&*]tine! Parvvati-padapadm[4*lya jagad-Calnanda-dayine | Venas van-ali-vishaman sikhara-praka5 ra-malay=&langhyam I nirjjhara-gabhira-parikha-dastaram=est-ari-santrasam Avidita viyoga-dushkhan santosha-sa6 mapta-sakala-vishaya-sokban asty-uttaragi(gi)rio-kabake Vijayapa (pu)ram nama pripadh Anil Tattra cha chatur-ambhodhi-bhranta-ya7 sah sthira-dayo maha-sat[t]vah i srimn=Dharmmadityo nsipatir-abhud-V(68) dhisat[t"]va iva | Tasya cha sasziva sevyo bha(bhogy8 8 lokasya kalpasakh=iva [1] hrada iva toishn-Apaharah suto=bhavati srl-Jayadi. tyah || Raj=&pi yo vinito yuv-Api dhird 9 manobhava-dvdshi | sarvva-prado=pisa (sa)ava(t)-sarvvasya grihita-paramarthah 11 Tasya sachivah srut-Artho mah-Anubhavo vi10 nirjjit-aratih samantasya bumahatah Ktitakirtter=mmantrinas-tanayah u Yasya cha sucharu-mu[r*]tter=ddadatah Karono=pi 11 1[A]ghavan yatah praksiti-para-va(ba)ddha-keksholl va(ba)bhuva sa sri-Madolir12- iti il Dummuddumaka-nama gramo raja-prasa12 da-sampraptah! klishi-vasati-go-dhan-adhyo Darggayai sisitasetena (1) Bhavati hi satan vibhutih par-Opakritage * From an impression supplied to me by Mr. Pleet. Expressed by a symbol. * Metre, Sloka LADushtabh); and of the three next verses. * The proper spelling would be vishvag-, but the palatal sibilant is consionally employod in this woed, in later works. Read on thedra.. * Metre, Ary&; up to the end. The correction in this word appears to bave been made already in the original. 10 Rond -bhavach-chhrf-. 11 Road -kanksha; who by nature was striving for final beatitude.' 12 The socon akshara, do, of this word is quito clear in the impression.
Page #181
--------------------------------------------------------------------------
________________ JUNE, 1892.] THE INSCRIPTIONS OF PIYADASI. 171 13 mahantam=isri (ari)tya jalave (dhe)r=adaya jalan jaladah sasyaya varshanti13 11 Sva-para-jana-nirvviso (se) shah sante(nto) vira14 la hi santi ha(pha)la-danekalpadrumah kiyantah sru(sr)yante Nandane=pi vane (11) Ma kalaya kaliyugo(ge)-pi hi sama15 natam tata . sarvva-sat[t]v[A*]nam [*) rakshati vasudham parapatir-Atma-gribam n=au(ai)va laghu-sat[t*]vah 1(11) Janma maranan=cha sampa16 d=vipach=cha punsas14-tu sa (sa)svati-bhavati Iyadi ch=aivan para-kirttim svam=iva kasmin=na palagata(tha) 11 Krishi-karana-sam17 yaktar vasundharam yo dadati saskavatim15 vrajati vimin-irudhah pitrinle sa a()h1[A*]dayan=nakam | Apahara18 ti yo=pi mohad=ve(de)va-dvija-pada-kalpitim vasudham [10] svargga-sthan=api niyatam patayati sa purvvajan nara19 ke !! Atinirmmala-kula-janma deva-dvija-guru-narapati-nati-sakta[h 1] khanita-bhuri tadaga(ga) karita-devala20 yasetyagi 11 Sagata-pratimah kripaya guna-nidhir-abhavat17 jit-ondriyo vidvan 1 vipriya-vade vi21 makhah kayastho Nagadatta iti 11 Sa(sa)chivasya tena rachita lakshana-yukta so[va*Jrnna-ksita-sobhe! 22 sad-vsitta lalita-pada bhakty&' paraya prasastir-iyam 11 Sva-gana-khyapana-bhirosa tasya bhrattra ka23 niyasals rachita [1*] a(A)ryanam tritayam-idam Vidyadattena bhut-artham 11 Raja-prasada-lavdha(bdha) dhana-kanaka-sa24 makul=htisasyavati [l*] Jivanapallir=iti satim gram[]=yam s[8]=sya tad-[AP] parah19 [11*] THE INSCRIPTIONS OF PIYADASI. BY E. SENART, MEMBRE DE L'INSTITUT DE FRANCE. Translated by G. A. Grierson, B.O.S., and revised by the Author. (Continued from page 156.) The influence of a learned orthography apon the linguistic aspect of our monuments does not, as a whole, allow itself to be measured in detail with absolute precision. I shall only quote one example, as sufficiuat to enable the reader to grasp my meaning. Girnar distinguishes between I and I n, but only in the interior of bases. Is preserves I every: where where Sanskrit would write it in the bases, but it writes only 1 in terminations, even where Sanskrit usage would have required a cerebral 1. I confess that a comparison with the Eastern versions, all of which know only 1, makes this invariable practice seem, in my eyes, to be suspicious. I strongly doubt if the popular pronunciation of the people of Girnar correctly distinguished the two n's, but I have no means of rendering this doubt a certainty. Whatever may have been the fact in this and in other analogous instances, many of the divergencies which distinguish our parallel versions are not reducible to an orthographic interpretation. However great may be the latter's importance in its legitimate sphere of action, it leaves remaining a series of phenomena which coustitute dialectic characteristics. It is this face of the question which still remains to be considered. From this point of view the monuments of Piyadasi divide themselves clearly into two main groups. In the one, there is no cerebral , no palatal i, an initial y is elided, I is 14 Read punsas. 18 Originally varshpanti was engraved, but the p has been struck out. 16 Originally easyavatish was engraved, but tich has been altered to tim. 16 Originally pityan was engraved, but it ha. beon alterod to pitrin. 18 Originally niyasd was ongraved, but it has boon altered to niyasd. 3Colobrouku's reading is easyatarah parah. 17 Read -abhavaj-jit..
Page #182
--------------------------------------------------------------------------
________________ 172 THE INDIAN ANTIQUARY. [JUNE, 1892. substituted for r, the nominative masculine, and usually the nominative neuter, end in e, and the locative in asi; the other distinguishes the cerebral n and the palatal h, retains the initial y and the r unchanged, makes the nominative singular of masculine a-bases end in 6, and the locative in amhi or in e. The first comprises all the inscriptions, except Girnar and Kapur di Giri, which alone constitute the second class. It is the more impossible to doubt the existence in this case of a dialectic difference, because certain of the peculiarities which denote the first group are quoted by the grammarians as proper to the Magadhi dialect. Such are the nominative in e and the substitution of 1 for r. It must be admitted that these are also the only points of agreement, and that neither in its omissions - the absence of , n, e, the elision of initial y - nor in certain peculiar usages - the retention of j, of chh, &c., - does the dialect of the inscriptions correspond with the Magadhi of the grammarians. On the contrary, we have seen that the use of the group 8, attributed by the grammarians to Magadhi appears only in the orthography of Girnar. Is it possible to trace subdivisions, to distinguish sub-dialects, within the limits of these two main groups? Between Girnar and Kapur di Giri, if we except the groups 8! and st on the one hand, and the use of the three sibilants on the other, both of which, in my opinion, should not be admitted into the calculation, the only differences of a somewhat general character, which I note, are the group tp at Girnar, which, according to my theory, corresponds to a pronunciation pp, and which is represented at Kapur di Giri by t; the locative singular, which is in mhi, and more rarely in e at Girnar, and in e, never in mhi at Kapur di Giri; and the genitive of bases in in, which is in ino at Girnar, and which, at Kapur di Giri, follows, by the formation isa, the analogy of the declension in a. It may also be noted that the group hm or mh, which is retained at Girnar, is unknown at Kapur di Giri, where bamhana is written bramana, and that the termination vya of the future participle passive, which usually at Girnar adheres to the spelling viya, is, at Kapur di Giri, generally assimilated to va (vva). Finally, we may add one or two other divergencies, such as the 3rd person plural in are used at Girnar, and the accidental substitution of y forjat Kapur di Giri. We can thas have no hesitation in holding that the two sets of inscriptions, to a certain degree at least, do reflect different shades of dialect, which are absolutely distinot. I do not think that the case is the same with regard to the versions which constitute the former group. If we put out of consideration the alleged use of e and sh at Khalsi, regarding wbich I shall shortly take an opportanity of stating my opinion, and which has nothing to do with the present discossion, the only appreciable differences refer to the initial y, the use of r, and the termination of nominatives neuter in ani. Khalsi and the columnar edicts retain the initial y more frequently than the others, but as they present at the same time a number of examples of its elision, even in the same words, it is clear that no linguistic conclusion can be drawn from the fact, especially as in the versions which elide it most regularly, at Jaugada and Dhanli, examples are inversely found of its retention. In some instances Khalsi makes the nominative of nenter bases in a, in an and not in &: but it also contains a more considerable number of nominatives in e of bases usually treated as neuters; on the other hand, in one instance, Jaugada writes anusasanari. Rapnath writes chhavachhare and chirathitike, arad have, pakare, bat, also, satileke, apaladhiyena, and ahale; and if it is admitted that it throughout retains the initial y, it must not be forgotten that it is short, that it has only three such examples, and that it is impossible to assume the existence of a peculiar dialect from such a detail, in the face of its otherwise perfect agreement with those inscriptions which more nearly resemble Magadhi. It is plain, however, that we must not neglect sporadic discrepancies. They have a certain significance which should be cleared up. This problem appears to me to be an easy one. It will solve itself when we have elucidated one point, regarding which people have, I think, come to wrong conclusions. It has been admitted hitherto that each of the versions of the edicts faithfully represents the dialect of the country in which it has been engraved. I believe that
Page #183
--------------------------------------------------------------------------
________________ JUNE, 1892.] THE INSCRIPTIONS OF PIYADASI. 173 this is a mistake, and that the deductions, which have been formed on this basis, are altogether unfounded. A priori it would be extremely surprising that a single dialect should have reigned, without rival and without shades of difference, throughout the whole of north and north-eastern India, from Khalsi to Jaugada, by way of Bairat and Rapnath. Our scepticism will be found to be strengthened by several particular reasons. According to this theory, at the time of Asoka, both at Dhauli and Jaugada, as well as at Rupnath and Allahabad, people must have employed a dialect which made nominatives masculine of a-bases terminate in e, and which changed r into l. This I shall, for the sake of brevity, term the Magadhi of Aboka. Now the inscription of Khandagiri, quite close to those of Dhauli and Jangada, the date of which cannot be fixed with accuracy, but is certainly not more than a century later than the monuments of Piyadasi, and which appears to emanate from a local sovereign, makes the same nominatives in o and the locatives in e, preserves the etymological , and in a word presents none of the characteristic traits of this dialect. We are thas led to think that Asoka's dialect was not that of the country. The ancient inscriptions of che Bharhut stupa, mid-way between Rupnath and Allahabad, perhaps contemporary with Piyadasi, of a surety not much later, and which are certainly expressed in a language analogous to the local idiom, present no trace of Magadhism. So also at Sanchi; yet General Cunningham has discovered there a fragment of an edict which, with a probability almost equivalent to certainty, he attributes to Piyadasi. Now, in this, fragmentary as it is, the nominatives in e, words like chilathitike leave no room for doubt. It was written in Magadhi. But all the native inscriptions found in the same looality, either contemporary with it, or belonging to a very nearly contemporary epoch, agree without exception in the use of a Pruksit free from Magadhisms. In the other localities we are not so fortunate as to be able to use parallel monuments for controlling the apparent evidence of those of Piyadasi, but these facts are sufficiently significant. Evidently, the use of the Magadhi djalect in his edicts does not prove that it was current and in vulgar use in the localities where they have been found. The conclusion readily presents itself to our minds, It was in Magadha that the head-quarters of Piyadaei's empire was situated. Magadhi must have been the language of his court, and nothing can be simpler than to suppose that he used it throughout the extent of his dominions to address his people, and moro spocially his officers, the representatives of his power, But then, it will be said, how is it that the inscriptions of the extreme north-west and of the coast of Surashtra escape this common level ? The question appears to me to be capable of two explanations, each of which strengthens the other. No one, I think, doubts that it was in the north-west and west that a graphic system, adapted to the necessities of Indian languages, was first elaborated. At least the inscriptions of Kapur di Giri and of Girnar testify that in each case there had been already constituted a peculiar graphic system with its own traditions. 1 At the other extremity of India, in Ceylon, we find a sign which favours this theory. However great, 48 regards details, may be the exaggerations of the Sinhalese traditions with reference to the conneotion of Aboka with Tamraparpi, the testimony of Piyadasi himself would appear to indionte that he held oertain relations with that distant island. That he profited by these relations to help forward the diffusion of Buddhism, his seal and the analogy of his conduct elsewhere do not permit us to doubt. It is hence the more interesting to follow up the traces, which have, in several instances, been pointed out, of the infuence of the Magadhf dialeot on the ancient language of Ceylon. The moat ancient insoriptions which have been found in the island are without doubt of sensibly later date than Piyadasi. This interval explains the alterations which the MAgadht tradition has under. gone from the time of the earliest insoriptions. The fact itself of ita introduction, which it is diftioalt to refer to any author except Piyadasi, only stands out the more clearly from the persistence of certain traita, I do not speak merely of grammatical peculiarities: the locative in si, nominative in , &0., which have been pointed out by P. Goldschmidt (Ind. Ant., 1877, p. 318, of. Rhys Davids, Ind. Ant., 1879, pp. 188 & ff. d. Maller. Ancient Inseript. of Ceylon, p. 8; and the recent observations of Prof. Kern in the Bijdragen tot de Tral, kunde van Vederl. India, IV. 10. p. 562). Two palieographic facts are equally characteristio. One is the adoption of the siam A before its limitation to the palatal $ (see below), and the other is the absenos of the palutal, not employed in the official writing of Piyadasi, and which we see, for example, in the inuoription of Kivindo (E. Mullor, No. 57) expressed by the compound ny, in savanyutipeta. It in, therefore, probable that Piyadasi had dirootly or indirectly transferred to Ceylon, as he had done to the provinces of his empire, the methode pooullar to hie Magadht system of orthography,
Page #184
--------------------------------------------------------------------------
________________ 174 THE INDIAN ANTIQUARY. JUNE, 1892. These were facts which Piyadasi found established, and which he was obliged to take into his calculations. In the second place, it will be remarked that the two systems of spelling, or, if it is preferred, the two dialects used by Piyadasi, exactly coincide with the distinction between his immediate dominions and the merely vassal provinces, which, I believe, I have established by arguments perfectly independent, and having no reference to the facts which we are now considering. It was quite natural that Piyadasi should accommodate himself to the local customs of regions which were only indirectly attached to his empire, and in which traditions must have existed which it might have been both suitable and convenient to respect. Certain useful indications can be drawn from the inscriptions. The various versions are not equally consistent in the application of orthographical peculiarities which correspond to dialectic differences. Even at Dhauli and Jaugada, where the initial y is most regularly elided, it is occasionally retained: ye (J. det. I. 4); yi (Dh. IV. 17); ye (Dh. V. 20; det. I. 8); at Khalsi and on the columns this is much more common: at Rupnath, the y is retained in the only three words in regard to which the question could be raised ; at Bairit, we have, side by side, an and ya. On the other hand, it is at Rupnath that we find two or three words in which the ris retained and not replaced by l. As a general rule the distinction between masculine and neuter is lost in the Magadhi of the inscriptions, both genders making the nominative in e. Nevertheless, at Khalsi, it would appear that we have some nominatives masculine in 8 (satiyaputo, II. 4; Kelalaputa, ibid. ; so, V. 14; cf., also, lajano, Il. 5), while neuters very often have the nominative in an. These inconsistencies can be explained in two ways. They result either from the influence of the learned language, or from the sporadic action of the local dialect entering into the official Magadhi. I do not venture to decide. Other irregularities, such as those which we meet at Kapur di Giri and at Girnar, are inverse cases. Thus, we have frequently in both versions nominatives singular in e (1) both for masculines and neuters. I may quote at Girnar : pradesike, yute, yarise, bhutapurve, vadhite, tarise, apaparisave, devanampiye, seste, kamme, dhamacharane, manigale, dasane, dane, vipule, karime, mule; at Kapur di Giri: antiyeke, si, athi, sakali, mate, turamaye, jive, bhutapurve, radhite, tadice, dane, niche, darsane, ete, ye, kalavi, hati, yi, nichi, vijite, ghatiti, mahalake, likhite; at Kapur di Giri, several locatives in asi (mahan asasi, I. 2; gananasi, III. 7; yutasi, V. 13; orodhanasi, VI. 14; &c. are contrasted with the ordinary form, which is in e. It is clear that these accidental forms cannot be explained in this case by the influence either of a learned language, or of a popular one. They are so many Magadhisms, whose only possible source can have been the influence of the Magadhi officially employed by the suzerain of the states. To sum up, the inscriptions of Piyadasi divide themselves, from a linguistic point of view, into two series, of which one, that of the north-west, betrays by certain, though not very important, indications, the existence of a dialectic sub-division. The other must represent the official language of the royal chancery. They bring before us two strongly contrasted orthographical systems; the one more nearly allied to the popular speech, the other with a greater tendency to approaching etymological and learned forms. Neither the one nor the other is subject to definite rules;- neither the one nor the other escapes individual discrepancies, or certain local influences. We shall see from what follows, and it is this which gives these facts a real interest, that this state of things marks the first phase of an evolution which was destined to accentuate itself more and more as it pursued its course. We shall see, in the epoch which follows, on the one hand, the Mixed Sanskrit, on the other hand the monumental Prakrit, each continuing in parallel lines the tradition of which we here grasp the most ancient manifestations. On several occasions, in the remarks which precede, I have been led to speak of "a learned language," and "a learned orthography." These expressions might lend themselves to
Page #185
--------------------------------------------------------------------------
________________ JUNE, 1892.) THE INSCRIPTIONS OF PIYADASI. 175 misconceptions which it is my duty to prevent. Now that I have explained myself regarding the popular language, it remains to determine, so far as we can from the indications at our disposal, what was the linguistic situation from the point of view of this other most important factor, Vedic or Classical Sanskrit. Palaeographic facts here hold the first place. Some are common to both of Piyadasi's modes of writing, others are peculiar to only one or other of them. The north-western alphabet possesses no special signs for marking the long vowels. It is quite true that many languages are content with a similar notation, but Sanskrit does not present itself to us under ordinary conditions. A language partly artificial and used only by the learned, leaping into existence, after a long preparation, ready made and almost immutable, it had a grammar before it was put into writing. Neither in its orthography, nor in its grammatical forms, does it shew any sensible trace of progressive development. It could only be put into writing, at the time when it did commence to be written, under the same conditions as those under which it has continued to be written. A language thus elaborated must have imposed beforehand the power of distinguishing long vowels on the alphabet, by means of which it was intended to record it. An alphabet, which was not capable of making this distinction, would certainly never have sufficed to record it. I may also mention a peculiarity which is common to both methods of writing. I have just now drawn attention to the fact that neither of them represents the doubling of identical or homogeneous consonants. Now, from the time when Sansktit first makes its appearance, it observes this duplication, wherever it should be etymologically expected. No one can imagine either the Vedic Sanskrit or Grammatical and Classical Sauskrit being written without obserying this practice. But, once established for the learned language, this duplication could not have failed to introduce itself into the popular orthography, as we shall see did actually occur in the case of the literary Prakrit. It will, therefore, be asked how the orthography of the dialects, which we are at present considering, did not, of its own motion, adopt so natnral a usage. For my part, I only see one satisfactory explanation, the persistent influence of the Semitic method or methods of writing upon which the alphabets of Piyadasi were founded. A long effort was necessary to overcome this influence, and the sequel will shew how the new practice is exactly one of the traits which characterised the constitution and expansion of the literary language. The Indian alphabet, on the other hand, did possess special signs for the long vowels, but when it is considered that at Khalsi, and perhaps at Bairat and Rupnath, there are no signs for i and i long, and that in the other versions instances of inexactness in the notation of long vowels are continually met with, it will, I think, .be unhesitatingly concluded that, at the date of our inscriptions, a fixed, arrested form of language, liko Sanskrit, had not yet been established in general use, for it would not have failed to act as a regulator and model for the popular languages, or to introduce into their orthography the precision, the unity and the consistency in which they are so much wanting. The Indian alphabet of Piyadasi has only one sign to represent ; whether it precedes or follows a consonani. Would this have been possible it that alphabet were used to record Sanskrit? Now, it is actually in the period which immediately follows, that it develops new resources in this respect. From the time of the inscriptions of Managhat, we find the definite notation of r after another consonant well established, and, shortly afterwards the same sign transferred to the top of the consonant which it accompanied, served to express an antecedent r. At Bharhat, as in later times at Nanachat and elsewhere, rafter a consonant is placed blow it, citizer in its zigzag form ($) as in ohraniti, or in the perpeudicular form, 44 iu o of brahma. (ct. Cunnilyham. Bharhut Stupa, Inscrip. Nos. 76, 97, 89.)
Page #186
--------------------------------------------------------------------------
________________ 176 THE INDIAN ANTIQUARY. [JUNE, 1892. We can also assert that the sign for the vowel ri did not yet exist in the time of Asoka. The reason is simple, and is quite independent of any a priori argument. It is clear to every one that the sign J of the vowel ri, in the most ancient form in which it appears, is derived from the sign used to mark r in composition with a preceding consonant, viz., J; and we have just seen that this sign did not develop till after the time of Piyadasi. Another lacuna is more significant still; it is the absence of three distinct signs corresponding to the three sibilants of the learned orthography. I am now speaking only of the Indian alphabet. Khalsi allows us to show that this absence was perfectly real, and that it was neither voluntary or merely apparent. It will be remembered that Khalsi, in addition to, the ordinary sign for s, also employs another form, . This s has been considered as representing the palatal . It is true that this last letter has an identical or analogous form in the most ancient inscriptions in which it appears, i.e., at Nasik and at Girnar. But we must understand matters. It is not possible to admit that, at Khalsi, the first edicts and the last ones differ between themselves in dialect, and I consider that the conclusions to which I came in the Introduction of this work are unassailable, that, at Khalsi, is merely an alternative graphic form of . Other facts confirm my opinion. The sign reappears in the Edict of Bairat, and in the two inscriptions of Ramnath, the first presents only a single example, in the word starga, in which the palatal e has no right to exist. The inscriptions of Ramnath are, unfortunately, either badly defaced or very badly reproduced. Such as we have them, they do not lend themselves to a translation, or even to an approximate interpretation; all that we can remark is that the first uses the sign and that alone, and the other sign d and that alone. This is a very strong reason for considering that the two signs are simple equivalents. The demonstration is completed by facts drawn from the other end of India. Mr. Rhys Davids (Ind. Ant., 1872, p. 130) was the first to point out, in the most ancient inscriptions of Ceylon, the parallel use of two sibilants and A. The second is clearly only a modification of the of Khalsi or of its prototype. Since then, Dr. E. Muller (Ancient Inscript. of Ceylon, No. 1) has published one in which the form alone figures. He has drawn from these facts (p. 16) the only reasonable conclusion, that which Mr. Rhys Davids had already very justly put forward, that the two signs express indifferently one and the same sound. We cannot come to a conclusion for the north different from that to which we have come for the south. The distance between the two localities of occurrence, and the absolute analogy of the facts prohibit us from thinking of a dialectic differentiation between the two sibilants. The sequel of paleographic history shows us that the form came to be subsequently employed to express the palatal e, when a need to express it, that is to say, to write in Sanskrit, was experienced. At the time of Piyadasi, the Indian alphabet did not yet possess the palatals; and it therefore had not yet been applied, in anything like a regular and consequent way, to the learned language. - Another strictly parallel fact indirectly confirms this. By the side of c, the inscription of Khalsi, in its second half, frequently uses a form . Dr. Buhler (p. 26) transliterates it by sh, and approves of my having recognized its relationship with the cerebral sh of the complete alphabet. I fear that there has been a misunderstanding here. I do, it is true, believe that the of Nasik and of Girnar (Rudradaman) is derived from this , but I in no way believe that this last form had the value of a cerebral at Khalsi. In spite of the transliteration sh, I would not venture to assert that such is even the opinion of Dr. Buhler, and in any case I could not agree with him if it is. The sign does not appear till about the 10th Edict, and only becomes common in the 11th, 12th and 13th, although the form is not absolutely unknown to the former ones, as we have it also in the 4th Edict, 1. 11. In the more than 110 instances in which Dr. Buhler reads sh at Khalsi, there are only thirty in which the cerebral sh could be expected. Under these circumstances, and the transition between the forms du and being easy, the steps being marked out.by several intermediate shapes both at Khalsi and elsewhere, it is absolutely impossible to consider the sign as anything other than a graphic variant
Page #187
--------------------------------------------------------------------------
________________ 177 JUNE, 1892.] SACRED LITERATURE OF THE JAINS. of d. The perfect indifference with which the engravers use one sign or the other is really quite evident. All that has happened is the same as what we have already proved for. In subsequent times advantage has been taken of this duplication of forms to apply one of them to the notation of the cerebral sh, and it has become fixed in its new function, but the fact is later than our inscriptions. To sum up, neither the North-Western nor the Indian alphabet could have been at this epoch used to write Sanskrit. The Indian alphabet, the only one of the two which subsequently became applied to Sanskrit, appears before us in the condition of undergoing the modifications, which eventually prepared it for that role. We know of no trace of any different alphabet, which could have served for tho notation of Sanskrit, and we are driven to the conclusion that at the time of Piyadasi Sanskrit had not yet been written, and, as all our arguments apply equally to the religious, (Vedic) language, the conclusion holds equally good for it as well as for classical Sanskrit properly so called. Between these two languages there is, however, one important difference. The elaboration of classical Sanskrit could only have taken place with a view to a wide, profane use, with a view to a written use. To say that it was not written, is to say that it did not yet practically exist, at least in its ultimate form. But it is not so in regard to the Vedic language. Not only could its essential monuments exist in an oral state, but they could have been, in this form, the object of a culture purely oral, and more or less complete. Eminent Indian scholars have considered and still consider that the composition of the pratieakhyas does not imply the use of writing. I need not here expatiate on a subject to which we shall again be conducted by the conclusions of the following chapter. These remarks have merely for their aim to put forward (while we explain it) an apparent contradiction between these two propositions: on the one hand the paleographic condition of our monuments proves that the classical idiom which subsequently took so prominent a position had either not received as yet its complete elaboration, or had at least not yet been regularly written, while, on the other hand, the orthography of the popular dialects as it is reflected by our monuments, reveals the action, more or less latent, none the less certain, of a previous philological culture. It is to the oral tradition of the religious literature, to the efforts for its preservation and for its phonetic analysis, of which it was the cause, that we have to trace back this influence. The reader cannot fail to remark how happily this origin accounts for the peculiar character of the action, unequal and indirect, incomplete and accidental, which we have been able to describe. WEBER'S SACRED LITERATURE OF THE JAINS. TRANSLATED BY DR. HERBERT WEIR SMYTH. (Continued from page 113). XXXIV. The Tenth painnam, virathaa, virastava, in 43 vv. Enumeration of the names of the siri Vaddhamana [145] (v. 4). It begins: namiuna jinam jayajivabamdhavam bhaviyakusumarayaniyaram 1 Viram girimdadhiram thunami (ataumi) payatthanamehim 11111 It conclades : iya namavali samthuya siri Virajinimda mamdasnnassa (npassa ?) viyara karunao Jinavara 1 sitapayamanahatthiram (?) Vira! 11 43 I The gachhayaram, which in V., in the Ratnasagara, and in the second collection of all the painnas that I have before me, is cited as a part of the collection (see pp. 429, 431) contains in 138 vv. general rules of life, especially those for the bhikkhu and bhikkhuni, in the form of a lesson to Goyama, who is several times mentioned in it. It begins: namiuna Mahavtram gachchayaram kimchi uddharimo suasamuddao 11111 atth' ege Goyama! pani I je ammaggapaitthie gachchhammi samvasittanam 1 bhamai bhavaparam param II 211 The metre is almost everywhere sloka, thongh two syllables are often counted as one, one short being cast away; so for example in v. 15: samgahovaggaham vibina na karei a jogani samana
Page #188
--------------------------------------------------------------------------
________________ 118 THE INDIAN ANTIQUARY. (JUNE, 1892. Bamanim tu dikkhitta I samayarith na gahae Il 15 | vihina, samanam, samanim are to be read as disyllables. At the end it is called (see verse 1) an extract from the mahanisthakappa and the vavahara, sources which explain the use of the sloka here: mahanisihakappad | vavaharad tahe 'va ya siihu-shui-atthie i gachhayarain Hamuddhiam II 136 l padhamnsum sahuno, eam asajjhayam rivajjium uttamasvanissamdam gachhiyaram suuttamam ll 137 11 gachhiyaram sunittaram 146) padhitti bhikkhu bhikkhuni kunantu jam jahabhaiam ) ichchhamta hiam appano H 138 !! The fourth group of Siddhanta texts is composed of D. the six chhedasutras. So at least according to Buhler's List (see above, p. 226). In the Ayara vibi and in the Ratnasagara (Calc. 1880) these assert a prior place - between the upangas and the painnas. The mame chhedasutras (ehlieda, cutting, section ) can be explained in many ways. There is no authentic explanation that I have been able to discover. This name recurs in the texts in question as infrequently as in the paragraphs in the MSS. The first time where it is mentioned, so far as I know, 60 is in the Avasy, nijj. 8, 66: jam cha mahakappan7 jania sesani chhea suttani, from which passage it is clear that then, besides the mahakappan, there existed several other texts belonging to this group (kalpadini Schol.); and in another passage of the above cited work (16, 100), there are enumerated three texts which, at present, still bear this name and which state that they were divided just as we find them. They appear [447] to belong together after a fashion and to form a united group. In the enumeration of the anamgapavitha texts in the Nandi, in the Pakshikasutra and in the three samacharis we find these texts arranged in the same order insapan, kappassa, vavaha'assa). In the samacharts, in the passage in reference to the number of daya necessary to learn them, we find that but one sayakkhandha is allotted to them all: kappavavaharadasanam (80 Avi., Svi., dasakaorunam V.) ego suakkhandho. The Vidhipr., however, states that some (kei) "kappavavahara namn bhinnar suyakkbandham ichhamti." The title chheasutta is not mentioned in this list of the anangapavithas or angabahiras, which cites, in addition to the three texts held to be chheasuttas, two others immediately afterward, one name alone intervening. These additional chheasuttas are nisiha and mahanisiha, which now stand at the head of the chhedas. The mahakapparuam (see p. 478), too, is found in the list, but in a different place - abont 24 places previous. From this we draw the conclusion that the author of the list did not regard the malkkappasuam (see p. 478) as belonging to these chheasuttas. The mabukappa(r) is mentioned in no other passage. In all other passages, where the chhedasutras are enumerated, the nisiham is invariably placed at the head of the list. Thus in Avi., where the number of days necessary for learning the ehhedasutras is stated, (448] there are enumerated as the "chheaggartha" (here placed between upaigas and painras; see p. 446) the seven names : nisiha, dasa, kappa, vavahira, mabanisiha, pamchakappa and jfakappa. The panchakappa is mentioned also under the paznnas. Cf. above, pp. 427, 430. The case is similar in Svi., where, however, the name chheao is omitted, and the discussion on this subject is inserted between that concerning aigas 4 and 5. In Svi. only siha, dasa, kappa and vavahira are treated of together, parchakappa and jtakappa not being mentioned, and mahi nisiha is disposed of at another place, viz. : - at the end of the entire jogavibi after the painnas. V. agrees herein with 65 An older form of the name is perhaps chhaaua, chhedasruta, thus incitation in the Vichkrimrita sangraha: "nistham- Aiya sa chheasusta"; chhedaeamgha, too, is found in the same place (Hee p. 430), where it is said that they are five in number. 66 The name of the second group of the charittagunapramina in the Anayogady Arasiltra - ehhedavaddbavaniat cbar-may be recalled in this connection. 67 According to the Scholinat those texts are borrowed from the dithivha (anga 19), and, consequently, are to be regarded as rishibhAshita : mahAkalpabrutadinam api rishibhashitatva(a) drishtivadad uddhitya tisht pratipidit. strat dharinakathanuyoga vva (o gatva cha ?) prasamngah. dasa uddesapakala dasana, kappassa haristi chhach cheva i dasa cheva vavaharassa hurti savve vi chhartl sau 11
Page #189
--------------------------------------------------------------------------
________________ JUNE, 1892.] SACRED LITERATURE OF THE JAINS. 179 Svi. completely, with the exception that, as Avi., it adds pamchakappa and jiakappa to nisiha, dasa, k. and vav. In the metrical portion at the close, the jogavihanapagarana, however, the first four are treated of either as to be learned together in 30 days or as "savvani vi chheasuttani," v. 22. In the next verse (23) there are statements concerning jiyak. and pamchak. (mahanisiha is not discussed till vv. 63, 64). In the Vicharamtitas, the chheasuam is called nisiha-m-aiyam - on jitak., pamchak. see p. 430 -- ; and in the commentary on the sraddbajitakalpa -- see below - sri nisithadi chhedagranthasutra is spoken of. We find that this agrees with Buhler's list (above, p. 226). Besides this arrangement which places nibitba at the head we meet with statements in modern sources in which the number composing the series varies in many ways. The series, as we have seen above, was never fixed, continually varying between 4 and 7 members. [449] In the Ratnasagara (Calc. 1880) we find the following arrangement : vyavahara. vsihatkalpa, dasabruta, nisitha, mabanisitba, jitakalpa. These names are the same with an exception in the case of jitakalpa (Buhler has panchakalpa ; Avi. bas both names). The arrangement of Raj. L. Mitra and after him that of Pandit Kashinath Kunte, taking its rise from the Siddhantadharmasara, is very remarkable. See my remarks on p. 227. The uncertainty of modern tradition may, it is true, create an impression unfavourable to the age of the chhedasutra texts which we possess. On the other hand, there are sufficient arguments which permit us to ascribe a relatively ancient date to the chief group at least, i.e. the three texts : dasa-kappa-vavahara. The order which I have here followed is, without doubt, the old arrangement, though, for convenience sake, I adopt that of Buhler from this point on: vavahara, dasi, kappa. We must here consider the statements of tradition in reference to the origin and composition of these texta. Haribhadra, on Avasy. 6, 88, explains the third of the three forms of the samachari which are mentioned in the text : Ohe darah payavibhage, the padavibhagasa machart by chhedasu. trini, and, as we have seen above, p. 357, he states that this is chhedastralakshanan navamapuryad eva nirvyadha. On Avaay. 7, 64 he limits the equalization of the padaviochart to kalpa and vyavahara (sa cha kahararapa). The same statement exists in the avachuri composed A. D. 1383 by JnanasAgara on the Oghaniryukti : (450) padavi'cbari kalpavyavaharau ; and purva 9 (vastu 3, prabhsita 20) is referred to as the source - see above, p. 357 - whence this BhadrabahusvominA nirvyddha. The composition of these two texts, kalpa and vyavahara, is frequently referred back to BhadrabAha, who is said to have made use of the same sources as they. But in the rishimaudalasutra (Jacobi, Kalpas, p. 11), (p. 472) the same is asserted of the third member of this group of texts, the dasia. We have consequently here, as in the case of apanga 4, to deal with an author whose name is specially mentioned. Whether this claim is correct or not (we will refer to this question below), the connection with the pavvas According to tradition, is significant. The contents of the existing chhedasutras makes it probable that a large portion of them is of considerable antiquity. This contents refers in general to the clergy and the rules of conduct prescribed 70 for them, though there is a large admixture of subsidiary matter of a legendary character (e. g. the entire Kalpasutram). The first two rules, according to the existing order, refer to expiations and penances (prayaschitta); while all the rest contain general matters referring to discipline. # The same is asserted of the nistham ; see p. 4630. 70 It corresponds consequently to the vinaya of the Buddhists with which, despite all differences, it is olosely connected in contents and in style of treatment. 71 The expression glattha in the last verse of Dharmaghosha's sraddhajitakalpa (see p. 478), tratirg ftho prayas. ohitta, is explained in the anonymous scholiast thereupon by gttArthAh briniefthAdiohhedagramtha ft rarthadharAb, i. e. gita is explained by chhedagrarnthastra. Dh. recommends to the glattha the correction of a work, which ho conceives of as being closely connected with the chhedasutras. This name glta does not agree particularly well with the form of the text of the existing ohhedastras, since a large portion of the latter is composed in prose, and floka not gath& is the prevailing form of metre in the metrical portions. Cf., however, the name of the sixth book of the second chhedas.
Page #190
--------------------------------------------------------------------------
________________ 180 THE INDIAN ANTIQUARY. [JUNE, 1892. [451] There is other testimony of an external character which makes for the antiquity of the chhedasutras. The first of these is, as is well known, closely connected with anga 1, and is, in fact, called a part of the latter (p. 254). Chhedasutras 2, 4 bear the stamp of antiquity because they resemble angas 1-4 as regards the introduction, and because chndas. 2-5 resemble the same angas as regards the conclusion.72 The ancient date of chhedas. 4 is eo ipso attested by the thoroughgoing mention of it and its ten sections in anga 3, 10. The testimony is not so favourable in the case of. chhedastra 2. It must be ascribed to a somewhat later date from the fact that it contains a polemic against the ninhaga, a mention of the dasapuvvin etc. See below. We have exact chronological data for the Kalpasutram, inserted in chhedas. 4. See p. 472. It is remarkable that there are old oommentaries called bhashya and charni,73 composed in Praksit, the first kind of texts written in gathus, the second in prose, on three of our texts : -- nisiha, vavahara, kappe. The Nom. Sgl. M. of the 1. Decl. ends invariably in o and not in e; and extensive use is made of the insertion of an inorganic m. The Prakpit shows many traces of a later age, e. g., we find the thematic instead of the declined form. Further. more, the fact that these bhashyas (452] are, for the most part, composed in gathis, whereas the verses in the chhodasutras are mostly slokas, deserves our attention. The extent of each of the texts is as follows: -1, nistham 812 (or 818) grahthas, - 2. mahanisiham 4504 gr., - 3. vavahura 500 gr., - 4. dasabrutaskamdham 800 gr., exclusive of the kalpasutra, that contains 1254 gr., - 5. brihatkalpa 475 gr., -6, pamchakalpa (is wanting). xxxv. First ohhedasatram, the nisihajjhayanam. This name is explained, strangely enough, by nisftha, though the character of the contents would lead us to expect nishedha. In the scholiast on Uttarajjh. 26 , nisihiye is paraphrased by naishedhiki; and so in the scholiast on Dasa vealia 5, % : asamamjasanishedhun naishedhiki; in the spholiast on Avaby. 7, 1, and on Anayogadv. introduction (21 in 4) where Remachandra explains it by savapari. sthapanabhumih. The statements in the text in Ayaay. 7, 88 fg. are decisive: - jamha tatths nisiddhd tenam nisihia hoi ll 33 11 .. jo hoi nisiddhappa nisihia tassa bhAvad hoi 1 avisuddhassa nisihia kevalamittam bayas saddo Il 19 Il; in 10, 40, 41 we read baddham abaddham ta suam, baddha to duvalasamganiddittham | tavvivariam abaddhan, nisiham anis iha baddham tu | 40 | bhu& parinayavigae saddakaranam tahova anisihan pachohhannam tu nisihan nisiha naman jahajjhayana Il a 11 Scholiast here74): iha baddhasrutan nishidham anishidham anishedham sha, tatra rahasya[453]pathad rahasypadeaach cha ppachhannar nisbidham uchyate, prakAsapaphet prakasopadebach cha 'nishidham, ... nishidham guptartham uchyate. From this we may indubitably76 conclude that the explanation by nisitha78 is simply an error, and is to be classed in the same category as the explanation of yvavdiyam by supapatikam and of rayapasenaiyyam by rajaprasniyam. Whether we are to understand our text under the nisthajjhayo mentioned in anga 4 (see p. 280) as part of the first anga or under the nisiha naman ajjhayanam in A vasy. 10, 41, is a matter of doubt, since its title is perhaps not passive Epachhannam (s. below), gaptartham, but active in sense. Nevertheless the statements, which (see p. 254 ff.) are found in anga 1 in relation to its fifth chala called nisiha (cf. also nisihiya as the name of ajjh. 2 of the second chala, ibid.), and in the introduction of the nisithacharni in reference to the identity of the chhedasutra with 79 It must, however, be noticed that (p. 448) in Syi. and y. the chheda texts are treated of between anga 4 and anga 5. 18 See Jacobi Kalpas. pp. 16, 25. ** padyagadyabandhand baddham, saetropadesavad; dvad. Ach&r&digaaipitakam .. lokottaran; abaddham laukikar. 76 In the enumeration of the 10 sAmky&rl (angas 3, 10, 5, 7, attarajjh. 26, Avaly, 7) the avessaye, commandments, are always found together with the nisthiya, prohibitions (Leumann). 76 Intermediate forms are nishidha - see just above - And nishitha in the scholiast onanga 1.
Page #191
--------------------------------------------------------------------------
________________ JUNE, 1892.] this fifth chala77, make at least for the conclusion that tradition regards the nisiham ajjhayanam in our chhedasutra as originally forming a part of anga 1 and separated from it at a later period. This does not, of course, exclude the possibility that the text in question existed originally as it exists to-day in an independent condition, and that it was at a later period joined with anga 1, whence it was again separated. SACRED LITERATURE OF THE JAINS. 181 In the Nandi see below. [454] the nisiham is mentioned after dasa kappo vavaharo and before mahanistham. It is, therefore, certain that our text is referred to. The statements, which are found78 in Avasy. 16, 114 (s. p. 255n) in reference to the three-fold division of nisiham into three ajjhayanas, by name ngghayam, anugghayam and aruvana, are not in harmony with the constitution of our text, which contains no trace of such a three-fold division, but on the other hand is divided into 20 uddesakas,79 containing hardly anything but prohibitions for the bhikshu.90 The words ugghatiya and anugghdeg are, it is true, made use of, but this does not presuppose a direct division into 3 ajjh.81 All these prohibitions commence with the following words (cf. the formula in the Pratimokshasutra of the Buddhists): je bhikkhu.. karei and end with karemtam va satijjai.83 We have here then a fixed canonical rule, which makes upon us the impression of being very old. At the conclusion of the udd. a penitence of one or, as the case may be, of four months is prescribed: tam sevamane avayyati masiyam pariharatthanam ugghatiyam (or aungghdeg, or chandeg) pisahe. The 20th udd. treats especially of this penitence and appeals thereby to the first udd. of the vavahara. [455] At the end there are three aryas, in which Visahagani is stated to be the writer (!): tassa lihiyam nisiham. These aryas are counted as constituent parts of the text, since they are followed by the words iti nisihajjhayane visamo uddesau sammatto. There is a very detailed commentary (bhashya) in Prakrit in aryas, akin to the prose commentary, which Jinaprabhamuni, author83 of the commentary on the paryushanakalpariryukti, mentions as his source of information under the name nisithachurni. The bhashya offers but little assistance in regard to the explanation of the words of the text, but contains general remarks concerning the contents of each of the uddesakas. It starts with a very lengthy introduction, which at the end is called pedham, i. e. pitham, cf. pithika in Malayagiri. Each of the paragraphs of the text is called sutram in every case. This commentary does not discuss the three concluding verses of the text. The writer of the Berlin MS. (Ahmedabad Samv. 1629) belonged to the stock of Ahhayadeva.85 XXXVI. Second chhedasutram, the mahanisiham. Instruction of Goyama in reference to transgressions (salla) and punishments (payachhitta, pachhitta), in 8 ajjhayanas, of which [456] ajjh. 1, 2 have a text composed partly in elokas or trishtubh, (Nom. in o) and partly in prose (Nom. in e); and in ajjh. 3 ff. many slokas are inserted. The single copy which I have by me, and that a very incorrect one, reproduces the text so very imperfectly that even the writer, 77 Silanka, in the introduction to the second erutask. of anga 2 says that the "Acharaprakalpo nisithah" is "nirvyudha" from purva 9, s, 20. (Leumann); see pages 357, 450n. 78 Haribhadra makes no statement on this head, since he holds the verses to be nigadasiddha. Cf. the five-fold division of the Ayara in anga 3, 5, 3 into: masie ugghaie, m. apugghfie, chaummasie u., cha. apuggh., cha. anugghaie Arovana. (Leumann.) 79 1 with 48 paragraphs, 2 with 59, 3 with 74, 4 with 62, 5 with 76, 6 with 22, 7 with 37, 8 with 19, 9 with 26, etc. 80 According to Kash. Kunt the nie. treats " of the duties of Sadhus, and the fines and penalties to be imposed on them when they neglect them." 51 The 20 udd. are, however, divided into 3 groups (1-5, 6-19, and 20; Leumann). 82 "Who does this or that and who does not do it." See Leumann, Aup. Glossar, p. 159 s. v. sajj (PAli sadiyati) "take," ": ""receive," accept, "permit." 88 A. D. 1307, see Jacobi, Kalpas. p. 35; also author of the Vidhiprapa, above p. 223. 4 Begins: navabambhacheramaio attharasapadasahassio veto (vedah, see p. 457) I havati ya sapamchachulo bahu bahutara padaggenam II 1 II AyArapakappassa tu.. II 2 II yaro aggamitiyapakappa taha cholia nistham ti..11311 pakappammi chaliye nisihe ya.. V. 1 is cited in the same form, by Blanka from Bhadr.'s acharaniryukti according to Leumann. 85 Samvat 1569 under Patasha Mahamada.
Page #192
--------------------------------------------------------------------------
________________ 182 THE INDIAN ANTIQUARY. [JUNE, 1892. overcome by the difficulties in his way, at the conclusion of the first ajjh., begg80, in Prakrit, that the fault be not laid at his door. He says that it is not a kulihiyam, but a text sui generis with its onixture of verses, lalf-verses, prose and even single aksharas. See my remarks on p. 472. If my explanation of his words be correct the writer speaks also of marginal glosses and of leaves that have fallen out from his original (pavvayarisa, purvadarsa). Since these words too are very corrupt, they are not to be ascribed to the writer of the present MS, which is well written to say the least, but to an earlier scribe, whose comments have always been copied together with the text. A statement in Sanskrit, of not less peculiar nature, but handed down in a very Orrupt state, is found at the end of the fourth ajjhayana, and is directed, not against the conGition of the text, but against its contents. According to this statement Haribbadrasuri had declared that it was impossible for him to believe some of the wonderful accounts contained in the text. (457] The writer first asserts that this scepticism of Haribhadrasuri has reference solely to a few of these statements and not to the entire fourth ajjh. or to the other ajjh. This scepticism, he says, was caused by the fact that in aigas 3, 4 and in upai gas 3, 4 nothing was said of these matters," na kathamchid idam kchak hye yatha." We must refer yatha to what follows, and regard the words as a kind of citation from ajjh. 4. The latter, however, does not suit the sense, which amounts to this : -cave-dwellers are able to undergo hardships for a year. The meaning of the very obscure words at the end appears to be that since this sutram according to ancient tradition is an arsham, and in this srutaskandha there are contained many excellent " ganadharoktani vedavacbanani," it is the conclusion of the writer that there is no occasion for nobelief even as regards these remarkable statements.87 The great Haribhadi asuri88 is undoubtedly referred to here, [458] who must have played an important role at the date of this remark of the copyist, to whom the polemic appeared as a bitter necessity. The wretched condition of the text is perhaps to be ascribed to the fact that the anthority of the mahanisithasutra found many opponents even among the Jains themselves. That the text is corrapt is manifested externally first of all in the imperfect tradition as regards its division. According to a special statement in the commencement of the third ajjh., after v. 3, mahAnilhasnynskarndhas8 pahamam ajjhnyannn alluddharana nima II 1!1 eyassa ya kulihiyada na da avvo buaharchiv kim tu jo chava yassa puvvayrriso asi, tattheva kattha ya silogo katthai ilgaddhan katthai payakkhara katthaitin akkharapatitiya katthai pattayaputthiyati (" marginal notes"?) kai be tinni pannapi Ova ghAi (P) bahu gamshpa (gartha P) parigaliyan ti. $7 atra chaturthidhyayane bahavah siddhantikih kechid ily Apakanna (?) samyak sudadhyity (?) evimtair asrnddadhanair asmakam api na samyak sraddhinam ity aha Haribhadrastrih: na punah sarvam eve 'dan chaturthfdhyayanam anyani v 'dhyayanini asyai 'va katipayai(h) parimitair klipakair asraddhivam ity arthol); yatah sthina-samaraya-jivabhigama-prajnapanidishu na kathamchid idam Achnkhya, yath proti (?) samt pasthinam asti, tai () guhav asinas tu manujnas, teshu cha paramadharmikapan punah punah rapti ahtavaran yarad apapattes, teahain cha tair darunair vajrasilagharat asamputair gilitanim paripidyamininam api samvatsaram yarat primavy Apattir na bhavatl'ti; vsiddhavadas tu punar yathavad idam Arshan stram, vikritir na tivad atra pratishta, prabhatha cha 'tra brutaskandhe arthah sushtv apibayena (?) satibayini ganadharoktini veda(see p. 4550) vachanann tad var athit na kinchid Asarkaniyam. 88 See pp. 371, 372. In Jinadattasfiri's ganadharasardhabata, v. 55, 114 payaranas are ascribed to him; and Sarvarajagani cites in the scholiast the following works: panchayastaka upadesapada parchalaki 'shtaka shida aks lokstat(t)vanirnaya dharmavimdu lokabimdu yogadrishtisamuchchaya darsanasaptatika nanachitraka vihanmithy Stvamamthana parchasdtraks samakritAtmanabissna samskritachaityaramdanabhashyz anekarataj yapatika 'nekintapadapravebaka paralokasiddhi dharmalobbasiddhi sastravarttasamuchchay Adiprakaranani, tAtha Avasyakavritti dabavaikAliks vrihadvritti laghuvritti pidaniryuktivsitti jabhigamaprajnapangpi gavritti pathchavastakavritti anekArtajayapata chvritti ohnitysvamdans vritti anuyogadvaravritti naudivritti sariigrahaDivritti kahetrasamleavritti Astray Art Aamushohaysviitti: arhachhricha Amani Samaridityacharita kathk06disastranArn. Not so complete are the statements in the Vichar Ampitasaingraha which contains, however, a large number of the names. In the Vio. .'s death is placed ($ 8 begin.) in the year 1050 after Vira. Probably in four dryka, though the metre or rather the text itself is very difficult to make out. The last rerae reads :- nikhittayibhittapanenade samghattenam ime mahniatha() var suyakkhardhar vottavvari cha Auttagapinagenar (P) till In the preceding verses the word abile is found three times : taie slasa uddese att ha tathera ambile jaro tarn itan chautthe vipanchamammi (!) 'ohhAmi yambile || dasa, chhatthe do, sattama tinni, Attham 'bile daba a l; this is probably s voontive to ambil," little mother," and to be explained in the same way as sundari! in panna 7 (see p. 442).
Page #193
--------------------------------------------------------------------------
________________ JUNE, 1892.] SACRED LITERATURE OF THE JAINS. 183 (a statement that perhaps did not belong to the text originally) the mahanis. consists of 8 ajjhayanas, each of which contains a certain number of uddesas, which is stated. But in our MS. there is no trace whatsoever of any uddesas. In the first ajjh. there are between the beginning and the end some SSSS numbers (31, 33, and 16, 17 for which 36, 37 are to be substituted), [459] and at the end the number 49. These numbers do not, however, refer to uddesa sections, since these are generally of greater extent, as is proved in the case of our text from the number of udd. ascribed to ajjh. 2-7. We have no statement of the kind in the case of ajjh. 1. These numbers are nine for 2, sixteen for 3, eight for 4, ten for 5, two for 6, three for 7, ten for 8. Of the eight ajjhayanas only the first six are specially distinguished, four having special names, though only those ascribed to the first two ajjh. are in harmony with the contents. The sixth ajjh: closes on f. 70a; the remainder is characterized at the close (96b) as: piiya, perhaps biiya, dvitiya, chuliya, so that two chuliya chapters are here indicated, 90 which, if added to the 6 ajjh., gives the desired number 8. In this faulty condition of the MS. it is worth while to note the statements of the three samacharis in reference to the mahan. Avi. treats of this subject (see pp. 447, 448) in discussing the chheaggantha, and states that there were 8 ajjh. with 83 uddesas. The first ajjhayanam had then no divisions of this kind and was egasaram; the second had 9, the third and fourth 16 each, the fifth 12, the sixth 4, the seventh 6, the eighth 20. The difference between this account and the information to be drawn from the MS. is very great indeed. (See above.) Svi. and V., on the other hand (see p. 448), separate the mahanisiham from the other chheda texts, and treat, at the conclusion, of the jogavihi of the sacred texts after the painnagavihi. [460] They too agree with Avi. as regards the number of ajjh. and udd. The seventh and eighth ajjh. are expressly called by V. chularava (donni chulao, v. 64). Forty-three days are necessary to learn the mahin., teyalisae dinehim ajjbayanasamatti, but as two days are requisite for suyakkhamdhassa samuddesa and for anunna, the total number is 45. The chhedas. 1, 3-5 required together only 30 days. See page 448. A statement in Wilson Sel. W. 1, 341 (ed. Rost) is of particular interest: "Vajrasvami91 instituted the Mahanisitha-sect ;" and of equal interest are the remarks of Rajendra Lala Mitra (p. 227) in reference to three different recensions (vachana) of the Mahanisitha. The question which is proposed in the introduction of chapter 22 of the Vicharamritasamgraha substantiates the belief that the Mahanisitha is tolerably old. This question is: - how is it to be explained that the prayaschitta prescribed in the Mahanisitha is not practised? The answer to this includes chhedas. 1, 3, 5, and reads:-adhuna mamdasattvaih kalpavyavaharanisithamahanisitha dinam ekatarasya 'pi gramthasya 'bhipreyena prayaschittani yatha chaddodham (? 'vasodhum) na sakyamte atas te sarvagachheshu jitavyavaharena prayaschittan(y) anucharamto drisyamte. The first mention of the mahanisiham, of which I am aware, is found in the enumeration of the anangapavittha texts in the Nandi etc., where the schol. on N. explains the word as follows: nisithat param, yat gramt harthabhyam mabattaram tam mahanisitham. [461] We have already mentioned (p. 445) that the gachhayara states that it is based upon the mahan. as its source. The introductory words are the same as in anga 1 etc.: suyam me ausam, tenam bhagavaya evam akkkayam, and each of the ajjh. closes correspondingly with ti bemi. Besides this, there is nothing which directly savours of antiquity with the single exception that the dialogue form between the bhagavant (who is addressed with (se) bhagavam and not with (se) nam bhamte) and Indrabhuti (Goyama !) is retained. This form, however, ill suits the introductory formula by which the whole is attributed to the bhagavant himself. The name of the text occurs shortly after the introduction, and is accompanied by laudatory epithets. This fact, together with the epithet mahao in the name, makes it probable The conclusion of the first chala is not directly marked off, but is to be placed on 80b, where a section closes with bemi. 91 Nominally 584 Vira, see pp. 219, 251, of. Avasy. 8, 41 fg. Ganadharasardhas. v. 23 fg. In reference to the statement above, ef. pp. 463n and 464.
Page #194
--------------------------------------------------------------------------
________________ 184 THE INDIAN ANTIQUARY. [JUNE, 1892. that it is of later date. It had need of a special sanction because of its secondary character. The words are : pavara-vara-mahnisihasnyakkhamdha(m) Bsuyanusarenam tiviham- but there follows no three-fold division. The first book is entitled salluddharanam and treats of the most various kinds of salla, salya. The repeated references to the savvangovamga are worth our notice; whence the existence of the uvamga at the time of its composition - see above, p. 373 -- is eo ipso clear. Then follows the figure of the useful co-partnership of the lame with the blind man which is specially emphasized :-hayam nanam kiyahinam, haya annanad kiya i pasamto pangulo daddho dhavamano a andhao 11 .. andho ya pamga ya vane samichcha te sampautta nagaran pavittha II. Furthermore [462] stress is laid upon reverence (vande, vamdiyya) for pictures (padima) and temples (cheia, cheialaya). A special formula seems to have been made use of in this connection, an enigmatical treatment of the letters of which occurgo nfter the fashion of the treatment of a l m (om) in the Upanishads and in similar formulas in the tantra ritual. This entire subject was a riddle to the copyist - cf. p. 456 - and so it remains for us. After the real conclusion of the work, in an addition, a similar subject is treated of in like manner merely by means of single letters. Book II. is entitled kammavivayanan, perhaps karmavipichana (cf. pp. 270, 280, 335). At the end is found an obscure statement which perhaps hns reference to ajjh. 1, 2 and which reads : eesim tu donham ajjhayananam vihi puvvagenam savvaskmannam vattelinam ti (?). Books III. and IV., without specific titles, are composed almost entirely in prose, and treat especially of the kusila. It is noticeable that in Book III. frequent reference is paid to the davalasamgam suyaninam and the samgovamga duvalasamgasamadda. The commencement with samaiya is retained (cf. p. 243), and the suyananain is then characterized as samaiya-m-ai logabimdusagara (sara !) payyavasanam (p. 245). [463] We find in the text the following statements which are very characteristic as regards the origin and history of Book III. : tattha tattha bahuehim suyaharehim sammiliunam samgovangaduvalasangan suyagamuddan anna-anna-uvargaguya(kkha)mdha-ajjhayana-uddesaganam samuchchineunam kimchim kimchin samvayyamanamettham lihiyam ti, na una sakavvakayain (svakivyaksitam) ti. This is an example of the saying qui s'excuse s'accuse. It is more probable that the above is a production of the author himself than that it emanates from the hand of a copyist who is inclined to donbt. Book IV. contains a legend of two brothers, Sumati and Nila, in which we may observe an occasional reference in Sansksit!) to an old elucidation (!) of anga 10: Sesham tu prasnavyakaranavsiddhavicharanad avaseyam.- Whoever, bhikshu or bbikshuni, should praise the adherents of hostile systems or schismatics (parapasandinam pasamsam kareyye, je ga vi nam ninhagayam p. k.), whoever speaks in favour of the schismatics (ninhaganan anukula bhaseyya), visits their temples (ninh. Ayayanam pavisiyya), studies their texts (ninh. gamthasattha Psynckharan va paravayy4), or follows their ordinance (ninh. Bankalie kiyakilesaue tayei va sanjamei va janei va vinnavei va snei va padivvei va avimuhasuddhaparisamayyagie salaheyya), his fate will be as disastrous as that of Sumati, sa vi nam, paramahammiesum uvavayyeyya jaha Sumati. The hate against the heterodox and schismatics is here so bitter, [464] that the conjecture is not too bold if we assume that the heterodox and schismatics had at that time got possession of the text of this book, see pp. 293, 368. Book V., davalasamgasuyamanasaa mavatiyasara (), mentions the duvalasanga, but amapaa mau kauttha ava | addhaina | amas um pam ap ay | An u krat pa amd om plamaa sa am bh ilnas a 11 amal khat re A sabaddha ipsum nam u eto. - In a similar manner (each of the single consonants having virama) we find the mantra composed which the Vidhiprapa cites in mentioning the Ayariyapayath vanaviht and uvajjhyapayo. These, however, commence with a um of the Upanishade. Have we here an example of the mauyskkbar&P see page 381 (with note) and page 850. * In the theravall of Kalpas., one of the four scholars of Vajra (sv Amin), p. 460, or of Vajrasens, is called by this name. He was the founder of a school which bore his name. Bhadinna, the scholar of NAgajjuna, was fro the N Ailakula; see v. 44 of the Theravall in the Nandis.
Page #195
--------------------------------------------------------------------------
________________ JUNE, 1892.] FOLKTALES OF HINDUSTAN 185 merely in a general way. It treats especially of the relation between the teacher (guru) and scholar (sisa), of the Ayara (gachhayara, see p. 445), and anayara. Book VI., giyatthavihara (see pp. 437, 450), treats of the pachhitta prayaschitta, and contains a legend of a teacher Bhadda and the ayyiya AryikA) Rayya. The mention of the dasapuvvi in the introduction brings eo ipso the date of its composition down to a period sa bsequent to that of Bhadrabahu, the last chaturdasapurvin, and to that of Vajra, the last dasapurvin. See pp. 219, 460. Books VII., VIII., which (see p. 459) are characterized as two chuliyas, a name which per se marks them as a secondary addition, treat likewise of the pachhitta, and, in fact, in such great detail, that the words kim bahana, together with the formal frame-work enclosing them, are occasionally repeated several times in immediate succession. Shortly before the close these words occar again. A legend of the daughter of Suyyasivi in Avanti plays a very pro. minent part in these books. The solemn adjaration found also in another passage) to save this satram from any damage, is another indication of its secondary origin : - jaya nam Goyama ! inam-o pachhittasuttam vochchhiyyihii taya nam chandaichcha-gaha[ 465]rikkha-taragi nam satta ahoratte ya no viphuriyya, imassa nas vochhedo Goyama ! kasinasamjamassa abhivo. To the conclusion (samnttam mahinisihasuyakkhandham) aro joined the reverential invo. cations to the 24 titthamkaras, the tittha, the buyade vaye, the suyakevali, all the sahu, siddhai to the bhagavant arahant. Then follow the incomprehensible separato aksharas etc., mentioned on page 462. The actual conclusion is formed by the statement concerning the extent of the whole book (4504 blokas) : chattari sahassa in pamcha sayaim taheva chatt&ri chattiri (again !) silaga viya mahanisihammi paenar 11 The mahanisiham is indisputably much younger than the nisiham, and is almost six times its size. It is noteworthy that this sutram, just as the fourth chhedas., according to its own statements (see above and pp. 456, 458, 461) receives suyakkhamdha, srutaskandha as an addition to its name. This is a title that is used in the case of the angas for larger divisions of an anga. But in the case of angas 3-5,7-10, up. 8-12 the expression also holds good for the whole and not merely a part. There is no commentary, as in the case of the nisiha, with the exception of the charni. See above, p. 445, for the origin of the gach hayaram from the mahanisiha. FOLKTALES OF HINDUSTAN. BY WILLIAM CROOKE, C.S. No. 1. - The Prince and his faithful friend, the son of the Wazir.1 There was once a king who had a son, and his wazir also had a son. Both were of the same age and were great friends. One day both of them planned to go and see their wives. So they went and told their fathers. Their fathers objected to their going, but they would not be dissuaded, and secretly mounted their horses and went off. The king's son first reached his father-in-law's house, where he was treated with great respect, and at night his bed was placeil on the top of the roof, but the wazir's son slept below. At midnight the prince's wife got up and dressed herself in her finest clothes, put some sweetmeats and fruit in a tray and came down the stairs. The prince was asleep, but the wazir's son woke and watched her going out. Then he followed her, and what did he see? She went to a faqir, who beat her soundly with a whip, and said: "Why are you so late ?" She replied: "I was delayed because my husband * The words, however, occur Aup. $ 48. 1 A folktale recorded from the lips of MahtAbo, an old Musalman cook-woman of Mirzapur, and literally translated. * There is an incident like this, in the Arabian Nights, of the Princess who loved the negro.
Page #196
--------------------------------------------------------------------------
________________ 186 THE INDIAN ANTIQUARY. [JUNE, 1892. came to-day." The faqir answered: "Well! Go, cut off your husband's head and bring it to me. Then I will be assured that you love me." So she went, cut off her husband's head and brought it to the faqir. Then the fuqir beat her again, and said: "Since you do not belong to your husband, whoso are you? Go, and never come near me again." Then she took her husband's trunk and head and placed them near the wazir's son. He rose, tied them up in a cloth, put them on his borse and rode off to his wife's house. There he was treated with great respect and exactly the same events occurred. For at midnight his wife got up and went out. He took his sword, followed her and saw her go to a fair. He asked her why she was late, and she answered that her husband had come and delayed her. On hearing this the faqir was greatly pleased, and said: "I will give you whatever you ask." She said: "I will consult my father and mother, and then say what I want." So she went and consulted them. They said : "God has given us all we want. Ask your husband : perhaps he may want something." Then she asked her husband and he replied: " My friend has laut his head cut off. I wish him to be restored to life." So the lady went again to the facer and asked him to restore her husband's friend to life. The fugir gave her some water, and told her to instruct her husband to sprinkle it on the head and trupk of his friend and he would recover. So this was done, and when the prince's head was joined on to his trunk and the water sprinkled over him he revived, and said: "I have had a fine sleep. What time is it?" But when he looked round he said: "This is not the place where I went to sleep." Then the wazir's son told him the whole story. The prince thanked his friend, and they stayed there. Some days afterwards they both went ont to hunt, and being tired out the prince became very thirsty. The wazir's son seated him under a tree, and went to search for water. With difficulty he found a tank and brought some water. When the prince drank he said: "This water is very sweet. I want to see the place where you got it." So the wazir's son took him there. Bat on the way he recollected that on the edge of the tank ho had seen the image of a very lovely woman, and he thought : "Perhaps he may want her." So he excused himself by saying the place was very dirty. But the prince insisted on going there, so the wazir's son could not help taking him there, but he tried not to take him in that particular direction. However, the prince would walk all round the place, and when he saw the image, he said: "I will never leave this till you marry me to the original of this image." The ecuzir's son remonstrated, but in vain. Finally, the wazir's son had to promise to search for the woman, and told the prince to sleep in a tree there until he returned. When night fell, the prince ascended a tree on the edge of the tank, and at midnight a snake came out, who hau a jewel in his mouth. When he touched the water with the jewel, it all dried up; and in the middle of the tank & door appeared. Then the snake put down his jewel, and by its brilliancy the whole place was illuminated. Then the snake began to drink the dew. When morning approached he again touched the tank with the jewel and the water returned. In the morning the prince descended from the tree. Then the prince prepared an iron trap and a rope, and again at night climbed up the tree. At midnight the snake appeared and put down his jewel ander the tree, where the prince was. When he had gone a little distance, lapping up the dew, the prince put the iron trap down on the jewel, and the moment its brilliancy was obscured the snake came up in a rage, and began to beat his head with such violence against the trap, that at last he died. Then the prince came down, secured the jewel and entered the tank. The water gave way before him ; so he opened the door and entered. When he came into the first room, what did he see but a bed of silver and over it a coverlet of silver, and on it was sleeping a silver fairy (chandi ki ek pari). She was extremely lovely, and there were two necklaces of silver - one at her feet and the other at her head. These he took up and examined and put them down, but by mistake he placed the necklaces in the The word used in taswit. + Or ruby fairy (la'l part).
Page #197
--------------------------------------------------------------------------
________________ JUNE, 1892.] FOLKTALES OF HINDUSTAN 187 reverse order : and as he did so the fairy got up and suid : "Why bave you killed my master the snake, and dared to enter here?" The prince answered: "Yes, I have killed him. Had you killed him, you would have been my mistress." Then the prince went into another room and saw & golden fairy sleeping on a golden couch. She was even lovelier than the silver fairy. Her necklaces also he displaced and she woko. She asked him the same question and he gave the same answer. Then the prince entered the third room and there he saw the red fairyt (lal part) asleep: and she was even lovelier than the other two. Her necklaces he also displaced. She also &woke, asked the same question and got the same answer. Then he went into the fourth chamber and there he saw the jewel fairy (jawahir pari) and she was the queen of all, and it was her image which was set up at the tank. When the prince saw her loveliness he was confounded and bit his finger (dant se ungli dabat). The fairy was greatly surprised how a human being managed to get there. So she asked him : " How did you find me out, and how did you manage to kill my master the snake, by a blast of whose breath a man will die ?" So the prince told her how he had seen her image, and how the moment he saw it he had fallen in love with it. "I made a vow," said he," that I would never leave this place until I married the woman, of whom this was the image." So he described to her the end of the snake, and she said: "We are all slaves of him who is master of the jewel," and she married, the prince and they lived together. One day the prince and the fairies went for a walk on the edge of the tank, when suddenly they saw an army approaching and retired into the tank. But as she ran in the jewel fairy dropped one of her shoes on the ground, Now, there was a king of another land, and he had a son, who had only one eye. He had gone out hunting and by chance came to the tank and saw the fairy's shoe. He took it and went home, and throw himself on his couch and refused to eat or drink. Then his father thought he was sick and asked him what was the matter with him. So the one-eyed prince told him the story, and said: "Until I marry the owner of the shoe I will neither eat nor drink." Finally his father induced him to get up, on the promise that he would send a wise old woman to trace the fairy. So the king called all the wise women, and asked each what her powers were. The first said: "I can make a hole in the sky." The king said: "That is no use." The second said: "I can put a patch in the sky." "You are no use," said the king. The third said: "I can neither make a hole in the sky nor patch it, but if you want any particular woman I can get her by fraud and trickery." "You are the person I want, and I will reward you nobly if you bring this fairy." So the wise woman made a flying bed (uran khatola) and came to the tank. There she stayed some days until one evening the fairies came out, and when she saw them the wise woman began to weep. Then the jewel fairy asked her what was the matter. She replied: "Why are you asking me? Don't you know me. I am your family barberecs (nain). Your mother was exactly like you, but she is dead, and you never think of me, and now I am dying of hunger." The jewel fairy believed her, and in pity took her home and entertained her. When the old woman had been there some time, one day, when the prince was asleep, she asked the fairy where his life was - whether in his heart or in something else.' The fairy replied: "Formerly it was in his heart, but since he has become master of this jewel his life has come into that." Then she had to go into the other room and the old woman snatched up the jewel. She went to the jewel fairy and found her feeding her parrot Hiraman. So she said to the fairy : "Let us take the parrot out for an airing." She agreed, and they went . We are now embarked on a variant of Cinderella. * Kane, always an evil sign in India. There is an incident like this in Old Deccan Daya, Seventee Bai's necklace held her life. For many other instances of the life index, see Wide Awake Stories, p. 104, 4. ED.).
Page #198
--------------------------------------------------------------------------
________________ 188 THE INDIAN ANTIQUARY [JUNE, 1892. outside the tank. There the flying couch was placed, and the old woman asked the fairy to sit on it. At first she objected, but finally agreed, and the old woman flew off with her, and while she was in the air threw into the sea the jewel, which contained the life of the prince. But, as it fell into the ocean, Hiraman, the parrot, was watching her. When they reached the king's palace he was much pleased, and his one-eyed son was delighted and wanted to marry the fairy straight off. But she replied: " Take care ! this old woman has stolon me by deceit from my husband, and if you say a word to me now I will burn you up into ashes. But this I will do. If any one comes to claim me within six months, I will go with him. If not I will marry you." Then she began from that day to give daily alms (sada bart) to the poor. When the wazir's son went to search for the woman, with whose image the prince had fallen in love he went wandering about through woods and lands and cities. One day he met a demon (de) and they became great friends; and the demon promised to accompany him and assist him in his enterprise. Soon after they met a monkey, and him also they took as their companion. Six months all but passed and the jewel fairy was distributing alms daily, but no one appeared to rescue her, and she was forced to agree to marry the one-eyed prince. On the last day the wazir's son appeared by chance, and he came to get alms, because he had become quite destitute. When he saw the jewel fairy he took out a picture (tusvir) of the lady's image and examined it. When the fairy saw him looking at the picture she took him aside, and he told her the whole story. She told him that she was married to the prince, with whom she was well pleased, and that the old woman had stolen her away by fraud. Then the wazir's son told her to prepare to escape with him, that he would arrange to burn the city and destroy the king's people that night, and that she was to keep the flying couch, on which she had been brought, ready. Then he went to the demon and the monkey and told them that he intended to carry off the fairy. So he instructed the demon to stand at the gate and kill all that passed, and he told the monkey to go, when an hour or two of night had passed, to the shop of a confectioner (halwdi) and take a burning stick from there and set the city on fire. So he went and sat near the place where the fairy was staying, the demon took his post at the gate, and the monkey fired the city. When the people rushed to the gate in confusion the demon began to devour them. Then the wazir's son climbed up to the upper storey. So he carried off the fairy and the old woman on the flying couch, and as they passed over the ocean the parrot Hiraman dived down and recovered the jewel; and the wazir's son dropped the wicked old woman into the sea. When they came to the tank he left the flying couch outside, and went into the underground palace. When he placed the jewel near the prince he woke and said: "I have had a good sleep." But when his glance fell on the wazir's son he was sore displeased and wanted to drive him out. But when the fairy told him how the old woman had abducted her, and how she had been recovered by the wazir's son, he embraced his friend, wept over him and thanked him. They stayed there some days, and the prince proposed to go home. When preparations were made they came out of the tank and there saw an old woman, who was weeping with one eye and laughing with the other. The wazir's son asked who she was: and he signed to the king's son to go on ahead. Then the wakir's son asked why she was both weeping and laughing. Then she said: "I am weeping because on the road by which the prince is going there is a tree, and as he passes under it the thickest branch will fall on him and he will be crushed to death. Hence he ought to avoid this tree. Then, when he comes into a certain forest a tiger will charge out and carry off him and his horse. Hence the horses should be sent alone and the tiger will carry off one of them. Then, when he arrives at the palace the iron gate will fall on him. Hence the gate should be knocked down before he approaches it and replaced by a gate of flowers. Then, when the prince sits to eat with his father there will be a great thorn in
Page #199
--------------------------------------------------------------------------
________________ JUNE, 1891.) FOLKTALES OF HINDUSTAN. 189 the first fruit he touches, which will stick in his throat and kill him, but he will escape if any one snatches the fruit from his hands and flings it away. Then the first night that he sleeps in his father's palace a snake will come down from the ceiling and bite him and his wife, so that they will die. But if any one were to sit in the room and kill the snake when he appears, both the prince and his wife will live many days. But if you speak a word of this to them you will be turned into stone and will remain stone until the prince and princess dash their eldest son apon you ; but when they fling the child at you speak not a word. But behind the palace is a tree and on this a large winged bird (garpankh) has built its nest : take some of its dung, rub it on the child and it will come to life again." So the wazir's son left the old woman and went to the prince, and they all started together. On the way they came to the tree and the wazir's son prevented the prince from approaching it. Suddenly a branch came crashing down, which would certainly have crushed him, and the prince thanked the wazir's son for saving his life. Further on the wazir's son kept the prince away from the horses, and lo! a tiger rushed out and carried off one of them. Again the prince thanked him for saving his life. When they approached the palace the wazir's son asked the prince to wait a little, and he would go ahead and announce his arrival. He went ahead and removed the iron gate of the palace and replaced it with a gate of flowers. Then he invited the prince to follow him. When the prince saw a gate of flowers instead of the iron gate he was sore displeased and said: "You have caused my father great loss." Bnt when the gate fell down he saw that he again owed his life to bis faithful friend, and promised in future to obey his advice. His father was delighted to see him again. So, when the prince sat down to eat with his father, the wazir's son stood on his right, and as he tried to eat the first morsel his friend knocked it out of his hand. Then the prince was wroth and called to one of his attendants to seize him. But the wazir's son said: "First look at the morsel you were about to eat:" and lo ! it was found to contain a deadly thorn. So the prince again asked his pardon. When the prince and princess retired to their chamber the wazir's son remained sitting outside, and when it was near midnight he took a sword and entered the room, and immediately a poisonous snake descended from the roof and approached the bed of the prince. Then the wazir's son cut the snake in pieces, but two drops of the blood fell on the face of the fairy princess and she awoke, and as she awoke, this roused the prince, who raised a sword and would have slain the son of the wazir. But he shewed him the dead snake under the bed. So he again begged the wazir's son to pardon him, and asked: "How did you learn about all these events?" So the wazir's son said: "All your dangers are now passed; and you will live in safety. But do not ask me how I acquired this knowledge, or you will repent it." But the prince said: "You shall not leave this until you explain the matter." So the wazir's son perforce had to tell all he learnt from the old woman: but as he went on with the story, so he began to turn into rtone; and when he had turned into stone as far as his breast the prince began to weep and said: "I have been very careless. Don't go on with the story." He replied: "What is the use of my living on in this state ?" If you wish to revive me again you must dash your first child at me." So saying he turned into stone, and the prince never ceased lamenting him until the princess had her first child. Then he threw the baby at the wazir's son, and ho bocame a man again, and without saying a word to any one he went off and got a piece of the dung of the large winged bird, which he rubbed on the baby, whereupon it revived and they all lived happily ever after. 8 . [I have never read a stronger instance than this tale in support of my old argumenta, that in the incidents and not in the thread of a story is to be found the true folklore tradition. Our friend MahtAbo, the cook, has jumbled together, in the most interesting fashion to the folklorist,' an extraordinary number of incidents properly belonging to different classes of tales. There is not an idea in it that could not easily be found in the various Indian tales reported already in these columns, but the general thread of the story is the well-worn theme of the friend who saves the hero at the risk of his own life. - ED.)
Page #200
--------------------------------------------------------------------------
________________ 190 THE INDIAN ANTIQUARY. [JUNE, 1892. MISCELLANEA. A NOTE ON THE TASHON AND BAUNGSHE | farmhouses; and, except at Minkin, which is a CHINS, WITH REMARKS ON THEIR MANNERS, frontier village, there was no attempt at stockades, CUSTOMS, AND AGRICULTURE. except such as had been hastily erected near Races :- Beginning from the north, we have Falam for our reception. first the Kanhos or Kanton-Kanhos, who inhabit We could also see that the authority of the the hills immediately south of Manipur. chiefs, who seem to act collectively and not South and south-east of these come the Siyins individually, is very much respected and feared. and Sagyilaings, while farther south lies the The country, so far as we could see, seemed to great Tashon country, lying in the hills drained be thickly populated, considering the enorious by the Nankape River south of Manipur and areas which it is necessary to cultivate in order extending to the Tyau, the north-eastern tributary to produce sufficient food. Indeed, I should of the Koladain; farther south lies the Baungshe think that, unless improved methods of agriculture country inhabited by the Haka, Tlantlang, and are introduced, many of the Tashons will be Yokwa tribes, and containing, besides these, many obliged to seek fresh fields before many years. independent villages stretching down to 22deg 10 Nowhere in the Tashon country did I observe of latitude. any virgin forest, except small patches near the My work has lain entirely in the Tashon and tops of high hills. Elsewhere the country is Baungshe country, and it is about these that I covered with small-growth trees, shrubs, and propose to make a few remarks. grass, which are cut down every three or four Tashons. The capital of the Tashon country is years and the land cultivated, as other clearings Falam, & village of about 400 houses Here live become exhausted through continuous cropping. Sunpek, Manlon, Kalyan, Bwemon, Winsau, and It struck me that there was a greater struggle the other Chiefs who rule the Tribe. Falam is for existence in the Tashon than in the Baungshe situated on the north-west face of the Baluma country, and that this probably accounted for the range, and looks down into the Nankabe River greater love of order which prevails. Moreover, and across its deep valley on to the steep slopes the people have little time to give to raiding, and of the northevn side, where many villages can be it is a curious fact that there are no slaves in the seen nestling on the hillsides. Tashon country. Altogether, to a casual observer, the Tashons are much in advance of the other During our visit to Falam the chiefs showed the greatest reluctance to give information about neighbouring tribes, and I have great hopes that, as their country opens up and their people begin their country or its resources. Moreover, they to find that money and food can be easily obtained pretended to be unable to give us a list of their by labouring in Burma, we shall get them to work villages, and we had to be content with knowing their boundaries, which they said were the on our roads and other public works. following: - Baungshes.-The Baungshes are known as On the North.-The Siyin, Sagyilaing, and ! Poi to the tribes on the Bengal border. Kanhd Country. They are also called Poi by the Tashons. The On the South.-The Yokwa, Haka, and termn Baungshe is a Burmese word which simply means "long turban." I could see no difference Tlantlang Tracts. between the head-dresses of the Hakas and the On the East.-The MyitTha Valley and the Tashons, but to the Burmese the word Baungshe Yomadung, west of Minledavng. has a well-defined meaning, and does not include On the West.-The Tyau River. the TashOns, who are known by the latter name For the reasons given above, we could get little only. I have already defined the area inhabited information regarding their manners and customs, by the Baungshes, by which term I propose to but, from what we could see, it was abundantly denominate them. clear that some sort of law and order prevails, Baungah Language.-The language spoken by and that there is considerable security for life the Baungshes resembles that of the Tashons in and property. This last was evidenced by the so many respects, that both appear to me to be fact that in the Karon Laiyo Valley we came simply dialects of the same language. Even upon single homesteads built here and there like amongst the Baungshes themselves there is some Printed originally as a Gover riginally as a Government paper, by the Chief Commissioner of Burma. The notes were made by Mr. D. Rosa, Political Officer in the Chin Hills
Page #201
--------------------------------------------------------------------------
________________ JUNE, 1892.] MISCELLANEA. 191 diversity of tongue, but the differences are dialectic, These are killed outside of the village and the and are never so great that an intelligent man head is cut off and roasted on the spot and is from Haka could not find his way about any part eaten by the Tlang Bwe and the people of the of the Baungshe country. village. The rest of the flesh is divided into To the south of the Baungshes, between them portions, one for each family, the Tlang Bwe and the Chinboks, there are a number of large taking two shares. villages, whose inhabitants are said to speak a Sacrifices to the minor spirits can be made tongue which is not understood either by Baung- without the intervention of the Tlang Bwe. When shea or Chinboks. . These people dwell about the a man decides to make a sacrifice he hangs headwaters of the Myitpa, and seldom or never bunch of green leaves at the entrance to his house, come down to Burma. Consequently little is which the neighbours know to be a sign that he known about them, but I hope it will be possible is offering to the spirits and, therefore, must not to study them soon. be disturbed. Origin of the Baungshes :- To return to the During the day the person making the offe Baungshes and their origin. I have been unable must not talk to any one, neither may he do any to meet anyone who can throw even a legendary work. For sacrifices of this kind a young cock light on their history beyond five or six genera. or a mole suffices. tions. The office of Tlang Bwe is an hereditary one in This is not hard to explain, when we remember Haka, and some peculiar privileges are attached that they have no written language and no means to it. For instance, if a maiban cow anywhere of recording dates. The Chin has no names in the Haka circle outside of the mother village for the months or the days of the week, and gives birth to a calf, the Tlang Bwe receives a no division of time except into the wet, cold, basket of millet or some other grain. &nd hot seasons, and the changes of the moon, Funeral ceremonies.- The Ching bury their day and night, and morning, noon, and evening. dend in deep graves dug inside the house enclosure. The headmen of Haka, while knowing nothing A chief is buried in a sitting posture with his of their origin, say that all the other villages of chief's plume on his head and his best clothes the circle are offshoots from the parent village. on. In cases where a chief leaves no son his gun is buried with him. The funeral, like all other Religion.-The Chins are spirit-worshippers, events in a Chin's life, is celebrated with feasting and offerings are made to the spirits who control and drinking, tinged with a strain of mourning. their destinies. The nats (spirits) have each a local If a Chin is killed by enemies, it is not considered habitation and a name. There are five altogetherlucky to inter his body in the village, and accord. near Haka, and of these the greatest of all and ingly it is buried outside. I saw an instance of the most powerful is the Rong Nat, whose this at Yokwa, where a new-looking grave was home is in the thick forest on the Rongtlang pointed out to us as the burial-place of a man, Peak. After the Rong Nat comes the Mwe Nat, who a few weeks before had been shot by a patrol whose favourite haunt is the neighbourhood of a west of Gango. large tree below Haka village. Other minor nats are the Hengtan Arman Nat, the Koring Nat, Laws. Amongst the Chins certain customs have obtained the force of law, but in general and the Naurai Nat. they have no recognized means of enforcing In Haka there is a high priest, called the Tlang these customs, except in very small matters, and Bwe, without whose presence no sacrifice may the only real law is the law of might. Adultery be made to the Rong Nat or the Mwe Nat. He it is theoretically punishable with death, but the is who makes the incantation over the animal be. carrying out of the law depends on the social fore it is slaughtered. In general the Rong Nat standing of the parties. For example, a chief's and the Mwe Nat are asked that the rains may be son may commit adultery with the wife of a abundant, that sickness and pain may not come poor man, or of a slave, and he is protected by amongst the people, that they may be successful his position and the influence of his friends. against their enemies, &c. These festivals take And this is the same in other cases. Theore. place at no stated times, but generally once a tically men are punishable, but practically they year. When it is decided to sacrifice to either of are seldom punished. A case in point occurred these spirits, the whole of the people in the Haka in our own time. Shwelen, son of Chief Lwe circle subscribe something towards the purchase Shan, in a drunken brawl injured one of his of the necessary animal, which is generally a father's servants so badly that he died. Shwelen maiban or a pig, together with a black hen. then ran away to Aibur, not to escape from justice,
Page #202
--------------------------------------------------------------------------
________________ 192 THE INDIAN ANTIQUARY. (June, 1892. but to escape from the wrath of his father, who had lost a valuable servant. In a few days the father's anger melted away and a younger brother went and called Shwelen, who was received like the prodigal son. After his return it was necessary for him to " wash his hands," to use a Chin metaphor, which consisted in slaying a bullock, of which the whole village partook, and thus the guilt was washed away. Chiefs.--The Chief or Boi class is a numerous one amongst the Ching. A chief's son is also a chief, and descent from a chief is re. warded with as much pride as a lofty lineage in Europe. A Chin, be he ever so dirty or poor, has only to prove his descent from a chief to be at once accorded an honourable position. In Haka there are two principal chiefs, Lwe Shan and Lyen MO; but, besides these, there are scores of others, who are related to them, and who claim a voice in the affairs of the tribe. The same may be said of all the other Chin tribes and vil. lages, not only those which are independent, but also those which pay tribute. All the villages in the Haka circle pay some tribute to the Haka Chiefs, but it is very difficult to find out the exact relations which exist between them. This will be understood, when I explain that the right to levy taxes (I use this term for want of a better) is an hereditary one, and a landlord has the right to subdivide it on his decease. Owing to this subdivision, and the intermarriage of members of one family with those of another in i distant village, the claims to get something are often curiously mixed up. One person has the right to get a pig once a year, another gets a basket of grain, another gets a quarter of any animal slaughtered, and so on. Agriculture.--Agriculture is practised by the Chins in its rudest forms. The only implements used are small ases, damus, and a little hoe. The atxe and dama are used for felling the jungle, and the hoe for planting the seed and for boeing up the weeds and grass. The principal food-grains grown by the Chins are fang or millet, fungvai or Indian-corn, mum or Jacob's tears, be or beans and peas, farsung or paddy, rah or giant bean. There are ten varieties of millet, three of Indian-corn, four species of legume with many varieties, and three varieties of paddy. The food-staples are fungvai, or fang with yams. The only fruits cultivated by the Chins are plantains, peaches, figs, oranges, and apples; but strawberries, raspberries, cherries, pears, and plums are found wild. The raspberries are quite equal to those found wild in England, but the other wild fruits are not fit to eat. The work of the season is commenced by cutting down the jungle and hoeing up the grass and weeds. This is done in December and January, and the clearings are burnt early in March. Seed is sown early in April, when showers may be expected. Fang is the first to ripen and begins to be harvested about the middle of July. This is quickly followed by fungvai, after which almost immediately come the peas and beans. Sweet potatoes are grown near streams and are obtained throughout the year, but the principal crop is dug in the cold weather. Pumpkins of various kinds, brinjals (aubergines), beans, and peas are the only green vegetables grown. Trade.-Trade amongst the Chins may be divided into two heads, internal and external. The internal trade is confined to exchanging property, such as guns, knives, .cattle, or grain for food or drink; but trade, as such, can hardly be said to exist. The external trade is somewhat brisker. The articles in most demand are salt, cotton blankets, iron, silk, and gongs. These are purchased or exchanged for money, beeswax, fishing-nets, an occasional elephant's tusk, saltpetre, plantains, chillies. The Chins have considerable herds of common cattle as well as maiban, but they show no disposition to sell them and ask extravagant prices. They are used only for slaughter purposes, the hides being eaten and the horns remaining attached to the head, which is impaled on a post outside the village. Goats are also found at most villages, but never in large numbers. These also are killed and eaten. Fowls and eggs are largely produced and are sold freely. These, however, are articles of local trade and could not be exported at a profit. Population-Tashons. I have already stated that the Tashuns were unwilling to afford information about their country, and I am therefore unable to do anything but guess at the population. It is said, but I know not with what authority, that they can collect 10,000 fighting men, which I take to mean that they have 10,000 houses, and, allowing an average of five persons to each house, we thus arrive at a total of 50,000, which I think is not an extravagant estimate. HAkas.-The Hakas possess about 2,500 houses which, at five persons to each house, gives them a total population of 12,500. Yokwas.-The Yok was, estimated in the same way, have a population of about 3,000.
Page #203
--------------------------------------------------------------------------
________________ JUNE, 1892.] NOTES AND QUERIES. 193 Tlantlangs. -The Tlantlangs are about 7,500, but about them I am not so certain as about the Yokwas and Hakas. Independent Baungshes.-I estimate the independent Baungsbe villages south of Yokwa and Haka at 2,500 houses, which, computed as above, gives a population of 12,500. The totals therefore are Tashons .................... 50,000 Hakas ............. 12,500 Yok was ..................... 3,000 Tlantlangs .................. 7,500 Independent Baungshes. 12,500 Total ... 85,500 NOTES AND QUERIES. GOOD AND BAD OMENS IN MADRAS. made on the forehead with a paste of cummin seed If a person comes across the following when and sugar, which is called the upanayanam pa starting on a journey, or on a special errand, extra, nayanam = eye, or extra eye), and also the it is a good omen: a married woman, a virgin, mental eye. This ceremony generally takes a prostitute, two Brahmans, the playing of music, place before a Brahman boy attains his twelfth any money, fruit, a light, an umbrella, any food, year. If it is delayed longer the boy is classed with the Sudras. milk, curds, mutton, precious stones, sandalwood, rice, a cow, a bull, an elephant, a horse, a pot full Punyavachanam are rites of purification. of water, a pot of tadi, a black monkey, a dog, Literally the term means "something said on a a deer, a corpse, a royal eagle, any honey, fish, good day," (punya = good, odchanam = word). the recital of the Vedas. The rites consist in bathing the body (andnam): But if he comes across any of the following, it seating the principal persone upon wooden seats is a bad omen:-one or three Brahmans, a in the midst of assembled guests and relations, widow, any fuel, smoke, a snake, a new pot, & new pot, a and announcing the ceremony of sankalpam : i.e., blind man, a lame man, a pot of oil, any leather, the worship of Ganesa as the god of wisdom, salt, a tiger. who is adored in the shape of a cone made of turmeric powder and water, placed upon rice If a person places his head always towards the contained in a silver tray. enst in the sleeping posture, he will obtain This ceremony is wealth and health: it towards the south, a performed on the twelfth day after confinement lengthening of life: if towards the west, fame: or delivery, on which day the days of pollution are said to cease. The husband, who has grown if towards the north, sickness. So a person his hair from the day of conception till now, may should not lay his head to the north while shave when the ceremony is over. sleeping If you dine with a friend, or relative, on Monday, Among the Bruhmans the host and the hostess call with the family priest on their friends and Wednesday, Friday, or Saturday, it is well: if on relations in the place on the day previous to a a Tuesday, there will ensue an ill-feeling: if on a marriage, generally towards the evening, and Thursday, endless enmity: if on a Sunday, invite them to the ceremonies and to all meals hatred. during the days of the marriage celebration. In If, when you are leaving the house, your head token of the invitation the priest presents them or feet strike accidentally against the threshold, with a little holy rice or mantarakshadai. The you must not go out, as it foretells that some invitation party is always accompanied with mischief will befall you. music. Among the lower castes printed invi. When the thalt or the sacred jewel on a tations are distributed with pan supdri by some thread worn round the neck of a Brahman male member of the house, told off for this duty, woman is lost, it is an omen that her husband will to the friends and relations in the place. fall ill or be lost soon. K. SRIKANTALIYAR. K. SRIKANTALIYAR. SANSKRIT WORDS IN BURMESE. SOCIAL CUSTOMS IN MADRAS. (1) ThinjAn. In the Rangoon Gazette of the When an elderly person calls on his friends 6th April, 1892, there appeared the following or relations and expects to see their children, he paragraph :should generally take with him some sweet. "At 8 hrs. 34 m. 488. p. m. on Monday, the meats to be given to the children. full moon of Naung Taga, 1253, (11th April, Upanayanam is the ceremony of investiture 1892) three guns will be fired from the Post with the sacred thread. In this rite a mark is Officer's Flag Staff at Rangoon and from the
Page #204
--------------------------------------------------------------------------
________________ 194 THE INDIAN ANTIQUARY. [JUNE, 1892. Court House at Mandalay on account of the Burmese Thingyan (Thinjan). The new year, 1254, B. E, will begin at 0 hrs. 36 m. p.m. on Thursday, the 2nd waning of Naung Taga, 1253, (14th April, 1892)." Thinjan (th as in thin') means to the Bur. mese, the occasion on which the head of Brahma in the custody of seven female spirits, is transferred from one to another at the commencement of each new year, and has several interesting derivatives, e.g., thinjanja and thinjan-ataja, letting go the head : thinjanjat and thinjanatajat, the passage of the head : thinjandet and thinjan-atadet, taking up the head and lastly thinjanko, the state of washing the king's head at the new year in order to wash away the sins of the people, one of the many curious Court expressions now passing into oblivion. The word thinjan is, however, the Skr. san. kerama, the passage of a planetary body through a zodiacal sign, by which the Burmese understand the passage of the sun at the commencement of the new year, the sankordnt of the modern Hindu. The word in Burmese is spelt both sankran and san 8kran, pronounced thinjan. The Pali word is sankama. The Skr. derivation of thinjan is therefore clear. (2) Thinthagayaik= the Sanskrit Langnage. This word is written Sansakarok = Sanskrita. Compare amrok (ante, p. 94, there misprinted amrot) for amrita. The Pali word for the Sanskpit Language is Sakkata or Saklata. The Skr. derivation of the Burmese word is here very clear. R. O. TEMPLE. BOOK-NOTICE. CATALOGUE OY TAX COINS IN THE GOVERNMENT protest against the scandalous indifference shown MUSEUM, LAHOR... COMPILED BY CHAB. J. ROD by the Pasijab Government to the encouragement GERS, M.R.A.S, eto. Published by order of the of archaeological research, that is to say, to the Panjab Govern ment. Quarto, paper cover, Calcutta. reconstruction of the history of India prior to the Printed at the Baptist Mission Press, 1891. Muhammadan conquest. Madras used to be open Uncatalogued cabinets of coins are little better to reproach on the same account, but the Governthan useless collections of old metal, whereas a ment of that Presidency is now wide awake, and cabinet of very modest dimensions, if provided is engaged in directing well-planned and well. with an adequate catalogue, may prove to be the executed measures for the recovery of the lost source of much valuable historical and numis history of the territories under its charge. The matic information. India, unfortunately, does Bombay Government has given ample proof of its not possess any collection of coins which can intelligent interest in the past by the magnificent compare with the European cabinets of the first series of volumes of the Archaeological Survey of rank, and, until a very short time ago, can hardly Western India. In the North-West Provinces be said to have possessed any public collection. and Oudh, ever since the time when Sir John Now, thanks to the exertions of Mr. Rodgers, Strachey was Lieutenant Governor, early neglect Dr. Hoernle, Dr. Bidie, Mr. Edgar Thurston, has been atoned for by considerable, though not Dr. Fuhrer, and others, helped by the patronage lavish, patronage of archaeological investigations. of the overnment of India and the Local The efforts of the Government of Bengal have not Governments, valuable public collections have always been happily guided, but, at any rate, been cumulated, and continue to grow, at something has been done, and the administration Calcutt. Madras, Lucknow, and Lahore, I have is not open to the reproach of absolutely neglect. not of the Bombay Government forming ing all enquiry into the history of the vast regions $ t of coins. committed to its care. For the past thirty years mencipal public collection in India is that the India Office and the Government of India in v ian Museum, Calcutta, and I understand have been most liberal in their support of archaeoth: Rodgers is engaged in cataloguing it. logical enquiry, and have done, I think, all that Mr. Edgar Thurston has done good sound work could reasonably be expected of them. It has in the issue of several little catalogues of the been reserved for the Government of the Panjab coins in the Madras Museum. No catalogue of to earn the ignominious distinction of displaying the Lucknow collection has, so far as I am aware, an utter indifference to the early history of its been published. The subject of this notice is a territories, which cannot be parallelod by any catalogue of the coins in the Lahore Museum, other administration in India. Yet, as all readers compiled by Mr. C. G. Rodgers, Honorary Numis- of the Indian Antiquary well know, the Panjab matist to the Government of India. is to the archaeologist, as it is to the states. Before proceeding to discuss the book under man, by far the most interesting province of review I shall take the liberty of recording a India.
Page #205
--------------------------------------------------------------------------
________________ JUNE, 1892.] Mr. Rodgers' catalogue of the coins in the Lahore Museum is apparently the only archaeological publication issued under the patronage of the Panjab Government for many years past. The book is enclosed, it cannot be said that it is bound, in a flimsy paper cover which falls off at the first perusal. It is to be hoped that the authorities in the Panjab, when next they issue a book for the use of historical students, will harden their hearts, and at least venture on the expense of boards. BOOK-NOTICE. In Mr. Rodgers' work nineteen pages are devoted to a general introduction, including an extremely imperfect bibliography, one hundred and forty-nine pages to the main catalogue, thirty-one pages to a supplementary catalogue of coins recently acquired by the Museum, and four pages to Pali coin inscriptions, with transliterations, and a plate of monogrammatic emblems. It is a great thing to have a printed catalogue of the Lahore cabinet at all, and I fully appreciate the difficulties of the compiler's task, and the abundant labour and learning which he has expended upon it. Yet it is impossible for any reviewer not to regret the chaotic arrangement of the work, and the neglect of the small details which make perfection. It is confusing to find the early Buddhist Kuninda coins and the Yaudheya pieces (page 23) inserted between the Guptas and the Khalifas, the Indo-Scythian coins with Hindi legends (page 52) placed at the end of the series of the coins of the Sultans of Dehli, and followed by a class dubbed Miscellaneous Old Indian Coins,' which includes pieces of the Indo-Scythian, Gupta, and mediaval periods. Many other instances of eccentric arrangement might be quoted. * Inattention to minor details is shown in a multitude of misprints, in the neglect to distinguish Indian from Bactrian Pali (Kharoshtri) in the table of inscriptions, and in various other ways. The book is printed in such a manner that much space is wasted. So much for fault finding. I now turn to the pleasanter task of pointing out some of the items of interest to be found in the book. Mr. Rodgers, in his Introduction, notices sundry desiderata in Indian numismatics, and it may be of some practical use to call the attention of readers of the Indian Antiquary to the 1 [The States and petty principalities of Patiala, Nabha, Jind, Maler-Kotla, Kaithal, Kapurthala, Bahawalpur, Ambala and Jagadhri all had coinages of their own, and, so I am told, had many others besides; George Thomas of Hissar, for example. Since I wrote my paper on the 195 enormous amount of special work, which is required before it can be said that anything like a general account of the coinages of Northern India becomes possible. Mr. Rodgers remarks "how necessary is a Coin Manual for India, which should, in one volume, show how much is known at the present day on the subject." That one volume would, I fear, have to be a terribly thick one, and many and grievous would be the gaps in its contents. It is odd (page v.) that the Lahore Museum should not contain a single specimen of the Mitra Dynasty, generally identified with the Puranic Sungas. Many of the coins of these princes have been described by Messrs. Rivett-Carnac and Carlleyie, but a monograph on the subject is wanted. "The numismatics of Kasmir are full of anomalies (p. vii)." This puzzling subject was long ago treated by Sir A. Cunningham, but there is plenty of room for a more exhaustive treatise on it. "Much work remains to be done to the coins of Jaunpur. The various types are, as yet, but imperfectly known." At present the brief notice in Thomas' Chronicles is the standard account. The coinages of the local dynasties, such as those of Malwa and Kangra, all require further elucidation. "The neighbouring (i. e., to Kangra) state of Chamba also had a coinage of its own. The coins were of copper only, and the characters on them were a kind of Hill Sanskrit or Thakuri. On some of the coins are the Raja's name, and that of one of the gods of Chamba. They have never been written about." (p. xiii). Ten of these coins are catalogued (p. 121). Pages xiii to xv of the Introduction contain some valuable observations on the coins of the Mughal Emperors, which, as is truly observed, "form an immense series." Nothing approaching a comprehensive account of this immense series exists, and perhaps the most pressing need of the Indian numismatist is that of a fairly complete description of the Mughal coinages, from the time of Babar to that of Bahadur Shah II., a period of a little more than three centuries. An absolutely complete catalogue is out of the question, because the number of varieties is almost infinite, but the compilation subject, ante, Vol. XVIII. p. 321 ff, I spent but a day or so in Patiala, and picked up gold, silver and copper specimens of some of these mintages new to me, and so far as I know, not even suspected to exist by numismatists. - ED.]
Page #206
--------------------------------------------------------------------------
________________ 196 THE INDIAN ANTIQUARY. of a sufficiently satisfactory treatise is quite possible, though the task would be far from easy, and it might be difficult to find a publisher. The absence, throughout the greater part of Mr. Rodgers' catalogue, of references to published catalogues of particular series renders it extremely troublesome to discover whether the Lahore collection contains any remarkable novelties or not, and, as regards most of the coinages, I cannot attempt to examine the collection in detail. In a recent paper I ventured to doubt the rather hesitating assertion of Mr. Thomas that coins exist bearing the names both of Prithivi Raja and of his conqueror Muhammad bin Sam. But the billon coin described at page 35 sets my doubts at rest. The description is as follows: "Billon: :-one specimen, very rare, 48 [scil. grains]. Obv. Horseman, gefi . Sri Prithvi Raja Deva.' Thos. p. 18, no. 15. Rev. Bull, a, Sri Mahammad Sam."" Pandit Ratan Narayan of Dehli also possessed a specimen of this rare type. It is entered as unique in the privately printed catalogue of his collection. The confused arrangement of the book under review must be my apology for referring next to coins of earlier date. Nos. 5-8, described at page 53, are coins of the Gupta period, or possibly a little later. No. 5, the only one at all distinct, is thus described by Mr. Rodgers: "Wt. 113-2. Diameter. 75. Obv. King in armour, standing to right, left hand grasps a staff, right hand is making an offering at an altar. Above right arm is a trisul with fillet. Under left arm Pasana or Pasata, letters one above the other as on Gupta coins. To right (P) indefinite. Rev. Female seated on throne, holds cornucopia in left hand, and in right a wreath, as on Gupta coins. To left a monogram not well defined." I am indebted to Mr. Rodgers for inspection of another specimen of this class. The metal seemed to me to be brass (possibly very impure gold) and the obverse legend clearly to be Pasata. The legend outside the spear (staff) was illegible, and the reverse was without legend. I cannot assign these coins. A copper coin of Toramana is catalogued on page 54. "Obv. Seated figure to right (). Rev. Standing figure to left, fat...." Coins of this type are said to be common Mr. Rodgers seems to have overlooked the paper by Mr. Fleet [JUNE, 1892. on "The Coins and History of Toramana," ante, Vol. XVIII. pp. 225-230. Like so many branches of Indian numismatics, the coinages of Toramana and Mihirakula require further examination. Mr. Rodgers catalogues a few specimens of Mihirakula's copper coinage at page 141, but characteristically omits the king's name from his index. In his notice of 84 specimens of punch-marked coins (page 110) Mr. Rodgers makes the odd observation that "no paper that I am aware of has ever been written on these punch-marked coins." A good deal has been written on the subject. The description of a few specimens of the well known Varaha coins, (p. 112) ignores the demonstration by Dr. Hultzsch that they were struck by King Bhoja of Kanauj in the latter part of the ninth century A. D. (Epigraphia Indica, Vol. I. p. 155, note.) The Supplement contains some novelties, thus ; Two small silver coins of 'Ali, an early Governor of Sindh (page 6) are stated to be "now published for the first time." On pages 8 and 9 several new coins of the Sultans of Ghazni are described. (Rizfya) is noticed on page 17. An unpublished variety of the coins of Razia Two of the exceedingly rare silver coins struck by Humayan at Kandahar are catalogued on page 26. One of the rare zodiacal coins of Jahangir, with the sign Taurus, is described on page 27. V. A. SMITH. 31st Jan. 1892. Postscript. Since the above review was written, I have received a copy of a most valuable little book entitled, Coins of Ancient India from the Earliest Times down to the Seventh Century, A. D., by Major-General Sir A. Cunningham, (Quaritch, 1891). This work, which is illustrated by thirteen autotype plates of coins, and a map of N.-W. India, describes the punch-marked min tages, and the coins of Taxila, Odumbara, the Kunindas, Kosambi, the Yaudheyas, Panchala, Mathura, Ayodhya, Ujain, Eran or Erakaina, the Andhras, Karwar, and Nepal. It marks a great advance in the study of Indian numismatics. I hope to have an opportunity of noticing it more at length. 14-2-92. V. A. S.
Page #207
--------------------------------------------------------------------------
________________ JULY, 1892.]. EKAMRANATHA INSCRIPTION OF GANAPATI. 197 EKAMRANATHA INSCRIPTION OF GANAPATI; DATED SAKA-SAMVAT 1172. BY E. HULTZSCH, PH.D.; BANGALORE. THIS inscription is engraved on the north wall of the second prulurt of the Saiva temple of kamranatha, the largest of the numerous temples at Kanchipura. It consists of 17 Sanskrit verses in the Grantha character and professes to be an edict (susana, verses 1, 15, 16, 17) of king Ganapati, who traced his descent from the race of the Sun (verses 5 and 11) and whose immediate ancestors were : Betmaraja (v. 8). His successor: Prodaraja (v. 9). , : Rudradeva (v. 10). The eldest of his four younger brothers: Mahadeva (v. 11). His son: Ganapati (v. 12). Prodaraja is said to have constructed a large tank, which he called Jagatikesari-tataka after a surname of his (v. 9). Ganapati claims to have defeated Simhana and the Kalinga king, and to have the kings of Lata (Gujarat) and Gauda (Bengal) for vassals (v. 14). His minister (sachiva) and general (sainyapala), Samanta-Bhoja, who belonged to the race of Dochi, appears to have held the appointment of governor (chaleradharin) of Kanchi. He was probably a Brahmana, as he claims to be a member of the Kasyapagotra (v. 15). By order of the king, he gave to the Ekamra temple at Kabchi the village of Kalattur(v. 16). The date of the grant was Tuesday, the eleventh tithi of the dark fortnight of Jyaishtha of Saka 1172 (in words), the cyclic year Saumya (v. 17). According to Mr. Sewell's South Indian Chronological Tables, the corresponding European date is Tuesday, the 8th June, 1249 A. D. The dynasty to which Ganapati belonged, is not named in the inscription. But the names of two of his predecessors, Prodaraja and Rudradeva, are identical with two kings of the Kakatiya? dynasty of Worangal, Prola and his son Rudradova, who are known from the Anamakonda inscription of Saka 1084.* This close agreement and the mention of Ganapati as one of the Worangal kings in unpublished inscriptions and local records leave no doubt that the two pairs of names are identical, that the Ganapati of the subjoined inscription was the nephew of Rudradova of Worangal, and that, at the time of his reign, Kanohi was included in the territories of the Kakatiya kings. According to the Anumakonda inscription, Prola's father was called Tribhuvanamalla, while the subjoined inscription mentions Betmaraja as the immediate predecessor of Prodaraja. It foilows from these two statements that Betmaraja was the real name of the father and predecessor of Prodaraja, and that Tribhuvanamalla was a biruda of his. Thus a combination of both inscriptions furnishes the following short genealogy of the Kakatiyas of Worangal : 1. Betmaraja, surnamed Tribhuvanamalla, of the race of the Sun. 2. Prodaraja or Prola, surnamed Jagatikesarin. 3. Rudradeva 4. Mahadeva. Three other sons. (Saka 1084). 5. Ganapati? (Saka 1172). 1 Kalattur is now a large village, after which the next Railway station south of Chinglepat is called. 2 Thus the word is spelled in the Prataparudriya. The Anumakonda inscription has the forms Kakatya and Kakatiya. 9 This name is spelled Oramgallu in Brown's Telugu Dictionary. In a Telugu chronicle (Madras Journal for 1881, p. 238) we find the forma Orugallu, Single Rock,' wbicla tallies with the Sanskrit nano Ekabila; see below, note 12. + Published by Dr. Fleet, ante, Vol. XI. pp. 9 f. * Mr. Sewell's Lists of Antiquities, Vol. II. pp. 114 ff. and 172 ff. * Proda or prola is a tadbhava of the Sanskrit prauha, see Brown, 8. v. prola. 7 According to local records, Ganapati was the son of Rudradeva and nephew of Mahadeva ; see Wilson's Mackenzie Collection, p. 77, and Taylor's Catalogue, Vol. III. p. 483. An unpublished inscription, which is quoted by Sir W. Elliot, Coins of Southern India, p. 83, agrees with the Ekamranatha inscription.
Page #208
--------------------------------------------------------------------------
________________ 198 THE INDIAN ANTIQUARY. (JULY, 1892. The Simhana who is reported to have been afraid of Ganapati (v. 14), was probably the Yadava king Singhana II. of Devagiri (Daulatabad), who reigned from Saka 1131 to 1169, and who, in his turn, calls himself 'the uprooter of the water-lily which was the head of the king of Telunga.'8 In the Paithan grant of the Yadava king Ramachandra, Singhana II. is said to have overcome the Andhra king. The predecessor of Singhana II., Jaitugi I. (Saka 1113 to 1131), is said to have slain the king of Trikalinga in battle and to have seized the whole of his kingdom. Further" (this) ocean of compassion fetched Ganapati, the speech of whose mouth was gweet, from the prison-house and made him) lord of (his) country." Accordingly, Ganapati was a contemporary of both Jaitagi I. and Singhana II. The king of Trikalinga, who was defeated and killed by Jaitugi I., nay have been either Gana pati's father Mahadeva or his uncle Rudradeva.10 The words of the Paithan grant leave it doubtful if Gana pati, before he was installed on the throne by Jaitugi I., had been kept imprisoned by this king, or by his own father Mahadeva, or by his uncle Rudradeva. A still earlier synchronism between the Kakatiyas and Yadavas appears to be contained in the Anumakonda inscription, which states that Rudradeva defeated one Mailigideva. This may have been the Yadava king Mallugi, who, according to the Paithan grant, was the predecessor of Bhillama ("Saka 1109 to 1113). Some additional information on the Kakatiya dynasty may be gathered from the Prataparudrayaasbhushana or Prataparudriya, a treatise on Alamkara. The author of this work, Vidyanatha, must have been a contemporary of Prataparudra, as he illustrates the rules of Sanskrit composition almost exclusively by verses in praise of that king. For the subjoined extracts I am using an edition in Telugu characters, printed at Madras in 1888 with the commentary of Kumarasvami-Somapithin, the son of the well-known Klachala-Mallinathasuri and younger brother of Peddayerya. The Kakatiyall king Prataparudra resided at Ekabilanagara,12 the capital of the Andhra or Trilinga country. The second of these Sanskrit names of the Telugu country is supposed to owe its origin to three famous lingas of Sivals at Srisaila, 14 Kalebvarals and Draksharama.16 The hermitage of Hidimba (HidimbAsrama, p. 130, or Hidimbalaya, p. 131) must be looked for in the neighbourhood of Worangal. Anumakonda, the former capital of the Kakatiyas,17 is referred to by its Sanskrit name Hanumadachala *the hill of Hanumat' (p. 109). The crest (mudra) of Pratiparudra was the figure of a boar18 (raraha, pp. 35 and 119, or kroda, pp. 203 and 307). The name of his mother was Mumma. damba (p. 12). Farther details about the king and two of his predecessors are given in a panegyrical drama, which forms the third chapter of the Prataparudriya. The father of Prataparudra Dr. Fleet's Kanarese Dynasties, p. 72. Published by Dr. Fleet, ante, Vol. XIV. pp. 314 ff. 10 Taylor, l. c. states that "Gapapati, making war against the Devagiri ruler, who had killed his uncle Mahadeva, conquered that chief, and took his daughter, named Rudramadevi, to be his wife." But 300 Dr. Bhandarkar's Early History of the Dekkan, p. 82. 11 As noticed by Dr. Burnell (Tanjore Catalogue, p. 53 f.), the commentary (p. 7) derives this word from KAkati, A name of Durga : - Fararh gor TTTTTTTTTATI AT E 07:. 12 EkasilA is the Sanskrit equivalent of Orugallu, on which see p. 197, note 8. The form kasaila (ante, Vol. XI. p. 12) does not occur in the Pratdparudriya and is probably due to a mistake. 18 Page 143 : - fantaa Feat via les Fietar dat amefariwarang: : 1 ageTECHYTT: paranterarfer: grau 14 In the Karnal district. 10 The temple at Kalahasti in the North Aroot district. 16 In the G3dkvart district. The commentary notices the form DAksharama, which does really occur in an inscription of Vira-Choda (ante, Vol. XIX. p. 424), and quotes the following derivation of it from the Skandapurana :syArAmabhAmitvAdAkSArAmobhidhIyate. 17 ante. Vol. XI. p. 9 f. The original form of this Telugu name seems to be Hanumatkonda, 'the hill of Heumat. 15 This crest is alluded to in verse 13 of the subjoined inscription.
Page #209
--------------------------------------------------------------------------
________________ JULY, 1892.] EKAMRANATHA INSCRIPTION OF GANAPATI. 199 was Mahadeva(P);19 but his immediate predecessor was the daughter of Ganapati (pp. 132 and 136) by Soma.20 Her father Ganapati, 21 who appears to have been without male issue, bad called her his "son" and conferred on her the male name "Rudra" (p. 102). At his death she seems to have succeeded him on the throne. In the text of the drama she is always styled " the king" (raja) and once (p. 123) Maharaja-Rudra, 22 while the commentary (pp. 101 and 104) calls her Rudramba. At the command of the god Svayambha ('Siva) she adopted her daughter's son Prataparudra and appointed him as her successor,33 Thus the Prataparudriya furnishes the following pedigree: - 1. Ganapati, md. Soma. 2. Rudramba. Mummadamba. Mahadeva(?) 3. Pra taparudra. The local records further suggest that No. 1. Ganapati is identical with No. 5. Ganapati of the pedigree derived from inscriptions (p. 197, above). Accordingly, Rudramba will be No. 6 and Prataparudra No. 7 in the list of the Kakatiya dynasty. The only event of Ganapati's reign, which is alluded to in the Pratdparudryu, is, that he founded a Saiva shrine called Ganapesvara (p. 143). Both Radramba (p. 101) and Pratipa rudra (p. 42) had the biruda Chalamartiganda. Prataparudra is reported to have conquered a large number of distant countries on his vijayayatrd or grand tour. Repeated mention is made of the defeat of the Yadava king of Savana. This king had crossed the Gautami (i.e. Godivari) river, north of which bis territory must accordingly have been situated, and was put to flight by the commander of an army of Pratu parudra.24 Among the kings of an early branch of the Yadavas, which was settled in the Nasik district, we find three times the name seunachandra,25 The first Seupachandra founded Saunapura at, i.e. transferred his capital to, Sindinagara or Sindinera, the modern Sinnar in the Nasik district,20 Later on, the term Seunadesa was employed as the designation of the territories of the Yada vas of Devagiri. For, in Hemadri's account of the reign of Mahadeva (Saka 1182 to 1193), De vagiri is said to be included in the couutry called Seuna ; 27 and in the Paithan grant of Ramachandra (Saka 1193 to 1230), it is stated that the grented village belonged to the country of Seana and was situated on the northern bank of the Godavari.29 This country of Seana is evidently identical with the country of 10 This statement rests on the commentator's explanation of a verse (p. 91) which, in my opinion, rather refers to king Ganapati than to PratAparudra. The local records all Prataparudra's father Virabhadra, 20 Page 102: - area ffer the IT parerar [read (41) Art T a r 11 11 According to the local records, she was not the daughter, but the widow of Ganapati. 12 Thas the coins of queen Lilavats of Ceylon bear the legend erweil avval, and those of queen Earlya of Delhi bear the title pline load I u on page 104, Siva addresses the queen thus: svIkRte putrabhAvena dauhitre prAmAjJayA / asmividhehi dhaureye gurvI mudhirAmiti / / The commentator explains pAk by janmakAle. ** Page 156 - 4 21Haccata af het d ate gears eSA kAkativIraruva iti kiM nAbhAvi saptAkSarI prayatprAtipakSapArthivamahAbhUta mahoccATanI / / Page 291-18 greate : Fera y ate qe fareu ! sadyo ruvanarendranAyaka camUnAthena kenApyadhikSiptasyA caritAni sevaNapatejAnAti sA gautamI / / 15 ante, Vol. XII. p. 128. 96 ibid. p. 124, and Vol. XVII. p. 118. Dr. Bhandarkar's Early History of the Dokkan, p. 87. > ante, Vol. XIV. p. 315.
Page #210
--------------------------------------------------------------------------
________________ 200 THE INDIAN ANTIQUARY. [JULY, 1892. Sevana, 30 which, according to the Prataparudriya, was situated north of the Godavart and ruled over by a Yadava king. As Prataparudra reigned from A. D. 1295 to 1323,30 his Yadava antagonist must have been Ramachandra, the last independent king of Devagiri. As suggested by Dr. Bhandarkar,31 the name sounadesa is perhaps preserved in the modern term Khandes. The only inscription of Prataparudra, of which I have a copy at hand, is a fragment discovered by my First Assistant, Mr. V. Venkayya, on the west wall of the second praldra of the Jambukokvara temple near Trichinopoly. It is written in the Grantha character, but in the Telugu language. Of the two first lines only the following words are preserved :1 . . . . . . . . . . [mezvarakAkatIyapratAparudradevamahArAjalu . . . . . . . . . [ga]nu pRthivIrAjyam seyucuNDagAnu A rAju TEXT. . 1 svasti zrIH [ // *] etanikhilabhUpAlamaulimaNDalamaNDanam [1*] gaNapatyavanIndrasya candrArkasthAyi zAsanam / [1] tejazzca zreyasAya syAdRpyahantAvaLAnanam [1*] ananyAsvAditastanyazailakanyA 2 stanandhayam // [2*] kuzalamavikalaM karotu kolassa kila saroruhavAsinIsahA[ya] [[*] tarati yadurupovotapAtryA pratiyugameva mhoddhindhritrii|| [3 *] zAzvatIm mumudaccayatA[va]zcandracUDamukuTentukalA sA [1] 3 yAmumA spRzani nauriti mauktI maulimaNDananadIjalakeLau // [4] yassAmaya'juSAm prameyapadavIsIno mahinaH padam yasteja[*] stabakIkRtam kranubhujAm koTayAstrayastriMzataH [*] tannetrAdudapayate 4 Sa bhagavAnambhojinIba[*]ndhavo / baahyaabhyntrbndhuraandhtmsaahNkaarsNhaarkH|| [5] tasmAdapathanipAtukajagatIkaradIpakaraNinItikaraH 33 [*] . manurAdimo nRpANAm [sI]mevAbhUtupAya[*]nAm // [.6 *] sagarabhagI 5 rathapatiraghurAmAdhAstavanu sandadhurddharaNim / / atha gacchati bahukAle tainvaye durjayA miyAm praapteH|| [*] abhimatabhujabhAjAma bAhujAnAM kulesminnajAna janita[kI]tibhUpatirbatmarAjaH [ / * ] 33 athigaruDa turaMgam prekSya sAkSAtkRtantam prathamagaruDavAhammenire ymmnussyaaH|| [8 *] 34 dviSatupahatadRpyatantimeghaMkarAzo niravizastha bhUmim bhUpatiH proDarAjaH / pratinidhimudadhInAM saJcayantoyasRSTe 7 rakRta jagatikesAMkhyayA yastaTAkam [ // 9*] tadanu pavanavegamatyanIkAvadhATIvihitamahitabhUbhRdrivo rudradevaH / / bhalamakRta kulantat mApakoTIrahIraprakaramukkurabimbatpAdabimboka( laka)lakSmI: 3 / / [10] 8 tadanujagaNamukhyaizrImahAdevarAjastapanakulasamudrAdyAdRzaH pArijAtaH [*] alabhata dinadIpavyApadaM yasya kIterasadRzarucijAlairanyarAjanyakIrtiH // [11] mahAdevamahIpAlAjjAto gaNapatirtRpaH [*] amI. 9 mivikramairebhirguNairAmibibhUtibhiH // [12*] 36 kolAMkobhUnsRgAMko nivasati kamale zrIriti zrIvarAhaH prApto naiSA priyasyorasi rativiratau lamagaNDam prasuptA [[*] ityAlApe sakhInAmuSasi sakutukam 10 satrapam sAnutApaM hastAbhyAM yadripustrI vinamitavadanA gaNDapALI pidhatte / / [13 *] yadudayakRtacetorikhaNassihaNo yacadulasubhaTadhATIdattabhaMgaH kaliMgaH [*] api ca yadupasevAjIvinI lA ____WA further reference toaking of Sevaya is found in Dr. Fleet's Kanarese Dynasties, p.68:-"An inscription of (the Hoyeula king) Narasimha II. gives a gre phis account of a battle between his father (Ballapa II.) and a certain Semana or Sevuna, whom he besieged and defeated at Soratur Dear Gadag, and pursued from there up to the Krishpavirpa, where he slew him, and who was probably the commander-in-chief of Jaitugi's army." Mallinatha-odeyar, the commander-in-chief of king Bukka of Vijayanagara, claims to be the commander of theBevana army (Sevana-dala) and of other armies. --See Mr. Rice's Mysore Inscriptions, pp. 2 and 5; I am quoting from impressions of these two inscriptions, the originale of which are in the Sampige- Siddhesvara temple at Chitaldroog. BO Mr. Sewell's Lists of Antiquities, Vol. II. p. 173. 81 Early History of the Dekkan, Supplement, p. iv. Ba Read degkaraNa. - Read bhadhi . The of dviSadupadeg is entered below the line. - Read degbimbokalakSmI * The syllables la are entered over the line.
Page #211
--------------------------------------------------------------------------
________________ JULY, 1892.) EKAMRANATHA INSCRIPTION OF GANAPATI. 201 11 737 ruraya: *[:] wrga *#21 [2x* ) arin u graafq[-2]qr/97 37 9 a aqoothan : 7649ZIT: [1] Fr ar 12 lam gaNapatinRpatezzAsanaM saMvyadhatta zrImatsAmantabhojo gaNapatisacivo docitugdhAbdhicandraH // [15 *] devasvaikAmradhAno bahumahimasapar2yAvasunyAsasiddhace grAmannAnA kaLanUriti bhu. 13 vi viditaM sasyahRdyanivedya [*] kAjhyAmAkalpakAlaM gaNapatinRpatezzAsanaM saMvyatti zrImatsAmantabhojo gaNapatisacivo docidugdhaabdhicndrH|| [16 *] zAkAbre tu visaptatyadhikazivazatakhyAtasaMkhyAnamAne saumyAbde 14.38 HE Mekara i afg [1] # A* taggage 30 BUY zrImansAmantabhojo gaNapatisacivo docidugdhAbdhicandraH // [10.] TRANSLATION. Hail ! Prosperity! Verse 1. This (is) an edict (sisana) of king Ganapati, which adorns the heads of (i. e, which is obeyed by) all kings, and which shall endure as long as the moon and the sun. 2. Let the power (Ganesa) which has the face of a ratting elephant, and which has sucked the breast of (Parvati) the daughter of the mountain, whose milk was tasted by no other, - produce happiness! 3. Let that boar (Vishnu) who is the consort of (Lakshmi) that dwells in the lotus, and on whose big enout, as on a boat, the earth crosses the great ocean (at the end of each yuga, - produce complete welfare ! 4. Let thnt sickle of the moon on the head of 'Siva, which Uma, sporting in the water of the (Ganga) river that adorns the head (of Siva), touches, (exclaiming : "Here is) a boat of pearls !" - procure you everlasting bliss ! 5. From the eye of (Niva) who is the abode of the greatness (which is reachel) at the end of the path that is to be known from the Saman, Rich and Yajus (Vedas)," and who combines the power of the thirty-three crores of gods, - was produced that god (vis. the Sun), who is the friend of the lotus plant, and who dispels intensely deep darkness without and egotism within (the mind). 6. From him was born Manu, the first of kings and master of expedients, who produced (a treatise on) right conduct, which supplies a handy lamp to men who are apt to stumble on the wrong path. 7. After him, Sagara, the lord Bhagiratha, Raghy, Rama and other (kings) of his race, who were hard to be overcome by approaching dangers, ruled the earth in the course of a long period of time. 8. In this race of warriors, 62 whose arms were respeoted, was born the renowned king Betmaraja, whom people, when they saw him on his horse (called) Garuda, took for the first rider on Garuda (i. e. for Vishnu) appearing visibly. 9. Then the earth was enjoyed by king Prodar&ja, who covered the horizon with clouds, (viz.) the ratting elephants offered (as presents) by his conquered) enemies, and who constructed a tank (tataka) (which he called) by (his) name Jagatikesarin' (i. e. the lion of the earth), which equalled the oceans, and which accumulated the downpour of water. 37 The first of grasrois entered below the line. * Read 08. 5. The syllable is entered below the line. 40 Siva is here identified with the universal soul of the Vedanta philosophy. 11 Literally, the limit, as it were, of expedients.' * The Kahatriyas are onlled bahuja,'arm-born,' because they are supposed to have been produced from Brahma's arme. *) In this compound, as in KAlidAss and other names, the final of the first member (jagat) is shortened in accordance with Panini, vi, 3, 63. The synonymous biruda Avanisimha occurs in yerse 20 of an unpublished Pallars grant from Kadakadi.
Page #212
--------------------------------------------------------------------------
________________ 202 THE INDIAN ANTIQUARY. [JULY, 1892. 10. After him, this race was adorned by Rudradeva, who put to flight exalted kings by the attack of horses which rivalled the wind in swiftness, and the proud splendour of whose feet was reflected, as by mirrors, by the multitude of the diamonds in the diadems of (prostrated) kings. 11. The first of the multitude of his younger brothers, the illustrious king Mahadeva, (ncas produced) from the race of the Sun, as the parijata (tree) from the ocean. In consequence of the unequalled splendour of his fame, the fame of other kings experienced the fate of a lamp at dey.light. . 12. From king Mahadeva was born king Ganapati, (who was endowed) with the same courage, the same virtues, and the same power. 13. "The deer-marked (moon) has become boar-marked." "The blessed boar (or Vishnu) has come, because beauty (or Sri) dwells in the lotus." "This lady has not slept with her cheeks pressed to the breast of her husband after dalliance." (Successively) experiencing curiosity, shame and grief during this morning talk of her maids, the wife of his (viz. Ganapati's) enemy bends her face down and covers the two marks on her cheeks with both hands.45 14. Who can boast of the courage of king Ganapati, at whose rise Simhana lost his heart, by the attack of whose fine soldiers the Kalinga (king) was overthrown, and who is served by the Lata and the Gauda (kings)? 15. He, who by his (the king's) order held a province, 46 the splendour of whose arms was famous, the foremost among generals (sainyapala), who, as regards eloquence (?), was the best of the smooth gems of the Tamraparni (river),47 who belonged to the renowned gotra of the KAkyapas, the minister of Ganapati, the illustrious Samanta-Bhoja, who, as the moon from the milk-ocean, (vas produced) from the Dochi (family), executed at Kanchi the edict of king Ganapati, (whick shall last) to the end of the kalpa. 16. By presenting to the god who resides in the Ekamra (temple), - in order that wealth might be deposited in the temple) for conducting the worship with great splendour, -a village which is famed on earth by the name Kalattar, and which abounds in grain, - Ganapati's minister, the illustrious Samanta-Bhoja, the moon of the milk-ocean of the Dochi (family), executed at Kanchi the edict of king Ganapati, (which shall last) to the end of the kalpa. 17. In the Saka year, which was measured by the famous (?) number eleven hundred increased by seventy-two, in the Saunya year, in the month of Jyaishtha, in the dark fortnight, on the day of Hari (Vishnu), a Tuesday, at noon (?), - Ganapati's minister, the illustrious Samanta-Bhoja, the moon of the milk-ocean of the Dochi (family), executed at Kanchi the edict of king Ganapati, (which shall last) to the end of the kalpa. << This simile implies, that the last king, Radradeva, had four younger brothers, and that Mahadeva was the eldest of these. In the Amaraka (i. 1, 53), the pirijata tree takes the second place among the five celestial trees. 15 As suggested to me by Pandit Rajagopalicharya of Chikka-Ballapura, the maids allude by the words 'moon' and lotus' to the face of their captive mistress, on which a boar, the creat of king Ganapati, was painted. She experiences ouriosity and shame, because she does not immediately catch the allusion, but takes the two first remarks of her maids in their literal sense. The third remark, which clearly refers to the painted figure on her cheeks, undeceives her and reminds ber of her past happiness and present misery. With the opening words of verse 13. WATCH E , compare page 85 of the Prataparedriya: mandhAnAcala mUlamecakazilAsaMghanazyAmikAkAraM yattahinayutI sphurati tatsAra mAcakSate / manye nanviha vIrarudanapateH kIrtipriyA nirjitastanmudrAjavarAhamindururasA bibhratsamujz2ambhate / / 46 Chakradharin appears to have the same technical meaning, which the dictionaries attribute to chakradhara and chakrapala. 47 "The smooth gems of the Tamraparpt' are the pearls, for which this river is celebrated. The epithet may also imply that Samanta-Bhoja was born on the banks of that river. + Literally, 'Siva's hundred.' Siva is synonymous with Rudra, which, since there are eleven Rudras, is used as a numerical word for eleven.' 4 1. e. the eleventh tithi, which is sacred to Vishnu.
Page #213
--------------------------------------------------------------------------
________________ JULY, 1892.] THE INSCKIPTIONS OF PIYADASI. 203 THE INSCRIPTIONS OF PIYADASI. BY E. SENART, MEMBRE DE L'INSTITUT DE FRANCE. Translated by G. A. Grierson, B.C.S., and revisel by the Author. (Concluded from page 177). CHAPTER V. THE LANGUAGE OF THE EDICTS, AND THE LINGUISTIC HISTORY OF INDIA. It is not sufficient to consider the language of Piyadasi as an isolated subject. His monuments form only the first link in the chain of Indian epigraphical documents. The facts which they reveal cannot fail to throw light on the period following, and our conclusions, if they are correct, cannot fail to find a more or less direct verification in later facts. It is this order of ideas which I propose to consider in this concluding chapter. PART I, THE CHRONOLOGY OF THE INSCRIPTIONS. The most urgent task is to establish, as exactly as possible, the chronological classification of the monuments with which we have now to deal. I do not propose to examine once more in detail the thorny problems which the chronology of India presents for the period which extends from Asoka to the kings of Valabhi : still less do I propose to bring forward here any original system of my own. These questions have been studied by such good judges, and have been replied to in so many different ways, that little room is left for new theories. I believe that the true solutions have been already indicated, and I intend simply to group dispersed elements together, and to connect them into a coherent whole, both by the consistency with which the principal dates fit into each other in one uninterrupted chain, and by the support lent to them by accessory considerations and coincidences. Amongst the works which have thrown most light on a very obscure subject, Prof. Oldenberg's essay, leber die Dalirung der altesten indischen Munz- uwl Inschriftenreiher, certainly holds the first place. It is, I believe, sufficient to combine his conclusions with certain results obtained by the labours of Messrs. Buhler, Bhagwanlal Indraji, Bhandarkar, and Fleet, I only mention the most recent publications, to obtain a chronological series, the main points of which appear to be firmly established. With Prof. Oldenberg, I consider that the saka era starts from the coronation of Kanishka, and that it is in this era that the inscriptions of this king and of his Indo-Scythian successors are dated.2 With him, I consider that the era of the Guptas, which was also adopted by the kings of Valabhi, should be calculated, in accordance with the evidence of Alberuni, from the year 319 A. D., and that no sufficient reason exists for distarbing one of the rare positive traditions which we have the good fortune to possess.3 This being settled, it remains to determine the chronology of the Satraps of Surashtra and of the Andhrabhrityas. Here several synchronisms come to our help. 1 Zeitschr. fur Numismatik, Vol. VIII. pp. 289 and ff. ? Prof. Max Muller holds the same opinion, India; What it can teach us, p. 291. 3 With regard to the era of the Guptas, I would refer the reader specially to Appendix A. of Prof. Bhandar. of the Deckan. New arguments have been put forward quite recently, which have led Dr. Buhler to the same opinion (cf. Buhler, Ueber eine Inschrift des Konigs Dharasena IV von Valabhi, in the Sitzungsber. der Wiener Akademie, 1885, pp. 13 and f, of the reprint). (Since the above was published the admirable researcbes of Mr. Fleet, contained in the 3rd volume of the Corpus Inscriptionum Indicarum, have put an end to all debate regarding the era of the Guptas. It has not been necessary for me to modify my original text in consequence, for it maintains the accuracy of the fact, of which Mr. Fleet has proved the certainty: but I cannot deprive myself, en passant of the pleasure of rendering a grateful tribute to the fertile labours of this skilful epigraphist. ]
Page #214
--------------------------------------------------------------------------
________________ 204 * THE INDIAN ANTIQUARY. [JULY, 1892. An inscription of Nasik, dated the 19th year of the reign of Vasithiputa Pulumayi, and emanating from his mother, Gotami Balasiri, refers to his father and predecessor Gotamiputa Satakani, as the destroyer of the family of the Khak haratas' (Khakharatadsaniravasesakara). We also find at Nasik a parallel series of inscriptions emanating from Usavadata, son-in-law of the "Satrap Nahapana, a Khaharata king,' and even a dedication presented by a minister, Ayama, of this prince. It is in the person of Nahapana that Gotamiputa Satakani must have destroyed the dynasty of the Khaharatas or Khakharatas, for the same locality has preserved for us a document, by which he exercises over it an act of sovereignty. He transfers to a community of ascetics certain lands, which come from Usavadata, probably the very son-in-law of the dispossessed sovereign. The reader can see in an ingenious article of Dr. Buhler's, that the numismatic discoveries of Pandit Bhagwanlal Indraji, on a comparison with epigraphic data, allow us to reconstitute the following series of sovereigns in the dynasty of the Andhrabhsityas. Gotamiputa Satakani, who reigned at lenst 24 years. Pulumayi Vasithiputa, who reigned at least 24 years. Madhariputa Sirisena, who reigned at least 8 years. Vasithiputa Chaturapana Satakani, who reigned at least 13 years. Siriyana Gotamiputa Satakani, who reigned at least 16 years. It is not certain, but it is at least probable, that the succession was immediate between the second, third, and fourth of these princes. Rudradaman, the Satrap king, in the celebrated inscription of Girnar, tells as how he twice conquered Satakarni, the king of the Dekhan; he only spared him from total destruction by reason of their close relationship. Now, an inscription of Kanheri7 has preserved the memory of a queen, daughter of a Kshatrapa king, whose name was composed of two syllables commencing with ru, and wife of the king Visishthiputra Satakarni. Whether the Ro[dra), father of the queen was, as appears very likely, or was not, the Rudradaman of Girnar, it remains almost certain that the Satakarni of whom that prince was the contemporary and conqueror is one of the two last princes named in the foregoing table. Fortified by palaeographical coincidences which tend to confirm the likelihood, which in itself is very strong, of these facts, we can hold it for proved that Rudradaman belonged to the same time as Vasithiputa Satakani, or Siriyana Satakani. The third synchronism, together with an indirect verification of the second, gives us a valuable means for approximately fixing the dates, not only relatively but absolutely, of these persons. In a well-known passage, Ptolemy mentions Tiastanes and Siri Polemaios, as sovereigns of Ujjayini and of Paithana. These two names have been long identified, the first with that of Chashtana, and the second with that of Siri Palumayi. Now Chashtana is known by the inscriptions as grandfather of Rudradaman; and it is quite easy that he should have been a contemporary of Pulamayi Vasithiputa, grandfather or great-grandfather, or at any rate third or fourth predecessor, of the Satakaai, of whom we have just seen that Rudradaman was the contemporary and the conqueror. A remark of Prof. Bhandarkare contributes a still higher degree of probability to these identifications. Ptolemy tells us that, while the northern parts of the west coast were governed by Siri Polemaios, the southern parts were under the rule of Baleocouros. Now, there has been discovered at Kolhapur a series of coins, in which the name of Vilivayakura, whose identity with Baleocouros forces itself on our notice, is associated with that of Vasithipata and of Gotamiputa, to whom we have just been introduced. * Arch, Surv. West. Ind. IV. 168. Arch. Sury. West. Ind. pp. 99 and ff. * Indian Antiquary, 1883, pp. 272 and ff. It will be seen from what follows that I have not been able to place myself in entire accord with the learned author. Arch. Surv. West. Ind. V. 78. * Early Hist. of the Deckan, p. 20. . Cf. Bhagw&n]Al Indrajt, in J. R. A. 8., Bo. XIII., 303 and ff.
Page #215
--------------------------------------------------------------------------
________________ JULY, 1892.] THE INSCRIPTIONS OF PIYADASI. 205 The terms in which Ptolemy speaks of these sovereigns, Tiastanes, Siri Polemaios and Baleocotros, give us naturally the impression that he speaks of princes of his own time. Without any doubt this conclusion is in no way a forced one. He could, it is true, have drawn upon previous authorities, and his information regarding such distant countries was not necessarily up to date ; but, until the contrary is proved, every presumption is in favour of the most simple solution, which makes the princes reign at the same epoch as that in which he wrote the geography, or a short time before. Ptolemy is credited with having composed his book a few years after 150 A. D., and we are, therefore, entitled, a priori, to consider that Chashtana and Pulum&yi V Asithiputa must have been in possession of their power between about 135 and 145. This conclusion, which is admitted by several scholars, 10 will impose itself with yet greater force upon our attention, if it is found to accord with the chronological data, wbich it is possible to collect directly in India. This is exactly the case. Prof. Oldenberg has strongly insisted upon the reasons which prevent us from fixing at a later date than the commencement of the second century the era of the Kshatrapa kings of Gujarat, that is to say of the dynasty, the founder of which was, as we gather from the inscriptions, Chashtana. The arguments on the basis of which he hesitates to make it coincide with the Saka era of 78 A. D. appear to me to be less convincing. We know of a Kshatrapa coin bearing not only the date 300, but the date 310 of the Kshatrapa era ;12 the date 83 of the Gupta era, i. e. (319 + 83 = ) 402 A. D., is the earliest one of their successors in Malava, 13 the Guptas, of which we have evidence, and it is hence impossible to bring down the commencement of the Kshatrapa era to a later date than 90 A. D. As it is, on the other hand, certain that the Kshatrapas were not the originators of the era which they employed, - we shall shortly see that it was also used by Naha pana, - it seems to me that the strongest probabilities lead us to conclude, with Pandits Bhagwanlal and Bhandarkar, that it was the 'Saka era of 78 A. D., the era of Kanishka, which they adopted. Every one is now, I believe, agreed in considering with Messrs. Oldenberg and Bhagwan. lal,15 that Nabapana was, in Gujarat, the representative of the race of the Kshaharatas, which was conquered by Gotamiputa Sa takani, and which immediately preceded this dynasty of Kshatrapa Senas, of whom Chashtana was the first representative. It will now be sufficient to mention the dates supplied to us by certain inscriptions; and we shall see how they adjust themselves, and how happily they coincide with the presumptions to which we have come independently. According to the Girnar inscription, Rudradaman was on the throne in the year 72 of his era, which we suggest to be the Saka era. Coins of his son Rudrasimha bear the dates 102 to 117, and it is probable that the first mentioned ones go back to the commencement of his reign.18 It is, therefore, likely that the reign of his father Rudradaman could not have commenced much before the year 150 A. D., the date of the bursting of the embankment at Girnar. Every indication points to the conclusion that the reign of his father Jayadaman was short, and Chashtana, as founder of the dynasty, could only have come into power at a mature age. There is, therefore, small room for making mistakes, if we'allow for these two reigns a period of 20 or 22 years. The accession to power of the Senas would thus be placed at about the year 128 or 130 A. D. An inscription of Junnar, 17 proves that Nahapana was still king in the year 46 of the era which he employed : the inscriptions of his son-in-law Usavada ta, which are known to us; are earlier, bearing the dates 40, 41, 42. We can thus put the destruction of his power by the 30 Of. Bhandarkar, loc. cit. BhagwanlA1 Indraji, art. cit. 11 art. cit. pp. 315 and #f. 12 Buhler, in Burgess, Arch. Suru. West. Ind. p. 78. 11 Of., for example, Thomas in Burgess, Arch. Suru. West. Ind. II. p. 20. 14 loc. cit. pp. 319, and ff. 10 Ind. Ant. 1878, p. 258. al. 10 Bhagwanlal Indraji, in J. R. A. 8., Bo. XIII. p. 315. 17 Arch. Surv. West Ind. IV. 103.
Page #216
--------------------------------------------------------------------------
________________ THE INDIAN ANTIQUARY. [JULY, 1892. Andhras, at about the year 48 or 50 of his era. What is that era ? If, hypothetically, we suggest the era of Kanishka, the date 125 to 128 A. D. which we get, agrees so exactly with that to which we are led on the other hand as the date of the coming to power of his conqueror, that the proof seems to be decisive. I may add that, according to a restoration which Dr. Buhlers considers as almost certain,' Usavadata, the son-in-law of Nahapana, in one of his inscriptions calls himself a Saka. It is, therefore, probable that this family of Kshaharatas held its power, as vassal satraps, from the Turashkas of the dynasty of Kanishka; and nothing could be more natural than that they should have used the era adopted by their suzerains. After them, the family of Senas must have simply followed their official tradition, as the Valabhi kings did in later years when they succeeded the Guptas. The name of Salivahana by which this era came eventually to be designated, appears to be a recollection of the similar procedure by which the sovereigns of the Dekhan, on their side, appropriated the era founded in the north by the 'Saka king. 206 Another result which follows from the above is that we now find the members of the Andhra dynasty, who more immediately interest us here, placed in their chronological position. I have mentioned their names above. If we take 126 A. D. as the date of the victory of Gotamiputa Satakani over Nahapana, an inscription of the conquerorie proves, on the other hand, that this event must have occurred before the 14th year of his reign, for he sends orders dated in that year to the representative of his authority at Nasik. Various epigraphical monuments testify that he reigned at least 24 years; and we thus get the year 126 + 11, say 137 A. D., for the end of his reign, and the coming to the throne of his successor Vasithipata Pulumayi. The rule of this prince having lasted at least 24 years, that of Madhariputa Sirisena at least 8, and that of Visithiputa Satakani at least 13, we arrive, for the conclusion of this last reign, at least at the date 137+24+8+13= say 182 A. D. Rudradaman, the Kshatrapa, having ceased to reign before 180 A. D., it follows that it was certainly Vasithiputa Satakani, and not his successor, who is referred to in the inscription of Girnar. We see how completely all these data agree amongst themselves. The verification which is, in my opinion, the most important, consists in the complete accord which this system establishes without any effort, with the presumptions which we are entitled to draw from the mention made by Ptolemy of Chashtana and Palamayi. It must be, as we have seen, about the years 185 to 145 A. D. that this mention should a priori, lead us to fix the reigns of these personages, and, that too, independently of any preconceived ideas, or of any clue obtained from Indian sources. On the other hand, our deductions, founded on absolutely independent calculations refer the former to the years 130 to 140 or 145, and the second to the years 137 to 161 A. D. In the face of so striking a result it appears to me difficult to avoid recognizing how artificial and how fine-drawn must be the suppositions, by which some writers have sought to weaken the induction which the text of the geographer at once suggests to us. On the other hand, I must express my entire agreement with Dr. Buhler in the criticism to which he submits the rash attempts which have been risked to reconstitute the chronology of the period anterior to the Andhrabhrityas. Their contradictions, and especially the positive data which are furnished by the monuments, shew how little confidence is deserved by the lists of the Puranas. The more this epoch is still enveloped in obscurity, the rarer the means of marking out its historical development, the more important is it to cling with all our power to the marks which we have been able, in my opinion, to fix with confidence. I sum them up here. 1. The Saka era of 78 A. D. is the era founded by Kanishka. His monuments and those of his successors, the last of whom are lost in the obscurity which surrounds the commencement of the Gupta dynasty in 319 A. D., are dated in that era. 18 Arch. Sur. West. Ind. IV. 101. 19 Arch. Sur. West. Ind. IV. 15.
Page #217
--------------------------------------------------------------------------
________________ JULY, 1892.] THE INSCRIPTIONS OF PIYADASI. 207 2. It is in the same ora that the inscriptions and coins, on the one hand of Nahapana, the Kshaharata, on the other hand of the Kshatrapa Benas of Gujarat, are dated. The monuments, known to belong to the former, relate to the years 118 to 124 A.D., and the rule of the latter dynasty extended from about the year 130 to the end of the fourth century A. D. The great inscription of Rudradaman at Girnar dates from the third quarter of the second century of our era. 3. The reigns of the five Andhrabbritya kings, whose names I have given above, and the order of whose succession we are enabled to determine with the aid of various monuments, from Gotamiputa Satakani to Siriyani Satakani, All the greater part of the second century of our era. These conclusions put us in a position to date several epigraphical monuments which are certainly of decisive importance for the linguistic history of India. It is desirable that we should be able to do more, and to attain to equal certainty both with regard to the preceding period which separates the inscriptions of Asoka from those of Kanishka, and for the subsequent one. Unfortunately the elements for analogous deductions are not forthcoming, and we are, as a general rale, reduced to indications borrowed from palaeography, to which it is prudent to accord but a limited confidence. I should add that, so far as regards the principal question with which we have to deal, this uncertainty very luckily does not appear to have 'very serious consequences. There is one class of monuments, the coins, concerning which I have not much to say. M. de Sallet20 has submitted the problems connected with them to an examination at once complefe and thorough. I doubt whether the main lines of his conclusions can be seriously altered by later researches. Under any circumstances, I do not believe that the uncertainties which may remain unexplained, or the errors which may require correction, are of such an extent As to compromise the deductions which philology can draw from the legends of the coins. It would be more essential, but it is more difficult, to fix with confidence the relative dates, and the order of all the inscriptions which belong to the same period. By the side of those which bear the names of Kanishka, Huvishka, and Vasndeva, whose dates, as I admit, are certainly to be referred to the Saka era, there are others which various indications connect more or less closely with the same series, without its being proved, or even shewn to be probable, that they employ the same era. I refer especially to two characteristic inscriptions in Indo-Bactrian characters, that of Taxila, 31 dated in the 78th year, and belonging to the great king Moga, and that of Takhtibahi,2, dated the year 103, and the 26th year of the reign of a king whose name is read as Gudapharas, most probably the same as the Gondopbares or Yndopherres of coins and of legend; but if this identification is admitted, and if, on the other hand, we also allow the identification, which has been proposed, of king Moga with the king Mauas of the coins, there are, from a numismatic point of view,23 serious difficulties to be met in fixing the epoch from which to count this year 78, so as to calculate these two dates. All that is at any rate certain is that these monuments belong approximately to the same period as those of the Tarushka kings; and the study of the former should not be separated from that of the latter. As regards the two inscriptions of Mathurg (No. 8 and No. 9 of Dowson) which are dated in the year 135, and the year 280 respectively, I see no decisive reason against referring them to the series of the SA ka era. 90 Die Nachfolger Alexandera des Grossen in Baktrien und Indien. Of., however, also Gardner and R. 8. Poole, Coins of the Greek and Seythie king of Bactria and India in the British Museum. 21 Cf. Dowson, J. R. A. 8. XX. 921 and f. 23 Dowson, J. R. A. 8., N. 8. VII. p. 876. Of. now my Notes l'Epigraphie Indienne, in the Journal Asiatique, 1890, I, pp. 114 sad ff. 45 Cf. Ballet, op. cit. pp. 48, 51, 157. # Cf. Dowaon, J. R. A. 8., N. 9. V. pp. 182 and l.
Page #218
--------------------------------------------------------------------------
________________ 208 THE INDIAN ANTIQUARY. [JULY, 1892. A certain number of inscriptions, though undated, contain names which enable as to determine their age with some precision. Such are the short dedications of Dabaratha, the grandson of Asoka, and the inscription of Bherhut, engraved under the rule of the Sungas '25 To the same category belong some texts of a higher value, - the inscriptions of Nanaghat. They are connected with the most ancient of the royal inscriptions of Nasik,26 that which contains the name of king Kanha (Krishna) of the family of the Satavahanas. The reader may be referred to a learned essay which Dr. Buhler has devoted to these inscriptions and their date. It can be seen from what precedes, that I am not able to accept the whole of his conclusions. I consider at least that these monuments belong to the beginning of the dynasty of the Andhrabhrityas or Satavahanas. While I admit that it would not be safe to accept the discrepant evidence of the Puranas as a solid foundation for calculating the period which clapsed between the kings of Nanaghat and the series of sovereigns who have left us at Nasik authentic documents, we should not, at the same time, too lightly discard these confused traditions. Dr. Buhler has been perhaps led to display the more severity towards them because they disagree with the date, in my opinion too ancient, which he attributes to Gotamipata Satakani and his successors. There remains the evidence to be adduced from palaeography. Dr. Buh'er calculates thnt this does not allow us to presume a space of more than a century between the inscription of Nanaghat and those of Gotamiputa Satakani at Nasik. Dr. Buhler's authority in matters of this kind is too considerable to allow me to venture to dispute his opinion, and I will only confess that, if an interval of a hundred years does not appear to him improbable between the characters of Asoka and those of Nanaghat, I can scarcely understand how it can be certain that between the engravers of Nanaghat and those of Nasik, there did mot elapse 200 years or even more. The trath is that, at least for this period, we have no scale of paleographical development graduated by documents to which exception cannot be taken. After all, vexations as these uncertainties are, I do not undertake to reconstitute the history of the Andhrabhsityas; so far as the aim which I have in view is concerned, it is sufficient to remember that the inscriptions of Nanaghat certainly fall in the period intermediate between ABoka and Gotamiputa Satakani, and that they are, at least, & century earlier than the latter. As for the other monuments of the period we are compelled to content ourselves with analogous, though still more valuable conclusions. It is a fortunate circumstance that however desirable it may be in many respects to fix the exact age of each text, these conclusions are in the present case sufficient for us. There are, I believe, very few instances in which we are not in a condition to assert that such or sach an inscription is or is not anterior to the line of demarcation which marks the epoch of Rudradaman the Kshatrapa, and his contemporary Satakani the Andhrabhritya. To the period which extends from Asoka down to these sovereigns belong the edict of Khandagiri and the inscriptions of Ramnath,27 the inscription of Kangra, 29 as also that of Row4,29 and several epigraphs both in the caves of the west coast, as well as in the ruins of Sanchi,30 of Bharhut, 31 and Amravati.32 Taking the word in the very wide sense which I have explained above, the dates of these texts are subject to no serious doubts. It is a matter for regret, that, for the period which follows, I mean the 250 years which extend from the commencement of the 3rd to the middle of the 5th century We are still worse provided. The absence of materials is here almost complete. We shall see, when we explain the linguistic importance of this epoch, how much this is to be regretted, We are hardly entitled to include in this period the inscription of Banav&si33 or those of the 25 Cf. Hultzsch, Iul. Ant. 1955, p. 138. 26 Buhler, Arch. Suru. West. Ind. IV. 98, No. 1. 27 Canningham, Corpus. Cl. Ind. Ant. 1873, pp. 245-243. 28 J. R. A. S. XX. 254. 29 Ind. Ant. 1880, 120. 50 Canningham, Buddhist Stapas. 51 Cunningbam, the Bharhut Stapa, and Hoernle, Ind. Ant. 1881, 118, 255; 1882, 25; Hultzsch 2. D.M.G. XL p. 70. 32 Arch. Surt, Wext. Inuel. Burgess, Yoter on the Amriratt Stripe. 33 Burgess and Bhagwanlol, Inscript. of the Rock-cut Temples, p. 100.
Page #219
--------------------------------------------------------------------------
________________ JULY, 1892.) THE INSCRIPTIONS OF PIYADASI. 209 Jaggayapetta Stapa, for they so closely follow the time of Siriyana Satakaai that they really belong to the preceding group. Towards the end of the 4th century, the series of Gupta inscriptions opens with that of Allahabad, engraved in honour of Samudragupta, and with the dedications of Udayagiri and Sanchi35 contemporary with his successor Chandragupta, JS and dated in the years 82 and 93 of that era, say 401 and 412 A. D. They are followed by the inscriptions of Skandagupta at Girnar (138 G. E., i. e., 457 A. D.), and by others more recent.37 From this period the series of monuments is prolonged in fairly sufficient number of specimens.39 But between the commencement of the 3rd century and the first year of the 5th, I know of no inscription which has been dated with certainty. Even those the palaeographical character of which would probably place them in this interval are of great rarity. A:nongst the numerous dedications of the caves of the west, there are very few which appear to belong to it.39 We must put aside the most anciant monaments attributed to the dynasty of the Gangas 10 for the most experienced authorities in Southern Indian Epigraphy have declared them to be apocryphal.41 We are thus reduced to a few documents which emanated from the kings of Veigi. The earliest in point of date would appear to be the donation of king Vijayanandivarman, which Mr. Burnell, and, agreeing with him, Mr. Fleet, refer to the 4th centary. Both these gentlemen refer to the same reign a donation of the 'yuvamaharaja' Vijayabuddhavarman contained in the papers of Sir W. Elliot. It has since been published by Mr. Fleet.43 It seems, however, that the name, which had originally led them astray, is in reality Vijayaklandavarman,' and various circumstances go against the idea of a close connexion between the author of this inscription, and that of the preceding one. It is, however, none the less one of the most ancient inscriptions of the dynasty of the Pallavas, and dates either from the end of the fourth century or the beginning of the 5th. The language in which it is couched renders it a monument of the very highest interest, and I shall subsequently deal with it again. It is either contemporary with or very little earlier than the donation of Vishnugopavarman, 45 of his brother Simhavarman, and of Ativarman,*7 which are referred to the 5th century. * Ind. Ant. 1882, pp. 255 and fr. Bargess, Amravati Stapa, p. 55. Prinsep, I. 233. 36 Prinsap, I. pp. 266-217. 37 Inscription of Skandagapta at Kahaon (142) (Prinsep, I. 250), at Indoro (116) (J. 4. S. B. 1874, P 383), of the column at Bhitari, belonging to a successor of Skandagapte (Prinsep, loc. cit. p. 210), of the column of Eran, under Budhagupta (155) (Prinsep, p. 218); the inscriptions of Toramaya at Eran and at Gwalior. With regard to the other Gapta inscriptions I may also cito here the Jain inscriptions, dated in the year 188 of the Guptas, of which Dr. Hoernle has given a transcription and a revised translation (Ind. Ant. 1882, p. 309). - It is now enough once for all to refer to the excellent Corpus of Mr. Fleet. 38 I quote, simply as examples, the plates of Gurjara Dadda (158) (Dawson, J. R. A. S. N. 8. I. 218 and ff.; and Fleet, Ind. Ant. 1881, pp. 81, 115); the inscription of Umeta &c. The plates of Jayabbata (Ind. Ant. 1876, pp. 109 and ff.) appear to be earlier (429), if Dr. Buhler is correct in referring them to the era of Vikramaditya, but this conjecture appears to me to be very improbablo. 89 Nos. 7-10 of Kuda, Arch. Suru. West. Ind., (IV. 85-86) seena to me to be of slightly later date. I may men. tion, however, No. 1 of Kanheri, which Dr. Buhler dates in the 4th or 5th century. The inscription is both very short and very obscure, but its date has, nevertheless, in our eyes, an interest, which will become clear later on. * I refer to the donation of king Chera Arivarnan dated Baka 169, quoted by Dr. Eggeling (Ind. Ant. 1874, p. 152) and published by Mr. Fleet (Ind. Ant. 1879, p. 212), and the inscription published by Mr. Rice (Ind. Ant. 1878, p. 168), and referred by him to the year 350 of our era. We should add the plates of Merkara (Ind. Ant. 1872, p. 360) for which the figures 388, caloulated in the SAka Ora, gave the date as 466 A, D. 41 Burnell, 8. I. P. p. 34. Fleet, Ind. Ant. 1883, pp. 111 and ff. 12 Ind. Ant. 1876, p. 175. Mr. Foulkes has published a donation of Nandivarman, which ho believes to belong to the same prince (Ind. Ant. 1879, p. 167). The numerous discrepancies which exist in the genealogy, in my opinion, render this suggestion inadmissible; and, if the inscription is not apocryphal, a Mr. Fleet considera (Ind. Ant. 1880, p. 101, note), it must emanate from another king of the same name, posterior to this first Nandivarman. 48 Ind. Ant. 1880, p. 100. # Fleet, loc. cit. 45 Fleet, Ind. Ant. 1876, p. 50. 46 Fleet, Ind. Ant, 1876, p. 154. 47 Ind. Ant. 1880, p. 102.
Page #220
--------------------------------------------------------------------------
________________ 210 THE INDIAN ANTIQUARY. [JULY, 1892. But, as I have already said, from this time the harvest of monuments again becomes sufficiently ample for it to be useless to undertake enumerations which would necessarily be incomplete. I lay stress neither on the plates of the earlier Kadambas, nor on those of the first Gurjaras, Dadda,49 or Jayabhata.50 They bring us down to a period too modern to affect the questions of formation and origin which alone interest us at the present moment. These are the known dates of the monuments which enable us to put forward precise conclusions for the chronology of the linguistic history of India. The preceding summary has therefore, been indispensable. By language, or more exactly by grammar and spelling, the epigraphical types divided themselves, in the period under consideration, into two series. The two currents continually intermingle and become confused, but we are, nevertheless, compelled to follow them separately. Of the two sections which follow, the first will be devoted to Mixed Sanskrit and to classical Sanskrit, and the second to monumental Prakrit and to the literary Prakrit. I shall commence in each case by detailing the characteristic facts which are furnished by a study of the inscriptions, and shall then examine the general questions which connect themselves with it. WEBER'S SACRED LITERATURE OF THE JAINS. TRANSLATED BY DR. HERBERT WEIR SMYTH. (Continued from page 185.) XXXVII. Third chhedasatram, the vavahara. We have already seen above, pp. 447, 449, that the three texts dasa, kappa and vavahara, according to the Avasy. 16, 109, are connected as one group. In the arrangement found in the Avasy, and in that handed down in the Nandi, vavahara is placed in the last place after dasa and kappa. This position after the kappa is also allotted to the vavahara [466] in the penultimate verse of the bhashya85 belonging to it, and consequently in Malayagiri's comm., where there are two statements to this effect - in the introduction and at the conclusion of the seventh udd.97 The same conclusion may be drawn from the compound kalpavyavaharau in schol. on Oghaniry. (see p. 449), though there may be here nothing more than a mere reference to the greater brevity of the word kalpa. In the Rutnasdgara (see p. 449), however, the vavahara stands at the head of the chhedasutra. We have already seen (ibid.) that kalpa as vavahira is attributed-especially tu Bhadrabahu and considered as an extract from purva 9, 3, 20 According to Avasy. 2, 6, Bhadrabibu (sapposing that he is here the speaker) composed at least a niyyutti on it. And we have also seen (p. 446) that the text is divided into ten uddesasoa in agreement with the statements in Avasy. 16, 109. The contents consists of general regulations in reference to the penances etc., of the clergy and of disciplinary statutes concerning right and wrong - kappati, no kappati. Each of the uddesas closes, after the fashion of angas 1-3, with ti bemi. The text is in prose and well preserved. The Prakrit bhashya in drya, is found entire in Malayagiri's very detailed commentary, which is in reality rather a commentary on the bhashya than on the text itself. [467] In the commencement of the very lengthy introduction we find the relation of the text to the kalpa stated as follows:- kalpadhyayane abhavat preyabchittam uktam, na ta danaprayaschittar danam; vyavahire tu dinaprayaschittam alochaniividhis cha 'bhidhasyate. 49 Ind. Ant. 1877, p. 22; 1878, p. 34. 19 Dowson, J. R. A. S., N. 8., 1, 2 18; Bhandarkar, J. R. A. S., Bo. X. p. 19. 50 Inscriptions of Kavi, Buhler, Ind. Ant. 1876, p. 109; of Uineta, ibid. 1878, p. 61. 5 kappavvavahirknam bhasain muttuna vittharam savyam. uktnin kalpadhyayanan, idanin vyavaharadhyayanam uchyate. 7 parvam kalpidhyayane bhanita. 98 Or according to its own schol., also in 3 khandas (udd. 1, 2; 3-6; 7-10). 99 pithika (see p. 455), in 2356 gr., corresponding to 182 verses of the bhashya. The entire commentary embraces 35122 gr.! The MS. which I have before me is dated Samvat 1565 A.D. 1509.
Page #221
--------------------------------------------------------------------------
________________ JULY, 1892.) SACRED LITERATURE OF THE JAINS. 211 udd. 1 treats of pariharatthanam lasting 1, 2, 3 or 4 months, - 2 of the relation of two shammiyas, -- 3 of teacher and scholar, - 4 of the mera (maryada) sahunam, -5 of the mera samjatinam, - 6 of mischances (also niggamthina), -7 of the raja dinam avagraha, - 8 of the sadharmikavagraha, - 9 of the ahara, - 10 of the abhigraha. See above, p. 445, in reference to the vavahara as source of the gachhayara. XXXVIII. Fourth chhedasutram, the dasa6 or Avaradasau, dasas, in fuller form dasasrutaskandha, in 10 addesas (uddesanakala Avasy. 16, 100), of which i to 9 are called dasa, the eighth is called also ajjhayanam and the tenth ajjhayanam only. In Avasy. 2, s the speaker declares himself to be author of a dasanam niyyutti whose author tradition (see Jacobi, 1. c. p. 12) calls Bhadrabahu. The great antiquity of the text is proved by the fact that not only is it cited in anga 3, 10 under the title Ayaradasau, but also the names of its ten ajjh. cited there are the same as those given here. See p. 272. Each of the first seven dasas begins after the fashion of anga 1 with the formula: suyam me a usam ! tenam [468] bhagavaya evam akkhiyam and closes with ti bemi. After akkhayam there follows another formala, which briefly says that the contents of the following section is as "therehim bhagavamtehim pannatta," as in up. 3 (p. 388), see Abhayadiva on anga 3, 10 f. 2886. The doctrines in question it refers to the predecessors of the bhagavant (see also up. 10, p. 423). In the first das 20 asamahitthana are treated of, in the second 21 sabala100 (sabalani), in the third 33 asayaniu, in the fourth 8 ganisampada, in the fifth 10 chittasama hitthana, or, according to V, attasohi (here there is a legend of a -sermon of Mahavira at the time of Jiyasatta, king of Vaniyagama, closing with 17 elokas), in the sixth 11 uvasagapadimaa, in the seventh 12 bhikkhupadimau. All this deals with regulations having reference to the department of the vinaya, and treats of the course of life and the discipline of the laitg and clergy. The method of treatment is short and compact. The eighth section is called ajjhayanam, but in auga 3, 10 as in V., pajjosavanakappo, exceeds the first 7 dasas in its contents and in its extent. Certainly its largest portion has been inserted here at a later period. It is formed of the work called Kalpasutra and in fact of the entire work of this name in its three parts, according to the MSS. and the Kalpantarvachyani. Jacobi (Kalpas. pp. 22, 23) has already called our attention to the fact, that in reality only the last (the third) section, [469) which is called "samichari, rules for yatis," and also paryushana. kalpa - cf. the title of this book in anga 3 and V. - belongs in this place, and that it alone could claim, together with the remaining parts of the dasisr., to be ascribed to Bhadrabahu. The closing words tti bemi, payyosana kappadasa attbamam ajjhayanam are similar to those of the other dasau and substantiates this conclusion. The contents of this section refers to the varshavasa, and treats of that which thereby is kappal and no k. In the introduction commencing with the legendary formula -- tenam kalegam - it is stated how Mahavira acted in these cases. The following portions, each of whose sentences invariably begins with a stereotyped refrain, is at the end ascribed to Mahavira in special legendary form likewise introduced by tenam kalenam. I will refer to the other parts of the Kalpasutra The ninth dasi, also called mohaniyyatthipam, has the usual legendary beginning: tepan Falenam.., and tells of a sermon of Mahavira under king Kuniya of Champa in reference to the 30 (so also anga 3) mohatthanaim. The portion dealing with this sermon consists of 39 blokas, for the most part with the refrain : mahamoham pakuvvai. The conclusion is ti bemi. The tenth book, ayatitthanam2 commences with the usual formula: tonam kalenam, and tells in great details how Senia [470] Bhimbhisara, king of Rayagiha, together with his spouse 100 Cf. Av. 18, 94 - 90, and Prasnavyak. conclusion (Leumann). 1 Cf. Avasy. 16, 17 fg. 2 ajananam &jati(h) sammurchhanagarbhopapatato janma, tasyah sthanarit samsarah Abhayadeva on anga 3, 10 (299a) in the introduction. 3 It refers to ap. 1.
Page #222
--------------------------------------------------------------------------
________________ 212 THE INDIAN ANTIQUARY. [JULY, 1892. Chellana, listened to a sermon of Mahavira. The sight of the princely splendour turned the thoughts of the followers of Mahavira to worldly things, to rebuke which Mahavira preaches a lengthy sermon on the excellence of his doctrine, divided into 10 SS and beginning with the same refrain. Nor does he forget to mention the rewards of those who follow his teachings. The result of this sermon was that his audience were delighted and Mahavira continued to preach in Rajagriha. The legendary excursi of the last dasau (5, 8, 9 and 10) in reference to Mahavira are doubtless the cause of the introduction of the Kalpasutra, the first part of which treats especially of the life of Mahavira. The Kalpasutram was the first Jain text which was made known, in 1848, in the very faulty translation of Rev. J. Stevenson. It is now carefully edited by H. Jacobi, 1879, to whose instructive introduction I have so often referred, We have already observed, that of the three parts of which it is composed, the last alone can claim to belong to the dasau. The two other parts were originally not connected, Each of them is divided into three portions, the first of which contains the history of Mahavira, the second that of his 23 predecessors, the third a list of his successors, [471] Theravall, to Deviddhi-khamisamana, the nominal redactor of the 45 agama. This Thoravalt agrees as regards each of its first twelve parts with those statements which are found in the theravali of the Nandi and of the Avasyakasutra, and in the later tradition of the Jains (fishimandalasutra of the Dharmaghosha etc.), But from this point on there is no such harmony. The list found here is the most complete, since it embraces a large number of the lateral branches proceeding from each of the patriarchs; and contains all sorts of divergences from the other lists. Jacobi distinguishes" four or five distinct treatises" (p. 23). It is self-evident that any connection is impossible between this Theravali and Bhaddabahu, the nominal author of the Kalpasutra - see below who appears in the seventh place in the list of patriarchs. The Thoravali contains eleven members more (ajja Vaira, Vajrasvamin, as number 16) nor did it belong originally to the Kalpasutra. This conclusion holds good also in the case of the account of the 23 predecessors of Vira which introduces it. In this account we find some few details in reference to two of Vira's immediate predecessors, Pasa and Aritthanemo, and in reference to Usabha who is placed first in the series. The other pre. decessors are treated of in a very few words. The relation is retrogressive, beginning with the 23rd. We find no mention that Malli (Mali in the text of Jacobi) was a woman. The intention of collecting everything that had reference to Jainism is manifest in the addition [472] (see Stevenson, p. 99) of these two sections, in reference to the successors and predecessors of Mahavira, to the main part of the Kalpasdtra which treated of his life. This main portion contains towards the close ($ 148) statements mentioning the dates 980 and 993 after Vira. According to Jacobi (p. 23) it is self-evident that these dates do not "refer to the author, but to Devarddhiganim, the editor of the Kalpasutra." Tradition places Bhadrabahu, the nominal author of the Kalpasutra, in the year 170 after Vira (see Jacobi, p. 114). But as far as I can see, an error or confusion has brought it about that the Kalpasutra has been ascribed to Bhadraba hu, as tradition, e. g. the introduction to the Kalpantarvachyani, states. In the well attested statement (see above, p. 449) that the Kalpavyavaharau was extracted from purva 9, 3, 30 by Bhadrabahu, we must not understand by "kalpa" the Kalpagutram, but the chhedastra 5, a conclusion that may be drawn from the statemente in reference to the division of the two texta kappa and vavahara, which is found in Avasy. 16, 109 The similar statement concerning the dasa-kappa-vyavahara in the Rishimandalasutra (Jacobi, p. 11) is, after a consideration of this passage of the Avaay., not to be referred, as Jacobi refers it, to "the 4.. mad dhamme pannatte, inam &ya nigganthe pavayane, sa che anuttare padipunne kevald .. (of. Aupapat: $ 56, p. 62, ed. Leumann),
Page #223
--------------------------------------------------------------------------
________________ JULY, 1892.) SACRED LITERATURE OF THE JAINS. 213 ten kalpas and the Vyavanara," but (see p. 357, 450) to the three chhedasutras 3-5: the dasau, the vavahara and the kappa. Personally I am inclined on the strength of $ 148 to hold Devarddhigani as the editor, and and even as the [473] "author" of the chief part of the Kalpasutra. I will even go a stepfarther and assert that in reality the Kalpasutram, or its present essential part, has no claim to this title, which is at complete variance with its contents. It has received this name after its junction with the paryushanakalpa, the eighth chapter of the dasan. This ancient title (see p. 468) is cited in the beginning of the sandehavishaushadhi as a collective title of the work. See Jacobi, p. 99. The Panchanamaskara, placed " keshuchid adaraeshu" at the commencement of the text, is known to us from anga 3 and upanga 4. It is followed here as in up. 4 by the passage in its praise, which is supposed to date back to Vajra (see Kup. 811), and is designed to glorify this commencement. This passage of the pamchanam. contains the form havai - and not hoi as in up. 4 - which in more modern times is regarded as the only well attested form. See p. 393, $$ 1, 2, which contain the recital so obnoxious to the Digambara (see Jacobi, p. 22) --- sce p. 261 - that Mahavira first "entered the womb of (the mihani) Devinanda before ho was placed ($ 21) in that of (the kbattiyani) Trisala "7), are borrowed outright from nugn 1. Jacobi, p. 23, considers the portion containing the 14 dreams (S$ 33-46), with their long, complex compounds, as a secondary addition, since it is not in harmony with the prevailing "archaic style" of the text. I shoald prefer to regard the solemnity of the subject as the cause of these stylistic differences. [474] Upon such occasions the aigas contain numerous stylistic excrescences, which, it should be remarked, occur not infrequently in other parts of the Kalpasutra. The differences of this kind in $$ 3-46 (or does J. extend the description of the dreams further than 16 ?) may therefore, I should think, be reduced to a minimum. The historical kernel of the recital is exceedingly small. Up to $ 96 (incl.) the events before the birth of Mahavira alone are treated of. The following S8 to 111 discuss the birth, naming, childhood of M. and his life as gihattha. It is noteworthy that there is no mention of foreign nurses, as is usual in the angas and upangas on such occasions, nor are the 72 kalas etc. referred to. The enumeration of the Brahminical sciences in SS 10 is the usual one, which we have already met with in auga 5. The recital as to how Mahavira : anagariyam pairrae (8 116), and of his farther development up to the time of his death ( 132) is devoid of every particle of life. There is no trace of the many legends concerning him which we find scattered here and there in the angas, etc. They have not been made use of at all; hence the whole makes a most unsavoury impression as regards any biographical information. In 147 the mention of the 55 ajjhayanas of the pavaphalavivayaim (see p. 271) is of interest, as also that of the 36 aputthavayaranain, which, according to Jacobi, p. 114, are to be referred to the uttarajjhayanam, We have in the work entitled Kalpantarvachyani, a production partly in Praksit, partly in Sanskrit, and in a mixture of the two (475). After a self-evident introduction in reference to the ten forms of the kalpa : achelukka (achelatvam), uddesia (auddesika pinda), sijjayara (sijjataro (sayy&o] vasatisvami), riyapinda (presents from the king), kiikamme (kritio), vaya (vrata), jittha (jyeshthatvam), padikkamane, masam (masakalpab), pajjovasanakappe (varshasu chaturmasavasthanarupah), in reference to the purvas, out of the ninth of which the srikalpa of Bhadrabahu, "uddhrita," etc., is the Kalpantar., in loose connection with the text of the Kalpasutra, makes the text of the latter the point of departure for the insertion of a large number of legends and other statements in prose and verse. The freqnent mention of Hemachandrasuri and of Manatungasuri, Malayagiri, of the Vamanam, Sarasvatikanthabharanam (as vyakara . Wo find, however, mention made of a ten-fold division of the kalpa, e. 9. in the introduction to the Kalpantarychyani. See p. 475. 6 Wife of Usabhadatta, cf. Wilson Sel. W. 1, 203 (see Bhagav. 9, 33. Leum.). 1 Wifo of Siddhattha of the Ndys race.
Page #224
--------------------------------------------------------------------------
________________ 214 THE INDIAN ANTIQUARY. [JULY, 1892. nam !!) and Sarasvatam vyakaranam shows that it was composed at a tolorably recent date. In general it may be said that there is a large amount of citations collected here. Of especial interest is the peculiar attempt made in the introduction to prove the great age of the Jinasasanam from supposed Vedic passages, as the two "vaisvadeva-richau Yajurvede9 ." om rishabham pavitram puruhutam adhvaram yajneshu nagnam paraman pavitram srutadharam yajnapatipradhanam pitaryajana (!) pasum indram ahave 'ti svihi, and : trataram indram rishabham vadamti anithram indram tam arishtanemim bhave , subhavam saparovam indram have tu sakra ajitam jinesdram tad vardhamanam puruhutam indram svaha, and also Vs. 31, 18, Rik 2, so, e etc. all of which is cited [476] incorrectly! The detailed enumeration of the Brahminical sciences in $ 10 contains much of interest (18 puranas, 18 smpitis, 18 vyakaranas). The foreign serving-women are enumerated in SS 16, essentially in the regular way: - khujjad chilid vamanid vadabhid babbarid pausiko janiko palhavid isinid charainiao laziao lausid domalid simhalio abarid (!) pulimdio pakkanid marum did bahalid sabarid parasid jatiye disyah. - On 108 : bhagavato lekhanasalakaranaprarambho likhyate (in Praksit), - on $ 209 a double enumeration of the 72 kalas and of the 18 lipayas - see above p. 400 - on $ 211, 64 mahilagunks. The oldest of the coramentaries to which I have had access is the Samdehavishaushadhir of Jinaprabhamuni, composed in Ayodhya A.D. 1307; at the end there is added a commentary to a paryushanike paniryakti. Both texts are composed in Prakrit, and the commentary is based especially on the nisithnehurni. This fact recalls chap. 8 of ehhedasutra 4. XXXIX. Fifth chhedastram, the btihatkalpa, in 6 uddesas. Ordinances for the clergy of both sexes (niggatha and niggamthi) in reference to that which is proper (kappati) and that which is not (nd kappati). The ngreement in reference to the division into 6 addesas shews that it is our text which (p. 446 ff.) is designated in the Avasy. 16, 109 in connection with dasa and vavahara and under the name of kappa simply. 5477) We shall bave to recognize it under the designation of kappa, or kalpadhyayana, in other passages (see pp. 449, 472) where there is mention made of the extraction of kalpavyavaharau from purva 9, 3, 30 by Bhadrabahu. Its designation as btihatkalpa, or vsihatsadhukalpa is unsuitable if we regard the diminutive size of the text (only 475 gr.). The conclusion (ti bemi) of udd. 4 and 6 is worthy of note. The old bhashya in Praksit aryas, belonging to this text, is designated simply as kalpabhashya, and is an enlargement of the "kappassa nijjatti," which the author of the Avasy. declares that he composed (2,7). See Kielhorn (in the Report on the Search of Sanskrit MSS. 1880-81, pp. ix. x.), in reference to an old MSS. of it (Samvat 1218), and to its very curious use of letters of the alphabet to denote numerical notation.10 The commencement differs considerably from that in a palm-leaf MS. similar to this, but much younger (Samvat 1334), of which the Berlin Library possess a copy made on transparent paper. The commencement of the Berlin MS. - after prefacing the first 6 SS of the text - is namo arabamtanam, kauna namokkaram titthayaranam tiloyamahiyanam kappavvavaharanam vakkhanavihim pavakkhami Il XL. The sixth chhedasutram is called pamohakalpall in Buhler's list; - see p. 226. I have not bad access to a text of this name, which is repeatedly mentioned (see pp. 448, 449) I am unable to explain the first passage, the second is manifestly Rik 6, 47, 11 (Ts. 1, 6, 12, 6): tratAram indram avitfram indrarh have have suhavan @dram inndrath hvay Ami enkrat puruhatam indrath avasti maghava dhAtv ithdrab II The words of the text which I have enclosed in brackets above do not occur here. na che 'data Jinsiaanam arvachinam, vedadishy api tadvachanAt, tath hi : vedeshu jinapramapAngull (?) darvi, tath& Yajurvede vaibvadeva-richau ... .1. On this see Bhagvanlal Indraji on the ancient Nagari Numerals in the Indion Antiquary, 6, 9 fg. (1877) and Buhler, itid. p. 47 fg. n In Kielhorn's report, p. 94, there is mention made of a paichakalpastrachurni by Amradevacharya.
Page #225
--------------------------------------------------------------------------
________________ JULY, 1892. MISCELLANEA. 215 both in Avi, and V., together with a jfakappa. According to the Vicbaramritasamgraha, the panchakappa is a work of Samghadasavachaka, while the jitakalpa belongs to the Jinabhadragaoiksbama [478]sramana.12 We find in it citations from both texts. The jita kaipa is also enumerated in the Ratnasagara, p. 507, as the sixth chhedasutram. Raj. L. Mitra, however (800 p. 227 above), mentions it as the last of his "five Kalpasutras." In lieu of commenting upon a text of the name of panchakalpa I will at least remark on the jitakalpa, which is mentioned together with it, that a sraddhajitakalpa in 141 Praksitgathas actually exists. It treats of the praFaschitta, which suits the character of the cbheasutras exactly, but is referred to a definite author, Dharmaghosha, scholar of Devendramunisvara. In the anonymous commentary on it it is designated as composed upanishatkalpa(!)kalpa-vyavahara-nisithayatijitakalpanusarena. In the commentary reference is paid to the pravachanam as samayikadibimdusaraparyamtam, and in v. 58 erroneous doctrines and pashandin are treated of in detail. Then the giatthas (see above, pp. 437, 450, 464). to which the text refers in v. 141, are expressly explained as erinisithadichhedagrartharthasutradharah.13 From all this we may draw the conclusion that the text is closely, [479] if not directly connected with the chhedasutras. We have already mentioned in reference to the mahakappa, Avasy. 8, 55, above pp. 446, 447, that the Nandi in its anangapavittha list recognizes the existence of a mahakappasuam, a chullakappasuam, and a kappiyakappiam. In the scholiast ibid. we find the following explanation : kalpakalpapratipadakam adhyayanam kalpakalpam ; tatha kalpah stbavirakalpadih, tat pratipadakam srutar kalpaarutam, tach cha dvidha: kshullakakalpo mahakalpo cha, tatrai 'kam alpagrantham alpartham, dyitiyam mahagrantham mahartham cha. There is, therefore, no doubt but that texts of this class existed.14 MISCELLANEA. NOTES ON THE CHINBOKS, CHINBONS, AND I bounded on the south by the Chinbong, the other YINDUS OF THE CHIN FRONTIER OF BURMA.1 boundaries being the same as those of the Geography.-The Welaung Chins inhabit the Chinboks. villages on the head waters of the Myitha river. The Chinbons inhabit the southern end of the They are bounded on the north and west by Monchaung and stretch across the Arakan Yomia Baungah8 Chins, on the south by Chinboks, and into the valley of the Pichaung. They are on the east by Taungas of the villages round bounded on the south by the Chinbong of the Webet, which is distant four days' journey. Minbu frontier, on the east by the Burmans, on The Chinboks live in the hills from the Mol the west by the Arakaneae. River down to the Sochaung. They are bounded History.--The Welaung Chins are stated to be on the north by Welaung and Baungehe Chins, of Baungshe origin. The Chinboks claim a similar on the east by the Burmans, on the west by the origin. The Yindus state that their origin is Arakan Yomas, on the south by the Yindu Chins. similar to that of the Taung Pas, an industrious The Yindus inhabit the valleys of the Salin race, who inhabit the Yo and Myith& Valleys chaung and the northern end of the Mon Valley, I in Burmese territory, and who claim to have come 12 See above, pp. 427, 430, where both texts are counted in with the painnas. There are there several other texts ascribed to Jinabhadra. The passage reads : Jinsbhao Gramapa krito jitakalpah, kshetrasamleah, samgrabant vibeshanavati cha. 13 In the scholiast on Vich Ar Amritasaragraha the following explanation for Jlyakappa is found in citation from the Panchakappa : jar jassa cha pachchhittam &yariyaparampardyaiviruddham joga ya bahuvihi ya leo khalu jiyakappo all; - and the word jiyam is ibid. explained as follows:- jam bahdhim giyatthehim Ainnain tarin jyam uchitam Achittam ity anaithAntaram vyavaharacharpipithe, jftam nems prabhatandkagitarthakita mary&da, tatpratipAdano grantho 'py upaoh ArAt. 14 Compare, also, the title of upanga 9. 1 Notes, dated the 20th April 1890, by Lieutenant E. M. Rainey, Commandant, Chin Frontier Lovy, regard. ing the Chin tribes bordering on the Yd Country in the Pakokku District, and printed originally as a Government paper by the Chief Commissioner, Burma. [The original paper is very difficult reading owing to want of care in composition. -e as aw in 'awful' throughout.-ED.) * [The word clyaung in such compounds means 'stresm' or ' river.' -ED.)
Page #226
--------------------------------------------------------------------------
________________ 216 THE INDIAN ANTIQUARY. from Popa Hill. The Chinbons, further south, point out a rock, which they state is the body of a min or official, who was killed in a quarrel with his brother, when they were emigrating from Popa, and was turned into a stone. The brother returned to Popa. The Chinbons claim Burman origin. Further than this the Chins appear to have no history. In appearance they resemble Burmans, though some have better features. Languages. The four villages on the head waters of the Myitba speak two dialects: the village of Welaung having a dialect of its own, differing from that of the other three. There are three distinct dialects of the Chinbok language, the northern, spoken from the Mo to the north bank of the Che with slight variation; the central, spoken by the south bank of Che and the Chauksitchaung; the southern, spoken by the Kadin and Sochaung Chins. The Yindus speak a language of their own; while the Chinbons speak a language which is identical with that spoken by the Chins, who live in the Laungshe township, and to whom they are related. There is no written language. Government. There appears to have been no attempt at government further than an incomplete village system. Each village has a thugyi." The title is hereditary, and does not necessarily indicate a man of influence. There is generally in each group of villages some man (or perhaps two of three), who is looked up to and respected either for being a brave sportsman or raider, or for having a knowledge of Burmese, or for some special qualification. These are the men who really lead the people. Quarrels are wiped out with blood only. There are no laws, but certain customs, which all observe.* Religion. There is no religion further than propitiating and consulting nats or spirits. The Chinboks appear to be perfect slaves to their nats (spirits). To propitiate nats an animal must be slaughtered; buffaloes, bullocks, maiban, goats, pigs, fowls, and dogs are chiefly used for this purpose; the three latter being more commonly used as they are so prolific. All are afterwards eaten, if the offering was sacrificed near home; but when raiding, on a journey, passing through notoriously unhealthy jungles, &c., saorifices are frequently made, animals being carried on purpose. For this purpose dogs are preferred, [JULY, 1892. as they follow and require no carriage. Nats are consulted in a similar manner, the direction in which the blood flows, &c., being one of the signs. Eggs are also used for these purposes, being blown as we blow them for egg-collections, i.e., with a hole at each end. They are afterwards painted and stuck on a stick, as also are cocks' feathers. Rows of these sticks are frequently seen across paths. 3 i.e., bijt in Burma the man who actually collects the revenue and is a kind of village headman. Raids are frequently abandoned at the last moment and after travelling long distances, if the omens are unfavourable. When nats are consulted or propitiated near home, every one gets drunk off home-brewed rice-beer. Tom-toms, music, and dancing accompany the ceremonies. Nats are sometimes humbugged by the wily Chins, an example of which will be found under the heading Marriages. They do not trouble about a future world. There are no priests. Medicine.-Medical science and surgery are unknown. No medicines are used. When a person falls sick the nats are consulted or propitiated: consulted to ascertain if the patient will recover or not; propitiated in hopes that the patient will be spared. The principal diseases are fever, bowelcomplaints, skin diseases, and wounds. Dress, Arms, Customs, &c.-The Welaung and Kwonan Chins more closely resemble the Baungshes than the Chinboks; but, as I have seen but little of them, I will not attempt to describe them. The dress of all the Chinboks from the Ma down to the Che is much the same everywhere, though there are slight differences. Those who inhabit the Chauksit, Kadin, and So streams wear a sort of compromise between the dress of the Chinboks and of the Yindus. The dress proper of a Chinbok man (see Plate 4) consists of a very small langot, as worn by natives of India when wrestling, and a piece of cloth, about three feet in length and one in breadth, which is folded and hung behind, being suspended by bits of string across the shoulders. The chief object of this cloth is apparently to have something warm to sit upon when the ground is cold. The women weave the clothes, and, when new, they are generally striped red and blue. The dress of a woman (see Plate 4) consists of a garment like a short jersey without sleeves and with an open V-shaped throat; also of a small lungs, which shows about 6 inches below the jacket. These jackets are also home-made and of similar patterns to the men's garments. [These have to a certain extent been reduced to writing: vide Maung Tet Pyo's Customary Law of the Chin Tribe. Rangoon, Government Press, 1884.-ED.]
Page #227
--------------------------------------------------------------------------
________________ INDIAN ANTIQUABY. Plate A A A Chinbok man. A Chinbok woman CE Jirar Chinbok woman. Chinhon woman. Yindu woman. Prom Irisut. Rainey', Sketches.
Page #228
--------------------------------------------------------------------------
________________ INDIAN ANTIQUARY. Plale B www ww1 HL. Tor A Yindu man NI 1,21 NAL U Chinbok in full dress. A Yindu woman. From Lieut Rainey's Sketchas
Page #229
--------------------------------------------------------------------------
________________ JULY, 1892.] MISCELLANEA. 217 In the presence of strangers the women either are also used. Women wear skewers in their stand or kneel. Any other position they could hair, but no feathers. not with modesty or decency assume on account Necklaces are much worn by both men and of their scanty skirts. women. They are made of beads of all kinds, The men tie up their hair with bits of rag,-red glass marbles with holes drilled through them, for choice. The hair is grown long. white metal bands, little bells like ferret-bells, In the cold weather men and women wrap cockspurs, teeth of hog.deer, cockle shells, kauris, blankets of Burmese or European manufacture coral, and stones, according to fancy. round their shoulders. Earrings of one pattern only are worn by men ; The Yindu man (see Plate B) wears a larguti, they are plain flat rings about two inches in diasimilar to that worn by the Chinboks, and also meter, supposed to be made of gold, but are pro bably generally of brass. They can be put on or off a loose blouse, without sleeves and open at the throat, which reaches down to below the knees. at pleasure by pressing the ends in opposite direcExcept in cold weather, they take their arms out tions. The elasticity of the metel keeps them of the sleeve-holes and wind the upper part of closed under ordinary circumstances. The holes in the ears are much pulled down by the weight the garment round their waists. The dress of of these rings. The women have large holes in the women (see Plate B) is similar to that of the their ears, in which they stuff thin strips of Chinbok women, except that the Yindu women, bamboo tightly rolled up. The only women I as well as the men, wear the blouse I have des have seen actually wearing earrings were some cribed above in addition to their other garments. Chinbok women on the Maungchaung, who wore The Yindus also use extra wraps and blankets bits of telegraph-wire about five inches long bent in the cold weather. into an oval-shaped ring! The dress of the more civilized Chinbons is Bracelets of brass wire are much worn by the exactly similar to that worn by the hundreds of men, sometimes nearly the whole of the right emigrated Chinbuns, who live in the Laungehe forearm being enveloped in rounds of wire. They township, and closely resembles the dress of the seldom wear them on the left arm. The women Burmans. The less civilized Chinbons, who live do not wear brass, but a white-metal branelet. on the Arakan side of the Yomus, wear what can hardly be called even an apology for clothing Wristlets to protect the left arm from the bowIt is stated that some even use the bark of trees string are always worn by men. Among the Chin. to hide their nakedness. The Biblical fig-leaf boks they are made of cane wicker-work lacquered would be more covering than was worn by some over ; but sometimes a strip of leather is used. of the villagers we met. These wristlets are about six inches in length and are frequently ornamented with bells. The Ornaments.--The clothing above described is Yindus wind a piece of string or rope round their supplemented by various ornaments. To begin wrists in lieu of the wristlets described above. with, the head is often decorated with coils of beads of different colours, kaurte, &c. Brass The Chinboks of the Chechaung wear long brass skewers are generally stuck into the hair, and, | guards, enveloping the whole of the back of the in the case of the Yindus, are generally beautified left arm up to the elbow, which are kept in by tassels of goat's hair dyed red or bunches of position by the wristlets. They are intended the teeth of the hog-deer. These skewers are partly to protect the arm from dagger-wounds used for scratching their heads, which are full when fighting, and partly for ornament. of lice. Sometimes bone, ivory, bamboo, or Arms and Accoutrements.-Among the Chinporcupine quill skewers are worn. Feathers boks and Yindus every male.carries a bow (see are universally used as head decorations by the Plate C) from the time he begins to toddle. men. Sometimes only a few, generally white cocks', It is made of bamboo, well seasoned by being feathers, are stuck into the topknot, for they smoked for several years over the fireplace wear their hair like Burmans: sometimes the in the hut. It takes five years' seasoning to whole of a cock's tail and part of the back is thoroughly mature a bow. The length of the worn. In the latter case the bird is skinned, and bow of an adult is usually about four feet. It the part to be worn is dried and stretched on is thickest at the centre and tapers to the ends, a bamboo frame with a bamboo skewer to stick where it is notched to hold the string. The into the hair. This arrangement is worn at the string is made of cotton, sometimes plaited with back of the head and presents a peculiarly bamboo and other fibres. When bows are not ludicrous appearance. Green parrots' feathers' in use they are frequently unstrung.
Page #230
--------------------------------------------------------------------------
________________ 218 THE INDIAN ANTIQUARY. [JULY, 1892. The arrows are carried in a quiver or basket waist in front to the small of the back behind. (see Plate C) on the left side. They are about a It is worn across the left shoulder, like the sash of foot and a half in length (the shaft being made #military officer, the ends being tied together at of bamboo about the thickness of a pencil), and the right side with a string, to which the dagger are neatly tipped with feathers or bamboo shav. in its bone sheath is attached. In the case of the ings. The heads (see Plate C) are of several kinds. Yindus this armour is frequently made of cane For war purposes and for killing big game iron | basket-work thickly covered with kauris. The heads are used. These again are of different Chinboks also frequently adorn theirs with kauris shapes and various sizes, some being barbed and and small bells like ferret-belle. some lozenge-shaped. The other heads they use The arrows are carried as follows:- A neat are hardened-wood points spliced on bone-heads basket, generally measuring about one foot four for shooting fish,--these are said to be very inches in depth, one foot eight inches in length, deadly for this purpose,-and, lastly, shafte with and eight inches in breadth, is slung on the right the points sharpened for shooting birds. shoulder, hanging therefore on the left side. It The arrows with iron heads carry 150 yards is divided into compartments. Nearest the front and further, and are very deadly, killing bear, a bamboo quiver containing the iron-headed tiger, deer, &c., at 80 yards range. Chins do not arrows is kept in place by cane loops in the basket. poison their arrows, and usually keep them This holds about twelve arrows, and has a top, bright and clean. But, as they use their arrows sometimes of bamboo or canework lacquered over, time after time whenever they can find them and sometimes of bamboo ornamented with red again, and as wounded animals frequently escape beads. This top is attached by a string to the only to die afterwards in the jungles, and as these breastplate, the string being frequently adorned arrows, which are frequently pulled out of the with small bells. The next compartment in the carcasses of animals in a putrid state, are used basket contains a somewhat smaller bamboo, indiscriminately with those that are clean, blood. which acts as a box for tobacco, tinder, steel, and poisoning is very likely to follow an arrow wound. flint. The tinder used generally consists of This has probably given rise to the idea that they bamboo filings. The lid of this 'box' is generally poison their arrows by sticking them into dead ornamented with red seeds. The rest of the animals. basket holds a pipe, arrows without heade, and odds and ends. Outside the basket at the back is The only other weapon which every man carries fixed a small bamboo holding a spare bowstring. is a dagger (see Plate C) a little over a foot in length, worn in war-time in a bone scabbard on On the left [P ED.] side a basket, measuring the right side attached to the shield or rather one fopt in depth and length, and eight inches in to the leather breast-plate (see Plate C). When breadth is generally worn. In this food, &c., is ca.crad in nencefal parauite it is stuck into al carried. It has a compartment, into which the basket, worn on the right side, in which there dagger fits as already described. is a sheath to receive it (see Plate C). The bone The pipes smoked by Chinboks and Yindus (see scabbard mentioned above is the shoulder-blade Plate C) are of three kinds :-firstly, a plain bamboo of a buffalo or bullock with a bamboo back. pipe with a bamboo stem a foot long; secondly, a These daggers are used both for fighting and pipe with a baked bamboo bowl and bamboo stem : for cutting up food, &c. The people make great thirdly, a pipe on the principle of the hubbleuse of them when fighting among themselves, bubble. This last consists of a gourd, in which which they frequently do when drunk. It oosta some water is kept, and from which a bamboo nothing to stick a knife into a man, while it he it into a manthila i he tube fitted with a neat earthen bowl, projects were shot with an arrow and afterwards escaped, about an inch from the npper side. The smoke is the arrow-head, which is valuable, would be lost. drawn into the mouth through the end of the gourd, where it tapers off at its stem. The tobacco Many men carry spears (see Plate 0), which the people smoke is grown by themselves, and resemble Burman spears :-in fact, many are is very rank and offensive in smell. They are obtained from Burmans. always smoking. The women smoke as well as Every man wears a kind of leather armour. the men. It consists of a strip of bent buffalo hide, about The Chinbons for the most part carry nothing nine inches to one foot broad, reaching from the bat spears. They have a few guns and a few (I make out from this that the dagger-basket, Bee Plate C, in the time of peace, is the food basket in time of war.-ED.)
Page #231
--------------------------------------------------------------------------
________________ INDIAN ANTIQUARY. Plate C. Dagger TOLLER Dagger basket Arrow Basket Scabbard a Breast Plate 72 Tube 101 Www Liquor Jars. Pipes and Hubble bubble. Arrows GOURD WUBBLE-DUBBLE From Litut Rainey's Sketchas.
Page #232
--------------------------------------------------------------------------
Page #233
--------------------------------------------------------------------------
________________ JULT, 1892.) MISCELLANEA. 219 bows and arrows. They have a square leather weeds have constantly to be kept down, and the shield, which, when on the war.path, they carry in work of weeding falls to the lot of the women, the left hand, and with which they ward off spear who also loosen the ground round the young thrusts and arrows. They have no accoutre- shoots with Dambyas, which are bought from ments. Burmans, as soon as the crop is a few inches high. Exports and Imports.-The principal exports The first crop of sat is reaped in August; other of these Chin tribes are crops are reaped in November and December. Plantains. Sat (a small millet). The same ground is cultivated for two years only, Tobacco. Ginger. as in the third year the grass grows so strongly Indian-corn leaves Pork. that cultivation is impossible. It is therefore left (for cheroots.) Honey. until jungle has again grown on it, when, usually Chillies. Beeswax. after five years.-- it can again be cleared and Turmeric. Cane mate. cultivated. The principal imports are Threshing is performed as under:-The grain Salt. Marbles. in the ear is collected in heaps near the grainBlankets. Trinkets. huts in the fields, and trodden out by foot on large Sheets. Spears. cane mate, from which it is transferred into Gaungbaungs. Damarks.7 enormous cane baskets standing over four feet Cotton (raw). Pauktis." high. Some grains, such as Indian-corn, are Cotton (thread). Iron. stored loose in the ear in the grain-huts. Needles. Sickles. The principal crops areDyes. Cattle. (1) Taungya paddy. (12) Sugarcane. Brass-wire. Goats. (2) Sat (a small mil- (13) Plantains. Gongs. Dogs. let). (14) Pineapples. Cymbals. Fowls. (3) Chaiksan (a large- (15) Chillies. Small bells. Ngapi. grained millet). (16) Brinjals. (AuBeads. Dumbyas.10 (4) Millet. bergine). Agriculture.-The system of cultivation carried (5) Indian-corn. (17) Tomatoes. on by the different sections or tribes on the South (6) Yams. (18) Pumpkins. Yd frontier is much the same everywhere, and (7) Sweet potatoes. (19) Gourds. the crops produced vary but slightly. It is all (8) Ginger. (20) Tobacco. taungya" cultivation. No cattle are used in (9) Beans (of various (21) Cotton. ploughing. All the work is done by hand, a great kinds, some an (22) Turmeric. deal being performed by women. The only inch in length). (23) Onions. exception to this systom of agriculture is that a (10) Peas (of kinds). (24) Garlic. few villages of Chinbons in the southern end of (11) Dal. the Mon Valley have a few buffaloes, with which they plough a few paddy-fields; but this industry Much damage is done to the crops by bears, does not prosper, as their more powerful neigh- pigs, and deer, and also by birds. The Yindus bours carry off their cattle to sacrifice to the nats. build huts high up in trees, in which they sit at The first operation in the taungyd system is night to frighten off the bears. Various scareto clear the jungle off the slopes to be brought crows are also used to frighten off birds. under cultivation. This work is performed by Grains which require to be husked are treated the men in the month of October with damauks, as follows:-A log is planted in the ground which they buy from the Burmans. The jungle, protruding about three feet. The top is scooped thus cut, lies until quite dry, till it is burnt in out so as to form a deep cup, into which the grain the month of April. The ground is then cleared is dropped and pounded with a club. The Chinand, without further preparation, the grain is bons, who live in houses near the ground, have planted as follows:-In the right hand a sharpened this log protruding through the floor of their or rather pointed, stick is held, with which holes houses and therefore perform this work inside are drilled into the ground. Into these holes the the house. This work falls on the women, and grain is dropped with the left hand. After this very hard work it is. While cultivating, the Burmese turbans. 1 dls or knives used for household purpose. & Spades. Preparation of putrified fish used as a condiment. 19 Trowels. 11 Temporary forest clearing.
Page #234
--------------------------------------------------------------------------
________________ 220 THE INDIAN ANTIQUARY. (JULY, 1892. Dogs. villages are deserted, the people living in tem. porary luts in their fields." Local Products and Industries. The only local producte, besides agricultural, are (1) Pottory, which is confined to a few villages only, Myaing on the Mon and Myin on the Maung being the foremost in this industry: (2) The manufacture of daggers, arrow-heads, and spear-heads confined to certain villages : (3) The production of lac, which is abstracted from troes in most villages and used in the manufacture of accoutremente, &c: (4) The production of salt. The largest saltsprings are on the Mo at a place called Sanni, six daing" from Tilin, where 200 viss of salt can be produced daily, and there are other springs further up the stream. These are, however, the only springs of importance. A small quantity of salt is procured at a place on the Chechaung, three dains from Yayin, a Burman village. The salt is produced by boiling down the water: (5) Spinning, which is done by the women; all the clothes of a purely national character being made by them. The people import most of their cotton, but grow a little : (6) The minufacture of mats, brooms, baskets, and such like articles; besides bows, arrows, and accoutrements: (7) Hunting, as a means of filling the pot, though the people collect heads (of animals) and trophies with a thoroughly sportsmanlike interest. They track their game and shoot it with arrows, bringing down tiger, bear, admbhar, pig, &e. They frequently come to grief and get badly mauled, and many are killed by tigers and bears : (8) Fishing, which is carefully and systemati. cally carried out in various ways;-a) by shooting the fish with arrows, at which the people are wonderfully skilful; (b) by catching the fish in basket traps, in the manner of the Burmans on this frontier; (c) by catching the fish with nets made locally; (d) by diverting a stream and isolating stretches of it with dams, and then poisoning the fish with the bark of a certain tree, which is stripped off, pounded, and thrown into the water prepared as above. Forests.-The lower slopes on the Burmese side of the Chin Hills contain some fine teak, especially near the mouths of the Yd, Maung, and Che streams. Bamboos are plentiful throughout the hills. On the higher slopes are fine fir foreste, oaks of various kinds, rhododendrons, and so on. 12 [A Shan custom also. -Ed.). Dwarf bamboos, making excellent fodder, were constantly met with, even at heights over 7,000 feet above sea level. There is some cutch on the lower slopes on the Burmese side. Flora and Fauna.-On the lower slopes the usual flowers and vegetation seen in Burma are met with. Higher up flowers and plants of a colder climate are seen, including orchide, ferns, roses, lawn daisies, marguerites, thistles, mosses; also a shrub with a flower like hawthorn. The wild animals are :Tigers. Hare. Bears. Porcupine. Leopards. Otter. Pigs. Wild cats. Deer of many kinds. Jungle fowl. Wild cattle (sain Pheasants(silver). and pyaring). Partridge. Monkeys. Many kinds of Apes (Hoolocks). small birds. The domestic animals are : Maiban. Pigs. Fowl. Goats. All are used for food and sacrifices, and for marriage gifts. Housos.-The houses resemble those of Burmans, except that they are stronger and better built; the thatch on the roofs being often a foot thick, well put on, and firinly tied down. The foors are frequently of teak or fir planks hewn out of a single tree. The floors are raised three to six feet from the ground. Pigs, gonte, dogs, and fowls lire underneath and all round, and the houses, though otherwise clean, are full of fleas. The fireplaces are similar to those in Burman houses. During the cultivating season the villages are abandoned and temporary huts are built in the abandoned and tempo fields, as well as sheds for storing grain. To prevent rats from getting into the latter they are ruised six feet or more off the ground, and branches of fir, stalk-ends uppermost, are tied to the posts, because rats cannot run up them. Flat circular boards are also used for the purpose of preventing rats from running up a post, the post passing through a hole in the centre. Engineering Works.-There are no engineering works on a large scale. Fishing dams are constructed to isolate reaches of streams in order to catch or poison the fish, or to divert the stream. 13 dainks about 2 miles.
Page #235
--------------------------------------------------------------------------
________________ JULY, 1892.) MISCELLANEA. 221 Bridges across streams are also made on the eantilever principle. These are wonderful constructions of bamboo and very clever. Other simple bridges are also made, including swing. bridges. Aqueducts for bringing water into the villages are also ingeniously designed. They are made of bamboos, split so as to form a gutter, along which the water runs. The bamboo gutters are supported, according to the level required, on tripods. A spot higher than the village is chosen as the source of water-supply often nearly half-amile distant. The Chinbons, who have paddyfields, irrigate them in the same way as the Burmans. The roads are mere tracks and are not in any way constructed. Household Furniture, Dishes, &0.-The only articles of furniture to be found in a Chin house are the fireplace and cooking pote, similar to those used by Barmans. Water is kept in ghards, bain boos, or gourds. They eat with their fingers off bits of matting, which take the place of plates. Each house has a rough loom, spindle, &o., for spinning. In Chinbon houses the grain-pounders protrude through the floor. In all houses are found a few baskets containing grain for present use and some liquor jars. Trophies and Decorations. In the verandah of each Obinbok or Yindu house are the heads of every animal shot, captured, or killed by the houseowner. The Chinboks also carve boards, or rather posts, about eight feet high, which they erect outside their houses. These iudieate the number of hend of game which the owner has killed. No man is thought much of unless he has a good show of heads and posts. The heads include tiger, bear, sdnbhar, sain, and various kinds of deer, monkeys, and domestic animals. Chinbons shoot but little. Raids.---'The objects of raids are to obtain possession of slaves, eattle, money, and property of all kinds; and are never undertaken with the sole objeet of human) head-hunting. They are not only directed against British-Burman subjeets, but also against those dwelling across the Yomas, and even against another Chin tribe. The eaptives taken in raids into Burma are usually held to ransom. The actual process of raiding is accompanied with much bloodshed and cruelty, but the prisoners are well treated if once they reach the village of their eaptors. Women are not outraged. As captives, women, children, and pungyis, (priests), are preferred: the two former as there is less chance of their effecting their escape than men; the latter because they can obtain such enormous ransoms for their release. Captives are at first placed in stocks, but are afterwards allowed out with a log attached to their legs, and a string to carry it by. To secure the leg to the log a hole is cut through the centre of the log. Through this hole the foot and ankle are inserted, and also a wooden pin so as to make the hole too small to allow of the foot being withdrawn. A string is attached to either end of the log, which the pri. soner holds in his hand when walking, thus taking the weight off the ankle. If it is thought that prisoner is not likely to attempt to escape, the log is removed. Prisoners are obliged to work in the fields, fetch water, husk grain, &c. Captives, if not quickly redeemed by their own people, are sold from village to village, which renders it very difficult to trace and recover them. They fetch from Rs. 80 to Rs. 300, sometines paid in eash, bat generally in cattle. Cattle are much prized, and are driven off from the plains, whenever opportunity offers. Iron is greatly valued for spear and arrow heads, &c. When raiding in Burma the Ching frequently tear off the t'is (summit ornaments) from pagodas for the sake of the iron they contain. Certain villages are notorious raiders, cultivating but little and living by raiding. They are a terror to the weaker and more industrious Chin villagers, whom they greatly oppress, and who are consequently frequently driven to raid on Burmaa villages to recoup themselves for the heavy losses they sustain at the hands of their more powerful neighbours. This system of terrorism keeps the Chins the savages we find them. They have no incentive to become prosperous, as they are liable to lose their all, including wives and children, at any moment. They can ransom their relations, if well enough off, but the price demanded is beyond the means of most Chins. Raids are organized as follows. The leading man or chief, who wishes to get up a raid, gets men together from his own and other villages. He gives a feast and arranges for rations on the road. All these expenses he defrays, but gets the lion's share of the captives and loot. Quarrels frequently occur, attended with bloodshed, over division of the spoil. The nats are always consulted and, if the omens are unfavourable, the raid is postponed and often abandoned altogether.
Page #236
--------------------------------------------------------------------------
________________ 222 THE INDIAN ANTIQUARY. (JULY, 1892. Moonlight nights are usually chosen for raids domestic animals they keep, and the game and and a "surprise" is always attempted. While fish they shoot and catch. Grain and vegetables retreating they generally spike the path behind are boiled, except chaiksin, which is generally them with bamboos and, if pressed, they often kill roasted, as is also the flesh of animals. They cook their captives. On this account the Burmans like the Burmans, but do not use oil. frequently hesitate to follow them ap. Except the beer they brew, water is their only Warfare.The Chin system of warfare is beverage. The women draw water in ghards, almost identical with the system of raiding. gourds or bamboos. When attacking an enemy's village, or a force Drunkenness.-The most remarkable custom encamped, they always attempt a surprise, and of these people is their habit of getting drunk unless they consider themselves very strong, they on every possible occasion. Every and any in. content themselves with harassing a column on cident is an excuse to bring out the beer jars (see the line of march by creeping up and discharg. Plate C)-the arrival of a stranger or visitor, the ing arrows, generally at tbe reur-guard. They birth of a child, a marriage, a death, a case of will also roll down boulders and rocks, if appor- sickness, an offering to or consultation of nats, tunity offers, upon an advancing force, and will are all sufficient excuses for every one present, attempt to burn the jungle through which a men, women, and even tiny children, to get column is passing. They only attempt a front drunk. They frequently keep up these debauches attack when confident of success, and then for days. The liquor is made of grain, boiled and advance yelling and shouting. On the defensive fermented, and varies much in quality, depending they roll down rocks, spike roads, and discharge on the grain used (rice is the best) and the length arrows from behind cover. They do not dig pits. of time the liquor has been kept. Good Chin Chinbok villages are not fenced in any way. beer is a very palatable drink, much resembling Yindu villages have a thorn or bamboo fence cider in taste, but more like perry in appearance. which presents no serious obstacle. The liquor is stored in jars, standing over two feet in height and filled half full with the ferment. Chinbone stockade with what is known as " Chin ing grain. As the liquor is drawn off the jar is stookade-work" and form most.forunidable abettis filled up with water. by felling the bamboo jungle in which their The liquor is drunk as follows:-A villages are generally built, sharpening the ends of hollow the bamboos, and planting innumerable spikes. bamboo, the thickness of a little finger, is thrust There is only one gate to a Chinbon village and into the jar, and pressed well down into the it is a very narrow one, approached by a path grain. The company sit round this and take which admits of men advancing in single file only. 1 sucks in turn. A few of the villages are not stockaded, but built A more civilized way of drawing off the liquor on high poles. is sometimes followed. A hole is made in the Chin villages are generally built in dense jungle side of the bamboo above mentioned, the hollow hollows on the sides of the hills. They can top being stopped up; into this hole another always be taken in rear and commanded, and bamboo is inserted sloping downwards over the side of the jar (see Plate C). The host gives a should never be attacked from below. Approaches will always be found to be spiked, and rocks will Buck to start the liquor running: gourds are then filled and handed round. be rolled on the advancing column. Tattooing.--All women have their faces Smoking and Washing.-Men, women, and tattooed (see Plate A). The process is comeven small children are never without their pipes menced' when they are small children and and tobacco, and smoke constantly. A descrip gradually completed, the operatione extending tion has already been given of the different kinds over bereral years. of pipes they smoke. The tobacco used is grown by themselves and sun-dried. It is very rank. The Chinboks cover the face with nicks, lines, and dots in a uniform design, the women's breasts Chins, especially the Northern Chinboks, have being also surrounded with a circle of dots. The the greatest dislike to water. They never wash Yindus tattoo in lines across the face, showing their bodies, and very seldom touch their faces glimpses of the skin. The Chinbuns tattoo jet and hands, with water. Their clothes are never black and are the most repulsive in appearance, washed. though often fair-skinned. The beauty of a Food and Drink.-The food of the Chine con. woman is judged by the style in which the tattoo sists of the grain and vegetables they grow, the ing has been done. Men are not tattooed at all.
Page #237
--------------------------------------------------------------------------
________________ JULY, 1892.) MISCELLANEA. 228 Proper Names.-Most Chin villages have Burmese names. Many have two names, one a Chin and the other a Burman name, which causes great confusion. Among themselves they usually talk of a village as So-and-so's village, naming the Djut (headman). Thus, a village of which the headman's name was Nga Tin would be called Nga Tinywe (Nga Tin's Village). The names of men resemble Burman names, but they invariably prefix Nga instead of Maung. The women's names are curious; they prefix Mi and Ba. The following are examples of names :Men Women. Nga Kwar. Mi Ba Do. Nga Shain. Mi Ba Laung. Nga Cha. Mi Ba Sok. Nga Tin. Sanitation.-The villages are kept cleaner than Burman villages, otherwise their sanitary arrangements are similar. Carrying Loads.-Everything is carried slung across the forehead by a strap, usually in cane baskets about the size of a Burmese paek-bullock's basket. Sometimes there is a second strap, which pasbes across the chest. Even water is carried in this manner, gourds being filled and placed in the basket, or, if gharas are used, the ghara is placed in the basket. A Chin makes nothing of a sixty-pound bag of dra (flour) going over the worst possible tracks. Music and Dancing.-Musical instruments consist of gongs, cymbals, drums, and bells. There is also & curious kind of banjo made out ne piece of bamboo & little thicker than & man's wrist and about eighteen inches long. The bamboo used is hollow and cut off at both ends just beyond the joint. Narrow strips of the bamboo are then slit and raised on small pegs without severing the ends; four or five strings are thus formed, which are manipulated with the fingers. The music produced is rather pleasant. There is no tune, but time is kept on the drums. Dancing, in which both men and women take part, is generally commenced when they are all primed with liquor. The men brandish spears and dds and shout, or rather yell. By firelight the sight is a curious and pretty one. Oaths.-Oaths are of several kinds and are supposed to be binding. The one most feared is drinking water that has been poured over the skull of a tiger. Another oath is partly Burmese, [P ChineseED.) in origin. The terms of the oath are written on paper and burnt, while the swearing parties place the butts of their arms, spears, dds, guns, bows, arrows, &c., in a basin of water. The ashes of the paper are then mixed with the water and drunk by the parties concerned. Another oath is drinking blood. In all oaths much liquor is drunk. It is doubtful whether oaths are of any value. Births, Marriages, Deaths.-All these are great oceasions and necessitate sacrifices to the nats, feasting, and much drinking, accompanied by music and dancing. When a child is born the nats are consulted to ascertain if it will live or die. Marriage among the Chinboks is a lore affair, and takes place at about twenty years of age. The young man proposes and, if accepted, the consent of the girl's parents is asked. They, it they approve of the suitor, consult the nate to see if the marriage will be a lucky one. If the omens are favourable, one maiban at least must be given to the bride's parents. If the bridegroom has not got the value of a maiban, he promises to pay by instalments and takes possession of the bride at once. If the girl has many necklaces, several maiban must be given. A big drink and feast follows, and sacrifices to the nats. If, however, the omens prove unfavourable and the young couple are nevertheless anxious to be married, the nats are periodically consulted until they are favourable. This always must happen in time, if the nats are only consulted frequently The Yindu marriage customs are different. Among them the love is one-sided. The would be bridegroom selects the lady of his fancy and goes to her father's house with ten pairs of earrings, or their value, and demands the girl, giving the father the earrings. The girl is immediately handed over to him, whether willing or not, and whether the parents approve of the match or not. The usual drinks and ceremonies follow. 4This oonfusion is universal in the East, e.g., an average Pathan village has six names; an average Sikkim village has five; & Kasmir village has four, and may. have nine ; in the Amherst Distriot a village or place will have ordinarily a Burmese, Talning, ShAn and Tsung 80 name, to which may be superadded - Pali name also. See my papers on the Tal-Chotiali Route, J. R. G. 3., Vol. L., and J. 4. 8. B., Part II. for 1882, and my Edition of Sir E. Temple's Journals kept in Hyderabad, Kashmir, Sikkim, and Nepal, 1887, preface, pp. xviiixxi-ED.] (Bee anto, Vol. XX. p. 4234: ED]
Page #238
--------------------------------------------------------------------------
________________ 224 THE INDIAN ANTIQUABY. [JULY, 1892. There are no divorces. If a man's wife is carried off by another man, as frequently happens, the husband kills his rival, if he can, and takes back his wife. There is no restriction as to the number of wives allotted to one man. If a man dies, his brother must take his wife and children. In this way one man may accumulate many families. On a death occurring all the friends assemble and drink. A maiban, or other suitable sacrifice, is slain. The number of days the body is kept, and consequently the duration of the festivities, depends on the age and importance of the deceased. The body is eventually carried far into the jungle to a burial-ground on the ridge of a hill, where it is burnt. The charred bones are collected and, together with the clothes of the deceased, are placed in an earthen pot. The pot is, amongst the Chinboks and Yindus, then placed on the ground under a slab of stone supported on four upright stones. In the Chinbok and Yindu country there are large cemeteries of these stones, some of which are of enormous size and must have taken great labour to bring from the places where they abound to the burial-ground. The Chinbong do not use stones, but erect miniature houses, which are models of the style of architecture of the particular village to which the deceased belonged, being either raised on poles or not, as the case may be. In these houses, which form miniature villages, the pots are placed. Those Chinbons who have emigrated to and died in Burma, are cremated where they die, but their bones are carefully collected and sent in a pot to be placed in the cemetery of the village, to which they or their forefathers originally belonged. NOTES AND QUERIES. SOCIAL CUSTOMS IN SOUTHERN INDIA. about half a dozen peacock feathers. As snakes When a young Brahman visits or takes leave have a very acute sense of smell, and as the of an elderly man of his caste and sect, either smell of these two things is very repugnant to in consequence of age or learning, the custom them, they will always keep away. The above is is for the younger to prostrate himself before said to be very effective in the case of cobras. the elder and to receive his blessing. Snake charmers in Southern India havo often In poor Brahmap houses, a widow is the chief been seen to catch cobras with their right hand, cook and she performs almost all the menial work while keeping a small stick in their left hand. This stick is always besmeared with onion in the house. She gets up early in the morning and shuns the presence of everybody else in the juice. house, as it is superstitiously believed that if any. A pinch of tobacco snuff thrown over the head body sees a widow's face on rising from his bed of a cobra acts as chloroform and the cobra he will have bad luck during the day. Even her benumbed as it were. own children, if she has any, are averse to seeing It is considered a great sin to kill a cobra. her face in the morning, and she herself, knowing When a cobra is killed the people generally burn the evil that would arise, will not approach them. it as they do human bodies. A man who has killed When a person starts on a journey or on any a cobra considers himself as polluted for three special errand, if a widow comes before him, it is days or at least for ninety hours, and in the an evil omen. On entering upon her widowhood, second day milk is poured on the remains of the a woman takes off the hair on her head, and a cobra. On the third day he is free from pollution. portion of her waist cloth is put round her head. She usually tuns very religious, takes only one SUPERSTITIONS ABOUT ANIMALS IN meal a day, and sets aside all worldly pleasures. SOUTHERN INDIA. She is also prohibited from singing on marriage The Indian screech owl or desth-bird is occasions. held in great fear by the Hindus of Southern K. SRIKANTALIYAR. India. If this bird happens to sit on the roof of a house and screech thrice, it is said that the SCPERSTITIONS AS TO SNAKES IN MADRAS, chief member of the house will die within one week Take half a measure full of native onions and from that date. make about three or four dozen small bags, put If bees build a nest in any part of a house, it is half a dozen onions into each and then tie np the said that the chief member of the house will die bags at some small distance from each other to within one month from that date. the rafters under the tiles, or tie up to the rafters K, SRIKANTALIYAR.
Page #239
--------------------------------------------------------------------------
________________ BYBTEX OF TRANSLITERATION The system of transliteration followed in this Journal for Sanskrit and Kanarese, (and, for the sake of uniformity, anbmitted for adoption, as far as possible, in the case of other languages),- except in respect of modern Hindu personal names, in which absolute purism is undesirable, and in respect of a few Anglicised corruptions of names of places, sanctioned by long usage, - 18 this: Banskrit. Kanarese. Transliteration. Sanskrit. Kanarese. Transliteration, bha ja jha $3 $ tha 431 # al mig dha tha da 123 23 63 83 dla .28a & UAE U 21 adalad & 3 na $ Visarga pa pla ba bha ma Visarga Jihvdmalfya, or old Visarga before a and a Upadhmantya, or old Visarga be. fore and Anystdra Anundsikt Anusvdra Iba K glia in 218 cha chla ha A single hyphen is used to separate words in composition, as far as it is desirable to divide them. It will readily be seen where the single byphen is only used in the ordinary wey, at the end of a line, as divided in the original Text, to indicate that the word runs on into the next line: intermediate divisions, rendered unavoidable here and there by printing neceesilies, are made only where absolutely necessary for neatness in the arrangement of the Texts. A double hyphen is used to separate words in a sentence, which in the original are written as one word, being joined together by the euphonic rules of sandhi. Where this double hypben is used, it is to be understood that a final consonant, and the following initial vowel or consonant-and-vowel, are in the original expressed by one complex sign. Where it is not used, it is to be understood of the orthography of the original, that, according to the stage of the alphabet, the final consonant either has the modified broken form, which, in the oldest stages of the alphabet, was used to indicate a consonant with no vowel attached to it, or has the distinct sign of the virama attached to it; and bat the following initial vowel or consonant has its full initial form. In the transcription of ordini texte, the double hyphen is probably unnecessary; except where there is the sandhi of final and initial vowels. But, in the transcription of epigraphical records, the use of this sign is unavoidable, for the purpose of indicating exactly the palaeographical standard of the original texts. The avagraha, or sign which indicates the elision of an initial a, is but rarely to be met with in inscriptions. Where it does occur, it is most conveniently represented by its own Devanagari sign. So also practice has shewn that it is more convenient to use the ordinary Devanagari marks of punctuation than to substitute the English signs for them. Ordinary brackets are used for corrections and doubtful points; and square brackets, for letters which are much damaged and nearly illegible in the original, or which, being wholly illegible, can be supplied with certainty. An asterisk attached to letters or marks of punctuation in square brackets, indicates that those letters or marks of punctuation were omitted altogether in the original. As a rule, it is more convenient to use the brackets than to have recourse to footnotes; as the points to which attention is to be drawn attract notice far more readily. But notes are given instead, when there would be so many brackets, close together, as to encumber the text and render it inconvenient to wad. When any letters in the original are wholly illegible and cannot be supplied, they are represented, in metrical passages, by the sign for a long or a short syllable, as the case may be ; and in prose passages, by points, at the rate, usually, of two for each akshara or syllable.
Page #240
--------------------------------------------------------------------------
Page #241
--------------------------------------------------------------------------
________________ Acoust, 1892.] BHARAUT INSCRIPTIONS. 225 BHARAUT INSCRIPTIONS. BY E. HULTZSCH, Ph.D.; BANGALORE. THE remains of the Buddhist Stupa of Bharaut were discovered in 1873 by General 1 Sir A. Cunningham, who very judiciously saved most of them from destruction by removal to the Indian Museum, Calcutta. His richly illustrated monograph The Shipa of Bharhut (London, 1879) contains eye-copies and tentative transcripts and translations of the Bharaut inscriptions, both of those which are now at Calcutta, and of those which remain in situ. Part of the Calcutta inscriptions have been minutely treated by Dr. Hoernle. With the kind permission of Dr. Anderson, Superintendent of the Indian Museum, I prepared mechanical copies of all those at Calcutta in 1885 and published them with German translations. The importance which the Bharaut inscriptions undoubtedly possess on account of their antiquity, now induees me to republish my German paper, with some additions and corrections, in English, and thus to make it more generally accessible. The age of the Bharaut inscriptions is approximately fixed by the inscription No. 1, which records that the East gateway of the Stupa was built "during the reign of the Sungas," ise., in the second or first century B. C., by Vatsiputra Dhanabhati. From the manner in which he refers to the Suigas, it may be concluded that this king was one of their tributaries. One of those inscriptions which have not been removed to Calcattat contains the name " of princo Vadhapala (i. e., Vyadhapala ?) the son of king Dlanabhati." At the beginning of another fragment, one is tempted to conjecture tisa instead of kasa, the reading of General Cunningham's eve-copy, 5 and to translate : -"The gift of Nagarakhita (i. e., Nagarakshita) the wifo of king Dhanabhu]ti." A gift by some later Dhanabhuti is recorded in a Mathura inscription, which has been removed to Aligadh. With the exception of No. 1, the Bharaut inscriptions do not contain any historical information. They are simply labels which record the names of the donors of the pillars (stamoha) or rails (suchi) on which they are engraved, or explain the subjects which some of the reliefs represent. The following towns from which some of the donors hailed, are incidentally mentioned :- Bhogavardhana, Bhojaknta, Bi[m]bik[A]na[n]dikata, Kakandi, Karahakata. Kubjatinduka (?), Mayuragiri, N[an]d[i]nagara, Patalipatra, Parika, Sirishapadra, Sthavirakuta and Vaidisa. The epithets Chikulaniya or Chekulana, Chudathilika and Dabhinika appear to be likewise derived from names of localities, the Sansksit originals of which are, however, doubtful. In General Canningham's eye-copies of those inscriptions which were not removed to Calcutta, occur : - Karahakata (Plate lv. No. 96), Moragiri (No. 95), Nasika (No. 87) and Vedisa (No. 100, and Plate lvi. No. 1); also Bhojakataka, 'a resident of Bhojakata' (Plate lvi. No. 46), Kosabeyeka, 'a female resident of Kausambi' (Plate liv. No. 53), and Selapuraka, 'a resident of Sailapura' (Plate lv. No. 91). Among these geographical names, Kaunambi, Nasika, Pataliputra and Vaidika are the modern Kosam, Nasik, Patna and Besnagar. Of the Buddhist scenes which are represented in the sculptures and referred to in the inscriptions, part are still obscure, and part have been successfully identified by General Cunningham. The most interesting among these representations are the Jatakas, or supposed previous births of the founder of the Buddhist creod. As will be seen from the subjoined table, & considerable namber of them have been traced by the Rev. Subhuti, Professor Rhys Davids, and myself, in the Pali collection of Jatakas, for the publication of which we are indebted to the scholarship of Professor Fausboll. 1 As stated by Dr. Fleet, ante, Vol. XIV. p. 188, note 1, this appears to be the correct spelling of the name. General Cunningham uses the form Bharhut. 1 ante, Vol. X. pp. 118 ff. and 255 ff. Vol. XI. pp. 25 ff. : Zeitschrift der Deutschen Morg. Ges. Vol. XL. pp. 58 #f. Stupa of Bharhut, Plate lvi. No. 54. Ibid. No. 67. * Ibid. Plato liii. No, 4, and Arch. Survey of India, Vol. III, Plate xvi. No. 21.
Page #242
--------------------------------------------------------------------------
________________ 226 THE INDIAN ANTIQUARY. [August, 1892. Below, No. 3. Maghadeviya jataka. Fausboll's No. 9. Makhadeva-jataka. - 6. Sujato gahuto jataka. >> >> 352. Sujata-jataka. Bidala-jata[k]a, (alias) >> >> 7. - 383. Kukkata-ja-aka. " Kukuta-jataka. 10. Isi-migo jataka. .. . .. . . . .. . .. . . . 12. Kinara-jatakam. Vol. IV. pp. 252 to 254. 14. Uda-jataka. No. 400. Dabbhapuppha-jataka. 13. Secbha-jataka. >> 174. Dubhiyamakkata-jataka. 17. Bhisaharaniya jatakan). 488. Bhisa-jutaka. 32. Naga-jataka. >> 267. Kakkata-jataba. 37. Miga-jatakam. 482. Raru-jataka(?). 72. Yavamajhakiyan jatakan, 85. Chhadartiya jatakam. >> >> 514. Chhaddanta-jatake. 86. Vitura-Punakiya jatakan. . . . . . . . .. . . . . . . .. 109. LaluvA-jataka. , 357. Latakika-jataka. , 155. M[u]ga(pa]k[i]y[e]j[A]ta[ka]. ................... ,, 156. Isis[imgiya ja]taska). 528. Alambusa-jataka. ,,157. Yam bram[h]ano avayesi jatakan. >> 62. Andabhata-jataka. ,, 158. Hamsa-jataka. , 32. Nachcha-jataka. Cunningham's Plate xxvii. No. 9. 206. Kurangamiga-jataka. >> >> >> 13. , 181. Asadisa-jataka. >> >> >> 14. ,, 461. Dasaratha-jataka. , xxxiii. , 4. , 407. Mahakapi-jataka. ,, xliii. , 8. >> 12. Nigrodhe miga-jataka. xly., 5. > Nog. 46 and 268. Aramadusaka-jataka. It appears from the above table that the titles of the single Jatakas in the Bharaut inscrip. tions generally differ more or less from those which are adopted in the standard redaction of the Jataka book. A very curious proof for the antiquity of the verses which are handed down to us in the Jataka book, is afforded by the inscription No. 157, which quotes the first pada of one of these verseg.7 As discovered by the late Professor Childers (Pali Dictionary, p. ix, note 3), an alinost literal quotation from the Life of Buddha, which is prefixed to the Jataka book (Vol. I. p. 92), occurs in the inscription No. 38. The announcement of the future conception of Buddha (No. 80), his descent to earth (No. 98), and the festival in honour of his hair-lock (No. 78), are referred to in the seme introduction to the Jataka, Vol. I. pp. 48, 50, and 65. The assembly (of ascetics) with matted hair' (jatila, No. 13) is probably intended for UruvolaKassapa and his followers (Vol. I. p. 82 f.). The Indrasala cave (No. 99) corresponds to the Indrasaila cave of the Northern Buddhists, who also mention the visits of king Prasenajit of Kosala and of the serpent king Airavate to Buddha (Nos. 58 and 60). The visit of Ajatasatru (No. 77) is described in the records of both Northern and Southern Buddhists. In the inscriptions, Buddha is generally designated Bhagavat, the Blessed one,' and once (No. 46) Sakyamuni, Of the former Buddhas the following are named: - Vipasyin, Visvablu, Kakutsamdha, Konagamana, Kasyapa. The inscriptions also mention Sudharmi, the hall of the gode,' Vaijayanta, the palace (of Indra),' the two classes of deities called Kamavachara and Suddhivasa, and give the names of four celestial nymphs (apsaras), three goddesses (devata), one angel (devaputra), one vidyddhara, six male and two female yakshas, 7 The chief story of the fifth book of tho Pafchatantra is closely related to the Chatudvdrajataka (Fausboll's No. 489). At the beginning of the Panchatantra story oocure the following verse (No. 22 of the Bombay edition): - ati lobhI na kartavyo lobhameva parityajet / atilobhAbhibhUtasya cakra dhamati mastake // The fourth pada of this verso la idention with that of the 5th verse of the Chatudvdrajataka, the second half of which reads : ichchhahatassa pasassa chakhash bhamati matthake.
Page #243
--------------------------------------------------------------------------
________________ AUGUST, 1892.] BHARAUT INSCRIPTIONS. 227 and two serpent kings (nagardja). Baddhistical terms are: - chaitya, bodhi or bodha, bidhichakora and dharmachakra. The mention of donors who were versed in the Pitakas, (No. 134), in the Satranta (No. 95) and in the five Nikdyas (No. 144) proves that the Buddhist canon and its subdivisions were known and studied in the second or first century B. C. Among the donors are one householder (grihapati), one trooper (asvavariku), one sculptor (rupakdraka), four preachers (bhdnaka) and twelve nuns (bhikshumi). Others are characterised as members of the priesthood by the epithet reverend' (Arya or bhadanta). TEXTS AND TRANSLATIONS. No. 1 (Cunningham's Plate liii. No. 1). 1 Suganam raje rano Gagi-putasa Visadevasa 2 pautena Goti-putasa Agarajusa putena 3 Vachhi-putena Dhanabhatina karitam torann 4 sile-kammato cha upamna.10 Daring the reign of the Sungas, - Vatsi-putra Dhanabhati, the son of Gaupti-putra AngAradyutil (and) grandson of king Gargi-putra Vibvadeva, caused (this) gateway to be nade, and the stone-work1 arose. No. 2 (liii, 1.b). Aya-Nagadevasa danam. The gift of the reverend Nagadava. No. 8 (liii. 2 b; Hoernle's No. 5). Maghadeviya jataka. The jataka (which treats) of Makhadova. No. 4 (liii. 3 b; Hoornle's No. 6). Dighatapasi sise anusasati. Dirghatapasvin instructs (his) pupils. No. 5 (liii. 4 b.; Hoernle's No. 7). Abode chatiyam.13 The chaitya on (Mount) Arbuda. No. 6 (liii. 5). Sujato gahuto jataka. The ja taka (entitled) "Sujata caught. "14 No. 7 (liii. 6). Bidala-jatara 15 kukuta-jataka. The cat jataka, (also called) the cock jataka. No. 8 (liii. 7). Dadanikamo chakama. The enclosure (called) Dandanish krama (?). . The text of Nos. 1 to 154 is transcribed from impressions which I prepared at Caloutts in 1885. A facsimile of No. 1 is found ante, Vol. XIV. p. 189, and facsimiles of Nos. 3 to 15, 17 to 51, 55 to 151, and 159 in the Zeitschrift der Deutschen Morg. Ges. Vol. XL. pp. 60 and 70.. * Read toranan (I instead of D. 10 Read upanno (1 instead of I). 11 As suggested by Dr. Buhler, this name has to be explained by Angara[ka] ia dyotata ity Angaradyut, shining like the planet) Mars. The ouatom, in accordance with which each of the three kinga bears & secondary name derived from the gotra of his mother, has descended through the Andhras to the Kadambas and Chalukyas ; se Dr. Fleet's Kanarese Dynasties, p. 5, note 2. 11 See Childers' Pau Dictionary, s. v. lammanto. 18 Possibly & clerical mistake for chetiyan. # Gahuto (Sanskrit grihttan) appears to mean either surprised' or 'anderstood' (by his father); see the Sujdtajataka, Fausboll's No. 852. 10 This is a clerical mistake for jataka (i.. jdtakar).
Page #244
--------------------------------------------------------------------------
________________ 228 THE INDIAN ANTIQUARY. [AUGUST, 1892. No. 9 (liii. 8). A sada vadhu susane sigalato fati.17 The woman Ashadha, who has observed the jackals on the cemetery. No. 10 (lii. 9). Isi-migo jataka. The jataka (entitled "the antelope of the saint." No. 11 (liii. 10; Hoernle's No. 1). Niga-samadaka [m] chetaya.18 The chaitya which gladdens the antelopes. No. 12 (liii. 12). Kinara-jatakam. The Kinnara jataka. No. 13 (liii. 13). Jatila-sabha. The assembly (of ascetics) with matted hair. No. 14 (liii. 14). Uda-jataka. The jataka (which treats) of the two) otters. No. 15 (liii. 15; Hoernle's No. 4). Sechha-jataka. The saikshal9 jataka. No. 16 (liii. 16). 1 Karahakata-nigamasa 2 dana. The gift of the city of Karahakata.20 No. 17 (liii. 17). Bhisaharaniya jataka[m). The jataka (which treats) of the stealing of the lotus-fibres. No. 18 (liii. 18; Hoernle's No. 8). Veduko katha dohati Nadode pavate. Venuka 21 milks22 katha23 on Mount Nadoda. No. 19 (liii. 19; Hoernle's No. 9). Jabu Nadode pavate. The jambu (tree) on Mount Nadoda. No. 20 (liii. 20; Hoernle's No. 2). U..... Janako raja Sivala devi. ..... King Janaka. Queen Sival4.24 16 Read sigole (acc. plur.) ? 17 nati probably represents the Sanskrit jnatri, as keta in No. 88 stands for kreta. 18 It remains doubtful whether the vowel a in the second syllable of this word is due to a clerical omission of the sign for i, or if it is the expression of an indistinct pronunciation of the vowel i. Compare Sabhada for Subhadrdan Ajatasata for Ajatasatru in Nos. 52 and 77. 19 See Childers' Pili Dictionary, s.v. sekho. 20 Karahikadaka, a resident of KarahAkada,' decurs in the Kuda inscription No. 18, Arch. Survey of W. India, Vol. IV. p. 87. Karahakata or Karahakada is probably identical with Karahataka, which is referred to in a Rashtrakuta inscription of Saka 675 (ante, Vol. XI. p. 110), and with the modern Karhad in the Sattard district. 21 According to No. 63, this person was a gardener. Veluka, 'little reed,' occurs in the Jataka No. 43 as the name of a snake. 22 See the corresponding relief, Stipa of Bharhut, Plate xlviii. No. 9. 23 This word may be meant for katha (PAli kattha, Sanskrit kushtha), or, according to Dr. Buhler, for kvatha or kratha, 'a decoction.' 2. Similar formations are Ahila and Vasula in the Kuda inscriptions, and Himala, Isila and Sivald in the Amaravati inscriptions.
Page #245
--------------------------------------------------------------------------
________________ AUGUST, 1892.] BHARAUT INSCRIPTIONS. 229 No. 21 (liii. 21 ; Hoernle's No. 3). Chitupida-sila. The Chitrotpata rock.25 No. 22 (liii. 1 c). Vedisa Chapadeviya Revatimita-bhariyaya pathama thabho dinan. The first pillar (is) the gift of Chapadeve, the wife of Revatimitra, from Vaidiba. No. 23 (liii. 2 c). Bhadamtasa 20 aya-Bhutarakhitasa Khujatidukiyasa danam. The gift of the lord, the reverend Bhatarakshita, from Kubjatinduka(?). No. 24 (liii. 3 c). Bhagavato Vesabhuno bodhi salo. The sula (which coas) the bolhi (tree) of the blessed Visvabha. No. 25 (liii. 4 c). Aya-Gorakhitasa thabho danan. A pillar, the gift of the reverend Gorakshita. No. 26 (liii. 5 b, 6 b). Aya-Pathakasa thambho da nam Chula koka devata. A pillar, (representing the goddess Kshudrakoka, 27 the gift of the reverend Panthaka. No. 27 (liii. 7 b). 1 Dabhinikaya Mahamukhisa dhitu Badhika2 ya bhichhuniya danam. The gift of the nun Badhika, the daughter of Mahamukhi, from Dabhina(?). No. 28 (liii. 8 b). 2 Pataliputi Nagasenya Kodi1 yaniya dinam. The gift of Nagasena, a Kodyani,29 from Pataliputra. No. 29 (liii. 9 b). 1 Samanaya bhikhaniya Chudathilikaya 2 danam. The gift of the nun Sraman430 from Chudathila. No. 30 (liii. 11 b). Bhagavato Konigamenas 31 bodhi. The boni (tree) of the blessed Konagamana. No. 31 (liii. 12 b). Bhojakatakiya Diganagay[e] bhichhuniya danno. The gift of the nun Dinnaga from Bhojakata.32 * Chitri utpat yatra 81 sila,' the rock whero miraculous portents happen.' The Pali uppada represents both utpada and utpata; compare Anddhao for Anotha in No. 88. 26 tasa looks like tdso, and the ta of Bhuta liko ta. 27 i. e..the little Koka. Her counterpart, the big Koka,' is mentioned on Plate lv. of the Stapa of Bharhnt, No. 98, which reads :- Mahakoka devata. 38 Perhaps Bodhika has to be restored. The name Bodhi occurs in three Kuda inscriptions. 29 Kodiyani, which is found again in No. 100, might be the feminine of Kodiya (No. 63), compare arya-aryliti, and kshatriya-kshatriyin. On the Kidyas, & tribe residing near and related to the SAkyss, see Dr. Kern's Buddhismus, translated by Jacobi, Vol. I. pp. 174 and 295. Besides, Kodiyani might correspond to the patronymic Kaundiny Ayant; compare Kachchana = KAty Ayana, and Moggallina = Maudgalyayana. 30 It follows from Nos. 103 and 104, that Sramani is heis used as a proper name. 31 In the fourth syllable of Konigamenasa we appear to have a case of short (Prikrit) e for Sanskrit a. Short for i occurs in Petakin (No. 134) for Pitakin, and Seri (No. 149) for Sirt (81); short o for u in Aboda (No. 5) for Arbuda; long & for 4 in the termination yt (No. 65, 106, 120, 121, 116, 148 and 150) for yar; and long for din tim (No. 130) for ding. The first syllable of bodhi is injured and looks like be. 32 According to a grant of the VAkataka king Pravarasena II. the village of Charmaoka,--the modern Chammak the Ilichpur district,-belonged to the Bhojakata-rajya ; see Dr. Floet's Gupta Inscriptions, p. 236.
Page #246
--------------------------------------------------------------------------
________________ 230 THE INDIAN ANTIQUARY. (AUGUST, 1892. No. 32 (liii. 13 b). Naga-jataka. The elephant jataka. No. 33 (liii. 14 b). 1 Bib[i]k[A]nadikata Budhino gahapatino 2 danam. The gift of the householder Buddhi (from) Bimbikanandikata (?). No. 34 (liii. 15 b). Supavaso Yakho. The Yaksha Supravrisha (?). No. 35 (liii. 16 b) Dhamagutasa dana thabho. A pillar, the gift of Dharmagupta. No. 36 (liii. 17 b). 1 Bibikanadikata Suladhasa asavarika2 5233 danan. The gift of the trooper Sulabdha (from) Bimbikanandikata. No. 37 (liii. 18 b, 19 b). 1 Pusasa thambho danam 2 miga-jatakam. A pillar, (representing) the antelope jdtaka, the gift of Pushya. No. 38 (liii. 20 b). Jetavana Anadhapediko deti koti-samthatena keta. Anathapincika gives Jotavana, (which) he has bought by a layer of crores (of gold pieces). No. 39 (liji, 21 b). Kosa[m]ba-kati. The hall at Kaubambi. No. 40 (liii. 22 b). Ga[n]dhakuti. The hall of perfumes,34 No. 41 (liii, 23). Dhamarakhitasa dunam. The gift of Dharmarakshits. No. 42 (liji. 24). Chakavako Nagaraja. Chakravaka, the king of serpents. No. 43 (liii. 25). V[i]rudako Yakh[o]. The Yaksha Virudhaka.35 No. 44 (lii. 26) Gamgito Yakho. The Yaksha Gangita. No. 45 (liv. 27; Hoernle's No. 17). Aya-Isidinasa bhanakasa danam. The gift of the reverend Rishidatta, a.preacher. 13 Bend "vdrikasa. 4 On gandhakuti see ante, Vol. XIV. p. 140, "and Arch. Survey of W. India, Vol. V. p. 77. * Soe Bohtlingk and Roth's Sanalepit-Worterbuch, s. 7., and Childers' Pak Dictionary, s. v. virilho.
Page #247
--------------------------------------------------------------------------
________________ AUGUST, 1892.) BHARAUT INSCRIPTIONS. 231 No. 46 (liv. 28 ; Hoernle's No. 11). 1 Bhagavato Sakamunino 2 bodho. The b8dha (tree) of the blessed Bakyamuni. No. 47 (liv. 29; Hoernle's No. 12 a). 1 Parathima (didas Sudhd2 vana de[va]t[aj. In the eastern direction, the deities (called) the Buddhdvdsas. No. 48 (liv. 30; Hoernle's No. 12 b). 1 Utaram disa (tini sa). 2 vatani sisafni]. In the northern direction, [three covered) heads (P). No. 49 (liv. 31; Hoernle's No. 13). 1 Dakhinani disa chha KA2 mavachara-sahasani. In the southern direction, six thousand Kanavacharas. No. 80 (liv. 32; Hoernle's No. 14). 1. Sadika-8ammadam 2. turam devanam. The musiost of the gods, which gladden987 by (i. e. which is accompanied with) acting.98 No. 51 (liv. 33; Hoernle's No. 15 a). Misakosi39 Achhara. The Apsaras Misrakebi. No. 52 (liv. 34 ; Hoerple's No. 15 d). Sabhad [A] Achhar[A]. The Apsaras Subhadra. No. 33 (liv. 35; Hoernle's No. 15 c). 1 PadumAvati 2 Achhara. The Apsanas Padmavati. No. 54 (liv. 86; Hoernle's No. 15 b). 1 Alam 2 busa Achhara. The Apsaras Alambusha, No. 55 (liv. 37; Hoernle's No. 18). Ka[m]dariki. Kandariki, No. 66 (liv, 38; Hoernle's No. 21). 1 Vijapi 2 Vijadharo. The Vidyadhara Vijayin.co Ms Outdra for tdrya, see omachandra, ii. 63, and Dr. Pischel's note tbereon. 17 With sahmada compare samadaka in No. 11. * According to Bohtlingk and Roth, 1, v., Bharata explains sdtaka by nataka-beda. >> Read Misakesi. 46 Vijapi might be derived from Vijayin by the double change of y to v and of v to p. Regarding the first obange, see Dr. Kuhn's Pals-Grammatik, p. 42 . and Arch. Survey of w. India, Vol. IV. P. 99, note 1, where BhadAvansya (p. 109, text line 10) might be added. Instances of the second change (Kuhn, 1.c. p. 45) are Erapata for Airavata (Nos. 59 and 60), Kupima for Kuvera (No, 92), bha Ges. Vol. XXXVII. p. 687, No. 88) and pardpata for pardvata (Jataka No. 42).
Page #248
--------------------------------------------------------------------------
________________ 232 THE INDIAN ANTIQUARY. [AUGUST, 1892. No. 57 (liv. 39; Hoernle's No. 10 a). Bhagavato dhamacbakam. The dharmachakra of the Blessed one. No. 58 (liv. 40; Hoernle's No. 10 b). 1 Raja Pasenaji 2 Kosalo. King Prasenajit the Kosala. No. 59 (liv. 41; Hoernle's No. 16 b). Empato [NA]garaja. Airavata," the king of serpents, No. 60 (liv. 42; Hoernle's No. 16 a). 1 Erapato Nagaraja 2 Bbagavato vadate. Airavata, the king of serpents, worships the Blessed one. No. 61 (liv. 43; Hoernle's No. 20). Bahubathiko. (The banyan tree) Bahuhastika.<3 No. 62 (liv. 44; Hoernle's No. 19 a). 1 Bahuhathiko nigodho 2 Nadode. The banyan tree Bahuhastika on (Mount) Nadoda.13 No. 63 (liv. 45; Hoernle's No. 19 b). 1 Susupilo Kodiyo 2 Veduko a3 ramako. Sisupala the Kodya. The gardener Vanuka.15 No. 64 (liv. 48, 49). 1 Chekulana-Saghamitasa thabho danan 2 bhagavato Kasapasa bodhi. A pillar, (representing) the bodhi (tree) of the blessed Kasyapa, the gift of Sathghamitra from Chikulana.16 No. 65 (liv. 50). Nagaye bhichhuniye danam. The gift of the nun Naga. No. 66 (liv. 51). Bhadamta-Valakasa bhanakasa dana thabho. A pillar, the gift of the reverend Valaka, a preacher. No. 67 (liv. 52). 1 Karahakata 2 aya-Bhutakasa thabho danam. A pillar, the gift of the reverend Bhataks (from) Karahakata. 41 The Chulavagga (v. 6) uses the form Brapatha, which has been wrongly sanskritised by Elapatra ; see Dr. Kern's Buddhismus, translated by Jacobi, Vol. II. p. 234, note 8. The usual form Bravana ia derived from the Sanskrit AirAvana, s vicarious form of Airavata. * Bahav hastin) yatra sah, where many elephants are worshipping) ;' see the corresponding relief on Plate xv. of the Stapa of Bharhut. 3 Compare No. 18, 19, and stapa of Bharhut, Plato liv. where two identical inscriptions (Nos. 70 and 79) appear to read :- Nadoda-pade Chenachhako, "at the foot of (Mount) Nadoda ....." ** Probably Kodiyo must be read; see p. 229, note 29, and compare No. 59, where the name of the country or tribe (Kosalo) likewise follows the name of the king (Pasenaji). 45 See No. 18. ** Chekulana is synonymous with Chikulaniya in No. 88.
Page #249
--------------------------------------------------------------------------
________________ AUGUST, 1892.7 BHARAUT INSCRIPTIONS. . 233 No. 68 (liv. 54). Tikotiko chakamo. The enclosure (called) Trikotika.17 No. 69 (liv. 55). Bhadata-Mabilasa thabho danam. A pillar, the gift of the reverend Mahila. No. 70 (liv. 56). Karahakat[a] Samikasa dana thabho. A pillar, the gift of Syamaka from Karahakata. No. 71 (liv. 57). Bhadata-Samakasa thabho danan. A pillar, the gift of the reverend Byamaka. No. 72 (liv. 58). Yavamajhakiyam jatakan. The jataka (which treats) of tho y avamadhyaka. No. 73 (liv. 59). Sirima devata. The goddess Srimati. No. 74 (liv. 60). Suchilomo Yakho. The Yaksha Suchiloma. No. 75 (liv. 61). 1 ..... to bhikhuniya thabho 2 danar. A pillar, the gift of the nun ..... No. 76 (liv. 62; Hoernle's No. 24). Bhadatasa aya-Isipalitasa bhana kasa navakamikasa danam. The gift of the lord, the reverend Rishipalita, a preacher, who superintends the building. operations.co No. 77 (liv. 63; Hoernle's No. 22). Aja tasata Bhagavato vardate. Ajatabatru worships the Blessed one. No. 78 (liv. 64; Hoernle's No. 25 a). 1 Sudhatima devasabha 2 Bhagavato chudamaho. Sudharma, the hall of the gods. The festivalin honour) of the hair-lock of the Blessed one. No. 79 (liv. 65; Hoornle's No. 25 b). 1 Vejayarato pa 2 side.50 Vaijayanta, the palace (of Indra). No. 80 (liv. 66; Hoernle's No. 23). Mahasamayikaya Arabaguto devaputo vokato Bhagavato61 sa sani patisamdhi. The angel Arhadgupta, 62 having descended, announces to the great assembly the future) conception of the Blessed one. N . iT Norah l3tay yasya sak, triangular; see the corresponding relief on Plate xxviii. of the stapa of Bharhut. ** This is the name of a kind of chandrayana. +1 On navakammika see Vinaya Texts, Part III. pp. 189 ff. and compare navakamaka in en Amaravati inscription (Zeitachr. der Deutschen Morg. Ges. Vol. XL. p. 846, No. 58) and lamantika, ante, Vol. XIV. p. 334. 0 Probably a clerical mistake for pleddo. 51 to looks almost like ta. Read deati. " The name Arahaguta davaputa is also contained in a fragmentary inscription on Plate lvi. No. 8, of the Stupa of Bharhut.
Page #250
--------------------------------------------------------------------------
________________ 234 THE INDIAN ANTIQUARY. (AUGUST, 1892. No. 81 (liv. 67, 68). 1 Moragirimha Nagiliya bhikhuniya danam thabh 2 bhagavato Vipasino bodhi. Pillars, (representing) the bodhi (tree) of the blessed Vipasyin, the gift of the nun Nagiles from Mayuragiri.54 No. 82 (liv. 69). Vedisa Phagndevasa danani. The gift of Phalgudeva from Vaidika. No. 83 (liv. 71). Purikaya dayakana danam. The gift of donors from Purika.56 No. 84 (liv. 72). Bhagavato Kakusadhasa bodhi. The bidhi (tree) of the blessed Kakutsamdha. No. 85' (liv. 73, 74). I Vcdisa AnuradhAya danam 2 Chhadamtiya jatakam. The jataka (which treats) of the Shadianta (elephant), tlie gift of Anuradha from Vaidika. No. 86 (liv. 75; Hoernle's No. 26). Vitura-Punakiya jatakan. The jatak. (which treats) of Vidhura and Purpaka. No. 87 (liv. 76). Bramhadevo manavako. The youth Brahmadeva. No. 88 (liv. 77). Bhadata-Kanakasa bhanakasa thabho dAnam Chikulaniyasa. A pillar, the gift of the reverend Kanaka, preacher, from Chikulana. No. 89 (liv. 78). Yakhini Sudasana. The Yakshini Sudarbana. No. 90 (lv. 80). i Bhadata-Budharakhitasa sa(tu)pada (na)2 sa danar thabho. A pillar, the gift of the reverend Buddharakshita, who is versed in the sciences (P). No. 91 (lv. 81). Chada Yakli. The Yakshi Chandra. No. 92 (lv. 82). Kumpiro Yakho. The Yuksha Kuvera. No. 93 (lv. 83). Ajakalako Yaklo. The Yalesha Adyakalaka. * Rogarding the formation of this namo, see Panini, v. 3, 84, and Zeitechr. der Deutschen Morg. Ges. Vol. XXXVII. p. 551, No. 5, note 2. Compare further Ghatila (No. 138), Mahila (No. 69), Saghila (No 128) and Yakhila (No. 126). # With Mayuragiri comparo Mayuraparvata, a locality which is referred to in a quotation of the Charana. tyrhabhishya ; see Dr. Buhler's translation of A pastamba, p. xxxi note, and Dr. Fon Schroeder's Maitriyant Solihita, p. xxiv. The same place is mentioned in Nos. 117 to 119. On a town of this name, which is referred to in the great pic. see Bohtlingk and Roth's Sanskrit Worterbuch, 8. v. At the time of the SilAhkras, Purl was the capital of tho Konkan; ante, Vol XIII. p. 134. Another Purt in Orisur is well-known by its shrine of Jagannaths; ante, Vol. XX. p. 390.
Page #251
--------------------------------------------------------------------------
________________ AUGUST, 1892.] No. 94 (lv. 84). Moragirimhan Pusaye danam thabhi. Pillars, the gift of Pushya from Mayaragiri. No. 95 (lv. 85). BHARAUT INSCRIPTIONS. 1 Aya-Chulasa Sutamtikasa Bhogavadha2 niyasa danaro. The gift of the reverend Kshudra, who is versed in the Sutranta,56 from Bhoga. vardhana.57 No. 96 (lv. 86). Moragirimha Thupadasasa danam thabha. Pillars, the gift of Stupadass from Mayaragiri. No. 97 (Iv. 88). 1 Maharasa amtevasino aya-Sama 2 kasa thabho danam. A pillar, the gift of the reverend Syamaka, the disciple of Mahara. No. 98 (Iv. 89). Bhagavato okramti.58 The descent of the Blessed one. Idasala-guha. The Indrasala cave. No. 99 (Iv. 92). No. 100 (v. 2). Pataliputa Kodiyaniya Sakatadevaya danam. The gift of Sakatadeva, a Kodyant, from Pataliputra. No. 101 (lv. 3). Kakam diya Somiya bhichhuniya danam. The gift of the nun 86m1 from Kakandi,50 No. 102 (lv. 4). Pataliputa Mahidasenasa dinam. The gift of Mahendrasons from Patalipatra. No. 103 (lv. 5). Chudhilikaya Nagadevaya bhikhaniyido [dinam]. The gift of the nan Nagadova from Chudathila. No. 104 (lv. 6). Chudathilikaya Kajaraya dana'n. The gift of Kunjara from Chudathila. [U]jhikaye dana. The gift of Ujjhika. No. 105 (lv. 7). Dha[i]maguta-matu Pusadevaya dinamm. The gift of Pushyadva, the mother of Dharmagupta: No. 106 (lv. 8). No. 107 (Iv. 9). ^ 235 [Dha]marakhitaya dana suchi. A rail, the gift of Dharmarakshita. 66 On Suttantika, see Vinaya Texts, Part I. p. xxx. and on the school of the Sautrintikas, Dr. Kern's Buddhismus, translated by Jacobi, Vol. II. p. 504. 57 The same place is repeatedly mentioned in the Sanchi insoriptions. The first letter of this word looks like 4, which is phonetically impossible. 59 Kakandi is mentioned in the Patavalt of the Kharataragachha; ante, Vol. XI. p. 247. Read bhikhuniya.
Page #252
--------------------------------------------------------------------------
________________ 236 THE INDIAN ANTIQUARY. [AUGUST, 1892. No. 108 (lv. 10). Atimutasa danam. The gift of Atimukta. No. 109 (lv. 11). Lata va-jataka. The latva jataka. No. 110 (lv. 12). Nadutaraya dAna suchi. A rail, the gift of Nandottard, No. 111 (lv. 13). [Mu]dasa danan. The gift of Munda. No. 112 (lv. 14). Isa nasa dana. The gift of Isana. No. 113 (lv. 15). Isidatasa danam. The gift of Rishidatta, No. 114 (lv. 16). Aya-Puna vasuno suchi dinam. A rail, the gift of the reverend Punarvasu. No. 115 (lv. 19). Devarakhitasa danan. The gift of Devarakshita. No. 116 (lv. 20). Vedisato Bhutarakhitasa dina, The gift of Bhatarakshita from Vaidina. No. 117 (lvi. 22). Purikaya Idadevaya danan. The gift of Indradeva from Purika. No. 118 (lvi. 23). Purikaya Setaka-matu danan. The gift of the mother of Sreshthaka, 1 from Purika. No. 119 (lvi. 24). Purikaya Samaya danam. The gift of SyAmd from Purika. No. 120 (lvi. 25). Budharakhitaye danam bhichhuniye. Tbe gift of the nuu Buddharakshita. No. 121 (lvi. 26). Bhataye bhichhaniye danam. The gift of the nun Bhata. No. 122 (lvi. 27). Ayar Apikina kasa danam. The gift of the reverend Apikinaka,63 No. 123 (lvi. 28). Saghilasa dana suchi. A rail, the gift of Samghila. 61 Regarding the loss of the aspiration, see Dr. Kuhn's Pabi-Grammatik, p. 61, and compare Asadi for AshAdha (No. 95, Virudaka for Virudhaka (No. 43), and Vitara for Vidhur (No. 86). 62 Compare Ampikinaks in a Bhaja inscription : Arch. Survey of W. India, Vol. IV. p. 82, No. 3.
Page #253
--------------------------------------------------------------------------
________________ AUGUST, 1892.) BHARAUT INSCRIPTIONS. 237 No. 124 (lvi. 29). Sagbarakhitasa matapituna athayA danam. The gift of Samgharakshita for the benefit of (his) mother and father. No. 125 (lvi. 30). Dhutasa suchi dano.63 A rail, the gift of Dharta. No. 126 (lvi. 31). Yakhilasa suchi dana. A rail, the gift of Yakshila. No. 127 (lvi. 32). Mitasa sochi danam. A rail, the gift of Mitra. No. 128 (lvi. 33). Isirakhitasa danam. The gift of Kishirakshita. No. 129 (Ivi. 34). Sirimasa danam. The gift of Srimat. No. 130 (lvi. 35). Bhadata-Devasenasa donan.64 The gift of the reverend Devasona. No. 131 (lvi. 36). ..... kaya bhichhuniya danam. The gift of the nun ..... No. 132 (lvi. 37). N[am]d[i]pagarikaya Idadevaya dinan. The gift of Indradeva from Nandinagara.65 No. 133 (lvi. 40). Jethabhadrasa danam. The gift of Jyoshthabhadra. No. 134 (lvi. 41). Aya-Jatasa Petakino suchi danam. A rail, the gift of the reverend Jata, who is versed in the Pitakas, No. 135 (lvi. 42). Budharakhitage rupakaakasa dang. The gift of the sculptor Buddharakshita. No. 136 (lvi. 43). Bhadata-Samikasa Therak[a]tiyasa danan, The gift of the reverend SyAmaka from Sthavirakata. No. 137 (Ivi. 44). Sirisapada Isirakhitaya danan. The gift of Rishirakshita (from) Birishapadra.68 65 dana is used as a masculine ! The 8 probably represents a dimmed (sanhvrita) pronunciation of the vowel 4. 68 A place of this name is mentioned in several Sanchi inscriptions. * A village onlled Birtahapadrake is mentioned in two inscriptions of the Gurjara dynasty : ante, Vol. XIII. pp. 82 and 88. Similar names are SAmalipada (Almalipadra) in a N Asik inscription (Arch. Survey of W. India, Vol. IV. p. 111) and Vatapadra, the modorn Baroda (ante, Vol. XII. p. 125, noto 85).
Page #254
--------------------------------------------------------------------------
________________ 238 THE INDIAN ANTIQUARY. [AUGUST, 1992. No. 138 (lvi. 45). Moragirimk7 Ghatila-matu danam. The gift of the mother of Ghatila, from Mayuragiri. No. 139 (lvi. 47). Samidatiya dinan. The gift of Svamidatta. No. 140 (lvi. 48). Chulanasa danan. The gift of Chullana.68 No. 141 (lvi. 49). Avisanasa danam. The gift of Aviananna.ce No. 142 (Ivi. 50). [Avisanasa danar. The gift of Avishanna, No. 143 (lvi. 51). Sanghamitasa bodhicha kasa danam. The gift of a bodhichakra by Sanghamitra. No. 144 (lvi. 52). Budharakhitasa Pachanekayikasa danam. The gift of Buddharakshita, who is versed in the five Nikayas.70 No. 145 (ivi. 53). Isirakhitasa 71 sachi danan. A rail, the gift of Bishirakshita. No. 146 (lvi, 55). Phagudeviye bhichhuniye danam. The gift of the nan Phalgudevi. No. 147 (lvi. 56). Kodaya Yakhiya danan. The gift of a Yakshi by Kroda.72 No. 148 (lvi. 57). Ghosaye danan. The gift of Ghosha. No. 149 (Ivi. 59). Seriya putasa Bharanidevaga dana. The gift of Bharanideva, the son of Sri. No. 150 (lvi. 60). Mitadevaye danam. The gift of Mitradeva. No. 151.13 Isa nasa dana. The gift of Ihana. 07 Moragirim is either a clerical mistake for Moragirimhd, or stands for the maimilated form Morugirimmd. Compare wachitammi for wafichitdomi, and paid for parahid in the Jalaka, Vol. I. pp. 287 and 146. This word is derived from chulla (Sanskrit kshudra). Compare Dhamanaka, NAkanaka, Pusapaka, Ramanaka, Usabhanaka and Vasulapaks in the cave inscriptions Compare Avisins in two Sfichi insoriptions 70 See Childers' Pali Dictionary, s. v. nekdyiko. 11 tasa looks like tasa. 19 Compare Kodi ina Karle insoription (Arch, Burvey of W. India, Vol. IV. p. 91, No. 16) and Kods in a Sopra inscription (Dr. Bh. Indraji's Sopard and Padana, p. 18). The word dinamh governs both & subjective and an objective genitive, as in No. 143; see Panini, ii, 8, 65. ** On the same rail as the identical inscription No. 112, but in more modern characters.
Page #255
--------------------------------------------------------------------------
________________ AUGUST, 1892.1 BHARAUT INSCRIPTIONS. 239 No. 152.74 Bo[dhiga]tasa danam. The gift of Bodhigupta. No. 153.76 ..... Himavate i ..... No. 154.76 .......... [m]ika[sa danam). No. 155 (xxv. 4; lv. 94).77 M[u]ga[pa]k[i]y[a]j[]ta[ka]. The jdtaka (which treats) of the cooking of beans (). No. 156 (xxvi. 7). Isis[imgiya jata[ka). The jataka (which treats) of Ribyabringa. No. 157 (xxvi. 8; lv. 97). Yam bram[h]ano avayesi jatakam. The jataka (entitled)" yan brahmans avadesi." No. 158 (xxvii. 11; liii. 11). Hamsa-jataka. The swan jdtaka. No. 159 (lvi. 66). Tirami timigila-kuchhimha Vasuguto machito Mahadevanam.78 Vasugupta is rescued from the belly of the sea-monster (and brought) on shore by Mahadova.70 No. 160 (lvi. 19). 1 [Ba]huhathika asana 2. [bhaga)vato MahAdevasa. The seat of the blessed Mahadeva (under the banyan tree) Bahuhastika.90 PRAKRIT AND SANSKRIT INDEX.91 Aboda (Arbuda) 5. Asada (Ashiha) 9. Achhara (Apsaras) 51 to 54. Asana 160. Agaraju (Angaradyut) 1. asa varika (asvadeg) 36. Ajakalaka (Adya) 93. atha (artha) 124. Aja tasata (satru) 77. Atimuta (mukta) 108. Alambusa (Alambusha) 54. avayesi (3rd pers. sing. aor. of vidayati) 157. amtevasin (ante) 97. Avisana (Avishanna) 141, 142. Anadhapedika (Anathapindika) 38. aya (Arya) 2, 23, 25, 26, 45, 67, 76, 95, 97, 114, Anuradha 85. 122, 134. anusisati (sasti) 4. Apikinaka 122. Badhika (Bodhika ?) 27. Arabaguta (Arhadgupta) 80. lvi. 3. Bahahathika (Chastika) 61, 62, 160. aramaka (Aramika) 63. bhadamta (bhadanta) 23, 66. 74 On rail 8, Plate xxxviii. No. 3; much injured, 78 On rail 12, Plate xxiv. No. 8. 76 On pillar 28, Plate xix. 11 Nos. 155 to 160, the originals of which were not removed to Caloutta, are transcribed from General Cunningham's photographs and eye-oopies in his Stapa of Bharhut. 7 Road Tiramhi timingila- kuchhimha Vasuguto mochito Vanaderna. To see the corresponding relief on Plate xxxiv. No. 2, of the Stapa of Bharhut. Mahadeva probably refers to the Mahisatta or Bodhisatta ; compare No. 160. * See p. 232, note 42. * Arabic figures refer to the Nos of the insoriptions, Roman figures to the Plates of the Stapa of Bharhul.
Page #256
--------------------------------------------------------------------------
________________ 240 THE INDIAN ANTIQUARY. [AUGUST, 1892. bhadata (bhadanta) 69, 71, 76, 88, 90, 130, 136. dana (dana) 108. 145. bhagavat 24, 30, 46, 57, 60, 64, 77, 78, 80, 81, dana 2 eto.- Maso. 125. 84, 98, 160. dayaka 83. bhanaka (bhinaka) 66, 88. deti (dadati) 38. bhanaka (bhanaka) 45, 76. deva (deva) 50. Bharanideva (Bharanideva) 149. devaputa (devaputra) 80. lvi. 3. bhariya (bharya) 22. Devarakhita (Derarakshita) 115. bhichhuni (bhikshuni) 27, 31, 65, 101, 120, devasabha (deva) 78. 121, 131, 146. Devasena (Devasena) 130. bhikhuni (bhikshuni) 29, 75, 81, 103. devata (devatil) 47, 73. lv. 98. bhisaharaniya (from bisa-harana) 17. devata (de vata) 26. Bhogavadhaniya (from Bhogavardhana) 95. devi (devi) 20. Bhojakataka (from Bhojakata) lvi. 46. dhamachaka (dharmachakra) 57. Bhojakataka (from Bhojakata) 31. Dhamaguta (Dharmagupta) 35. Bhuta (Bhuta) 121. Dhamarakhita (Dharmarakshita) 41. Bhutaka (Bhudeg) 67. [Dha]marakhita (Dharmarakshita) 107. Bhutarakhita (Bhutarakushita) 23, 116. Dha[m]magata (Dharmagupta) 105. Bib[i]k[@]nadikata (Bimbika nandio P) 33. Dhanabhuti 1. lvi. 54. Bibikanadikata (Bimbikinandio) 36. . dhitu (gen. of duhitri) 27. bidala (bidala) 7. Dhuta (Dhurta) 125. bodha (bodha) 46. Diganaga (Dinnaga) 31. bodhi (bodhi) 24, 30, 64, 81, 84, Dighata pasi (Dirghatapasvin) 4. bodhichaka (bodhichakra) 143. disa (acc. of dis) 47 to 49. Bo[dhigu]ta (Bodhigupta) 152. dohati (dogdhi) 18. Bram hadeva (Brahmadeva) 87. dona (dana) 130. bram[h]ana (brahmana) 157. Budharakhita (Buddharakshita) 90, 135, 144. Erapata (Airavata) 59, 60. Budharakhita (Buddharakshita) 120. Budhi (Buddhi) 33. Gagi (Gargi) 1. gahapati (grihadeg) 33. cha 1. Chada (Chandra) 91. gahuta (grihita) 6. Ga[m]dhakuti (Gandhakuti) 40. chakams (chankrama) 8, 68. Gamgita 44. Chakavuka (Chakra) 42. Ghatila 138. Chi padova (deva) 22. Ghosa (GhoshA) 148. Chekulana (from Chio) 64. Gorakhita (Gorakshita) 25. Chenachhaka (2) liv. 70, 79. Goti (Gaupti) 1. chetaya (chaitya) 11. ch[e]tiya (chaitya) 5. chha (shash) 49. hamsa 158. Himavata (vat) 153. Chhadamtiya (from Shaddanta) 85. Chikulaniya from Chikulana) 88. Chitupada-sila (Chitrotpata-sila) 21. Idadeva (Indradeva) 117, 132. chudamaha 78. Idasala-guha (Indrasala-guha) 99. Chudathilika (from Chudathila) 29, 103, 104. Isana (isana) 112, 151. Chula (Kshudra) 95. isi (rishi) 10. ChulakokA (Kshudrakdka) 26. Isidata (Rishidatta) 113. Chalana (from kshudra) 140. Tsidina (Rishidatta) 45. Isipalita (Rishi) 76. Dabhinika (fron Dabhina P) 27. Jairakhita (Rishirakshita) 128, 145. Dadanikama (Dandanish krama P) 8. Isirakhita (Rishirakshita) 137. dakhina (dakshina) 49. Isis[imgiya] (from Risyassinga) 156.
Page #257
--------------------------------------------------------------------------
________________ August, 1892.] BHARAUT INSCRIPTIONS. 241 jabu (jambu) 19. Janaka 20. Jata 134. jataka (ja) 3, 6, 7, 10, 14, 15, 17, 86, 157. jataka 12, 32, 37, 72, 85, 109, 155, 156, 158. jatila 13. Jetavana (Je tao) 88. Jethabhadra (Jyeshtha) 133. miga (mriga) 10, 11, 37. Misak[@]si (Misrakest) 51. Mita (Mitra) 127. Mitadeva (Mitradeva) 150. m[o]chita (mochita) 159. Moragiri (Mayurao) 81, 94, 96, 138. lv. 95. [Mo]da (Munda) 111. m[u]ga(pa]k[i]ya (from mudga-paka P) 155. Kakandi (Kakandi) 101. Kakusadha (Kakutsandha) 84. KAmavachara 49. Ka[m]dariki (Kandariki) 55. kanmamta (karmanta) 1. Kanaka 88. Karahakata 16, 67, 70. lv. 96. karita 1. Kasapa (Kasyapa) 64. katha (kashtha or kvatha P) 18. keti (nom. of kretri) 38. Khujatidukiya (from Kubjatinduka P) 23. Kinara (Kimnara) 12. Kodi (Kroa) 147. Kod[i]ya (Kodya P) 63. Kodiyani (KodyAni P) 28, 100. Konagamena (Konagamana) 30. Kosabeyeka (from Kansambl) liv. 53. Kosala (Kosala) 58. Kosa [in]ba-kuti (Kausamba-kuti) 39. koti (koti) 38. kuchbi (kukshi) 159. Kujara (Kunjara) 104. kukuta (kukkuta) 7. Kupira (Kuvera) 92. Nadoda (Nadoda) 18, 19, 62. liv. 70, 79. Nadutara (Nandottara) 110. naga 32. Naga (Naga) 65. Nagadeve (deva) 2. Nagadeva (deva) 103. Nagaraja (oraja) 42, 60. [Na]garaja (Oraja) 59. Nagarakhita (rakshita) lvi. 67. Nagasena (sena) 28. Nagila 81. N[an]d[i]nagarik[a] (from Nandinagara) 132: Nasika lv. 87. fati (joatri P) 9. navakamika (fron navakarman) 76. nigama 16. nigodha (nyagrodha) 62. okramti (avakranti) 98. latava (latva) 109. MaghAdeviya (from Makhaddva) 8. Mahadeva (Mabadeva) 159. Mahadeva (Mahideva) 160. Mahakoka (MahAk6kA) lv. 98. Mahamukhi (Maha) 27. Mahara 97. mahasamayika (from mahat and samajika) 80. Mahidasena (Mahendrasena) 102. Mahila 69. manavaka (mana) 87. matapituna (matapitroh) 124. matu (gen. of matri) 105, 138. mata (gen, of matri) 118. Pachanekayika (from Panchanikaya) 144. pada liv. 70, 79. Padumavati (Padmavati) 53. Panthaka 26. pasada (pradeg) 79. Pasenaji (Prasenajit) 58. Patalipata (putra) 28, 100, 102. pathama (prathama) 22. patisamdhi (pratio) 80. pauta (pantra) 1. pavata (parvata) 18, 19. Petakin (from Pitaka) 134. Phagudeva (Phalgudeva) 82. Phagudev& (Phalgadova) 146. PanAvasu (Punarvasu) 114. purathima (from parastat) 47. PurikA 83, 117 to 119. Pusa (Pushya) 37. Pusa (Pushya) 94. Pusadeva (Pushyadeva) 105. puta (putra) 1,149
Page #258
--------------------------------------------------------------------------
________________ 242 THE INDIAN ANTIQUARY. [AUGUST, 1892. raja (rajya) 1. rajan 1, 20, 58. Revatimita (Revatimitra) 22. rupakaraka (rupa) 135. susana (smasana) 9. Susupala (Sisao) 63. Satamtika from Sotranta) 95. thabha (stambha) 22, 25, 35, 64, 66, 67, 69 to sabha 13. 71, 75, 81, 88, 90, 94, 96, 97. Sabhad[Q] (Subhadra) 52. thambha (stambha) 26, 37. sadika (sataka or satika) 50. Therak[Q]tiya (from Sthavirak ula) 136. Saghamita (Sanghamitra) 64. Thupadasa (Stapa) 96. Sagharakhita (Sangharakshita) 124. Tikotika (Trikotika) 68. Sagbila (Samghila) 123. timigila (timingila) 159. sabasa sahasra) 49. (tini] (trini) 48. Sakamuni (Sakya) 46. tira (tira) 159. Sakatadeva ('Sakatadeva) 100. torana (torana) 1. sala (sala) 24. tura (turya) 50. Sama (Syama) 119. samadaka (sammadaka) 11. Samaka (Syamaka) 71. ada (udra) 14. Samaka ('Syamaka) 97. [U]jhika (Ujjhika) 106. Samana ('Sramana) 29. upamna (utpanna) 1. Samghamita (mitra) 143. utara (uttara) 48. Samidata (Svamidatta) 139. Samika ('Syamaka) 70, 136. sarmada 50. samthata (samstrita) 38. Vachhi (Vatsi) 1. sasa[t]i (sasti) 80. vadate (vandate) 60. sa[ta]pada[na] (sastropadana ?) 90.. Vadhapala (Vyadhao) lvi. 54. [sa]vata (samvrita ?) 48. vadhu (vadhu) 9. Valaka 66. sechha (saiksha) 15. Selapuraka (from 'Sailapura) lv. 91. vamdate (vandate) 77. Seri (Sri) 149. Vasuguta ("gupta) 159. Setaka ('Sreshthaka) 118. Vedisa (Vaidisa) 22, 82, 85, 116. Iv. 100. lvi. 1. sigala (srigala) 9. Veduka (Venuka) 18, 63. sila (sila) 1. Vejayanta (Vaijayanta) 79. Sirima ('Srimat) 129. Vesabhu (Visvabha) 24. Sirima ('Srimati) 73. Vijadhara (Vidyao) 56. Sirisapada ('Sirishapadra) 137. Vijapi (Vijayin ?) 56. sisa (sishya) 4. Vipasin (Vipasyin) 81. sisa (sirshan ?) 48. V[i]rudaka (Virudhaka) 43. Sivala (Sivald) 20. Visadeva (Visvadova) 1. Soma (Soma) 101. Vitura-Punakiya (from Vidhura and Purnaka) suchi (schi) 107, 110, 114, 123, 125 to 127, 134, 145. vokata (avakranta) 80. Suchiloma ("Sachiloma) 74. Sudasana (Sudarsana) 89. Sudhamma (Sudharma) 78. Yakha (Yaksha) 34, 43, 44, 74, 92, 93. Sudhavasa ('Saddha) 47. Yakhi (Yakshi) 91, 147. Suga (Sunga) 1. Yakhila (Yakshila) 126. Sujata (Sujata) 6. Yakhini (Yakshini) 89. Suladha (Sulabdha) 36. ya (yat) 157. Supavasa (Supravpisha ?) 34. I yavamajhakiya (from yavamadhyaka) 72. 86.
Page #259
--------------------------------------------------------------------------
________________ AUGUST, 1892.] THE INSCRIPTIONS OF PIYADASI. THE INSCRIPTIONS OF PIYADASI. BY E. SENART, MEMBRE DE L'INSTITUT DE FRANCE. Translated by G. A. Grierson, B.C.S., and revised by the Author. (Continued from page 210). PART II. 243 MIXED SANSKRIT AND CLASSICAL SANSKRIT. It is in the monuments of the last Kshaharata, Nahapana, and in those of the first Andhrabhrityas that we find the knot of the questions with which we are concerned. According to my opinion, these monuments are dated with certainty. Even for those who may not share my opinion, they are not one whit of less capital importance. A difference of 50 or 100 years is, in this matter, of small consequence, and, at any rate, there can be no dispute about one point, viz., that all these texts are to all intents and purposes contemporaneous. Nevertheless, from the point of view of language, they present characteristic differences. At Nasik, Karli, and Junnar, seven inscriptions of the reign of Nahapana have been brought to notice. Not only do they all belong to the same time, but also, with the exception of the last, they all emanate from the same person, Usavadata, son-in-law of Nahapana. Of these inscriptions, one, No. 5 at Nasik, appears at the first glance to be couched in grammatical Sanskrit, spelled according to classical rules. But, on closer examination, we observe more than one irregularity, the transgression of certain rules of Samdhi, Prakritizing methods of spelling, 52 such as dvatrisatnaligera, lenam, podhiyo, bhatarkanatiya, varsharatum, utamabhadram, &c. These irregularities, which are very rare at the commencement, multiply towards the end of the inscription. Another (Nasik 6 A) is, on the other hand, entirely Prakrit in its terminations; homogeneous consonants are not doubled; r is retained after a consonant (leshatrapa), but assimilated where it precedes (savana); it distinguishes three sibilants, but, by the side of sata, we read sata, and even panarasa for panchadasa; by the side of the ordinary assimilations of Prakrit, the group ksha is retained unchanged, and we find netyaka equivalent to the Sanskrit naityaka. It is hardly otherwise with No. 7 of Nasik. It contains both kusana and kasana, srenisu beside Ushavadata,63 karshapana and kahapana, sata and sata, all which does not prevent its using the vowel ri in krita. In another inscription, No. 19 of Karli, pure Prakrit reigns supreme, except in the orthographies brahmana and bharya. The fact is the more striking because the formula employed is the exact counterpart of the Sanskrit formula of the monument first referred to. The case is the same at Nasik, in Nos. 8-9, save for the orthographies putra, kshatrapa, and kshaharata, by the side of Dakhamita (equivalent to Dakshamitra). Finally, in No. 11 of Junnar, the ksha gives way to kh, which, nevertheless, does not prevent them from writing amatya and not amacha, by the side of sami for svami, and even of matapa for mandapa. I cannot dispense with again referring to No. 10 of Nasik which, although we are unable to fix its date with precision, is undoubtedly contemporaneous. This time, the terminations, the genitive masculine in asya, have the appearance of Sanskrit; but we also find the genitive varmanah, side by side with varmasya; as a general rule the orthography is Sanskrit, but, nevertheless, we read in it gimhapakhe, chothe (= chaturthe), vishnudatdyd, gilanabheshaja. This is the exact reverse of the preceding inscriptions, which write kshatrapa, and have the genitive in asa. This capricious and unequal mixture of classical and popular forms is no new thing. In the literature of the Northern Buddhists, it has a name. It is the Gatha dialect. Nowadays, that this same mode of writing has been found not only in prose religious 52 Hoernle, Ind. Ant. 1883, pp. 27 and f. 51 Cf. Arch. Surv. West. Ind. IV. pp. 99 and ff. 63 Ushavadata itself could easily contain an instance of confusion between the sibilants. The v, which is almost constant, does not appear to me to lend itself to the transcription Rishabhadatta of Dr. Buhler. It is, unless I am mistaken, Utsavadatta, which we should understand.
Page #260
--------------------------------------------------------------------------
________________ 244 THE INDIAN ANTIQUARY. (AUGUST, 1892. treatises, but also in lay works, and that we meet it in the texts of inscriptions, this terminology has become both inaccurate and inconvenient. I propose to substitute the term 'Mixed Sanskrit,' name which will, I hope, be justified by the observations which follow. The same caves preserve the memory of the Andhrabhrityas who were contemporary with or the immediate successors of Nahapana, - Gotamiputa Satakani and his descendants.66 In general (Nasik, 11 A, 11 B, 12, 13, 14, 15, 16, 22; Karli, 20, 21; Kanhori, 4, 14, 15) the inscriptions are couched in pure Prakrit, though not without certain inconsistencies in detail (svami beside 'samiyehi, Nas. 11 A, 15); Pulumayi (Nas. 13, beside Pulumdvi, Nas. 15, and Pulumdi, Nas. 12, &c.). This means that assimilation occurs everywhere, though the consonants are never written double. This does not, however, prevent us from finding at Karli (No. 22), a donation of the reign of Visithfputa Pulumayi, which has siddhari, according to the classical method; which, beside numerous genitives in asa, writes puttasya, sovasakasya, vdthavasya, and, beside nithito, hitasughasth(Otaya. It thus unites in the same word forms which were already no longer found in the inscriptions of Piyadasi, and others which are still rare in the 2nd century of our era, to which epoch they belong ! On the other hand, at Kanheri (No. 11)56, dedication of the reign of Vasishthipatra Satakarni, the sonin-law of the Satrap Rudradaman, is couched in pure Sanskrit, save for one single irregularity : Satakarnisya. Are these facts, I will not say isolated, but circumscribed in a narrow region ? Quite the contrary. It is sufficient for conviction to cast the eye over the monuments of the Turushka kings, Kanishka and his dynasty, monuments which are either exactly contemporary with those to which we have just referred, or of very little earlier date. The inscription of Sue Vihar7 is dated the 11th year of Kanishka. It may be said to be couched in Sanskpit, but in a Sansksit seriously disfigured by spellings like bhichhusya, athavi(W)ke, nagadatasya, sankhaka. tisya), yathis, yathipratithanam, &c. In the 18th year of the same reign, the stone of Manikykla, 58, however. imperfectly we may understand it, allows us clearly to recognise, side by side with the retention of the three sibilants and of groups containing an t, a number of Prakrit forms, such as budhisa, the termination ae, maharajasa, vespasisa, chhatrapasa, &c. Mathura possesses, from the year 28,50 a fragment of correct Sanskrit. So also for the time of Huvishka. At Mathura (Growse, 2, 11; Dowson, 1, 2, 5, 7) the language of the dedications is classical; yet they present the genitive bhikshusya, and the phrase arya (or Elasya) prervaye. On the Wardak vase, in the year 51, appear forms so much altered as thuvamhi (=stape), bhagae, arogadachhinal, to speak only of those which are certain. The date of the inscription of Taxila is not fixed with certainty, but I do not think that any one can consider it as more modern than those to which I have just referred; and the name Chhtharata, which I think I have identified at the end of the first line seems to assign it a place in about the same epoch, or in an epoch slightly earlier. Here, excepting the sibilants and a few groups (chhatrapa Thratara, vardhita, sarva, sahvatsara), everything is Prakrit, the genitive in asa, the assimilation in atha, takhasila, pratithapita, &c., and mixed up with very debased forms such as the Jocative samvatsaraye, and the dative puyae. It is necessary to complete this review, by noting that it is towards the end of the period of which we are treating, towards the year 75 or 80 of the Saka era, i.e. 155 to 160 A. D., that we find the first known inscription in perfectly correct Sanskrit, - the inscription of the * The Bashkhali Manuscript, which has been published by Dr. Hoernle. * Arch. Sury. Weat. Ind. pp. 104 and ff. 16 Arch. Suru. West. Ind. V. p. 78. 6 Hoernle, Ind. Ant. X. 321 and ff. Paplit Bhagwanlal Indraji has submitted this document to an independent revision (Ind. Ant. 1882, p. 129), in which be has frequently come to conclusions different from those of Dr. Hoernle. In cases of divergency, except in certain doubtful passages in which the truth appears to me to be still undiscovered, I consider that it is Dr. Hoernle who is right. 58 Dowson, J. R. A. S. XX. p. 250. ** Growse, Ind, Ant, 1877, pp. 216 and ff. Dowson, J. R. A. 8., N. 8. V. 182 and fr. (after Cunningham).
Page #261
--------------------------------------------------------------------------
________________ AUGUST, 1892.] THE INSCRIPTIONS OF PIYADASI. 245 Satrap king Budradaman, at Girnar. The inscription of Jagdhan, datod 127, and consequently 50 years later, emanating from the grandson of Rudradaman, only returns to the mistakes of Mixed Sanskrit in a few details. 61 What is precisely this Mixed Sanskrit P Various attempts have been made to explain its existence and its peculiarities. It has been held to be a dialect intermediate between the ancient period of Sanskrit and the more modern period of the Prakrits; a sort of jargon created by ignorance or, if it is preferred, by incomplete knowledge on the part of the people, their ambition being incommeasurate with their powers, who wished to give themselves the honour of writing in the literary language, withont possessing a safficient acquaintance with it (Burnout); - the special dialect of bards, who appear to bave taken a middle course between the popular speech and the learned language, in order to make themselvos intelligible, without too great derogation, to their audience (RajendralAla Mitra). Neither of these explanations, taken alone and in the exact meaning which was intended by its author, can be reconciled with facts as they are known to us at the present day. The conjecture of Burnoaf was an excellent explanation, when he seemed to be dealing with only a few stanzas lost in a vast literature. We can no longer attribute to the pedantry of an editor or of a clumsy scribe a language which is employed on a vast scale, and applied to royal inscriptions, and we are unable to explain by & valgar ignorance & mixture, which rather appears to bear witness to an extensive acquaintance with the literary language. It is no more possible to represent, as a special poetical language, a dialect which is fluently used in the inscriptions, and which is employed in lengthy prose works and even in didactic treatises. As for seeing in Mixed Sansksit the direct expression of the current language at a certain period of its development, the theory hardly deserves the trouble of refatation. A dialect so void of all stability, at one moment closely resembling classical Sanskrit, and at another very different from it, & dialect which brings together, in complete confusion and in arbitrary proportions, phonetic phenomena which belong to most anequal degrees of linguistic development, could never be a faithful echo of the popular language at any epoch whatever. Mixed Sanskrit is, neither in its grammar nor in its phonetics, intermediata between Sanskrit and the Prakrits; it constitutes an incoherent mixture of forms purely Sanskrit and of forms purely Prakrit, which is an altogether different thing. Mixed Sanskrit has, moreover, a history. In the chronological series of monuments which it is represented, far from shewing signs of gradually increasing phonetic decay, it continues to approach more and more nearly to classical orthography and to classical forms. In the inscriptions of Mathura, the remnants of Prakpit orthography are so rare, that the general appearance as a whole is that of pure Sanskrit.02 This observation comes to our Assistance in answering the question which we have before ns. It is not sufficient to know what Mixed Sanskrit is not. We must determine what it is. Towards the end of the 2nd century, we find upon the monuments three dialects which, in their phonetic condition, appear to correspond to different ages of the physiological development of the language : Sanskrit, Mixed Sanskrit, and Prakfit. All three are destined in the future to continue ooncurrently in literature. Here we find them used side by side, at the same time, and at the same places. It is inadmissible to suppose that they represent contemporary states of the vulgar tongue; at most, that conld be represented only by the most corrupted of the three, dialects, the Praksit. As for Mixed Sanskrit, like Arch. Suru. West, Ind. III. p. 128. Hoernle, Ind. Ant. 1883, p. 32. This gradation becomes still more evident if, as we ought to do, we take as our point of departure the inscriptions of Piyadasi at Girder and at Kapur di Giri.
Page #262
--------------------------------------------------------------------------
________________ 246 THE INDIAN ANTIQUARY. [AUGUST, 1892. regular Sanskrit itself, it cannot be anything other than a special literary language, or, more exactly, & special literary orthography. In itself, it is no more surprising to find side by side two literary idioms like Sansktit and Mixed Sanskrit than to find the parallel use of the various Prakrit dialects which were established for religious or poetic usage. From the facts proved for the time of Piyadasi, we are prepared to see a double orthographical current establish itself, one more near to the popular pronunciation, and the other approaching, and tending to approach more and more nearly, etymological forms. In the hundred and fifty or two hundred years which separate our edicts from the most ancient monuments of Mixed Sanskrit properly so-called, these tendencies, which we have grasped in their rudimentary state, have had time to become accentuated, and to develop in the strict logical sequence of their principles. As it appears to as in the most recent monuments, Mixed Sansksit is so nearly the same as Sanskrit, that it seems impossible to separate the history of one dialect from that of the other. What is the relationship which unites the two P From the time when Sanskrit first appears, we find it in a definite form. Neither in yrammar nor in its orthography do we find any feeling the way, any development, any progress. It leaps ready armed from its cradle. As it was at the first day, so it has remained to the end. Mixed Sanskrit is altogether different. Uncertain in its orthographical methods, without any absolute system or stability, it appears to us, from Kapur di Giri to Mathura, progressing, in spite of many hesitations, in spite of many minor inconsistencies, in one continuous general direction. At Kapur di Giri the language is entirely Praksit, but several consonantal groups are preserved without assimilation. In the inscription of Dhanabhuti at Mathura,es the terminations are Prakrit, but spellings like udtsiputra, ratnagriha approach the classical standard. At Sne Vihar, even the terminations take the learned spelling; asya and not asa; only a few irregularities connect the language with Praksit. In the caves we have seen that some inscriptions have side by side the genitive in asya and that in asa. These examples will suffice. Besides these characteristics, two important facts, which mark their true significance, deserve mention. In the north, the first inscriptions written in Sanskrit, or at least so nearly Sanskrit that they bear witness to its diffusion, are those of Mathura, and date from the reign of Kanishka. Shortly after this period we find no further examples of monumental Mixed Sanskrit. In the west, the son-in-law of Rudradaman inaugurates the use of Sansksit with the inscription of Kanhori; from the end of the second century, the use of Mixed Sanskrit is, in the west, banished from the insoriptions. In a word, the introduction of regular Sanskrit marks the disuse of Mixed Sanskrit. That is the first fact. The second is of another nature. All texts in Mixed Sanskrit, both in the north and in the west, preserve uniformly one very characteristio peculiarity, which we have already noticed in the spelling of Piyadasi. They never write as double, identical or homogeneous consonants, which are really doubles either by origin or by assimilation. This trait only disappeared at the procise moment when Mixed Sanskrit coased to be used. In the north, the first inscriptions which double these consonants are those of Mathura, which are almost entirely couched in regular Sanskrit. The practice was certainly a new one, for the other inscriptions of the reign of Kanishka, even those which, as at Sue Vihar, approach most nearly the learned orthography, do not adopt it. It is quite true that they are 61 Bharhut Stupa, pl. LIII. 4. The transcription proposed by General Cunningham requires corrections. We should read, Kal........... dhana bhatisa .........vatal putrasa [uddhapa) lasa dhanabhatisa danari vedika toranini cha ratanagriha sa ruabudhap jaya saha matapi tihi (7) saha . chatu . parishdhi
Page #263
--------------------------------------------------------------------------
________________ AUGUST, 1892.] THE INSCRIPTIONS OF PIYADASI. 247 engraved in the Aramean alphabet of the north-west, while the Indian alphabet is employed at Mathura; but at Mathura itself, the inscription of Dhanabhuti, although written in Indian characters, does not observe the practice of doubling any more than they do. This neglect is, therefore, not the peculiarity of one particular mode of writing; it is a general fact down to a certain epoch, which, in the north is marked by the reign of Kanishka. On the west coast, the first inscription in which we find the notation of double consonants is No. 1l of Kanheri (Arch. Surv. V. 85). It is one of the latest of the series, and is certainly not earlier than the end of the 2nd century. The doubling of consonants, therefore, only makes its appearance at the period in which the monuments testify that correct Sanskrit was becoming taken into common use, and the parallel application, in the inscriptions of the time of Kanishka, of the ancient procedure, and of the new method, indicates that we have grasp ed the precise moment of the evolution. It is not difficult to come to a conclusion. Mixed Sanskrit is certainly not a direct copy of literary Sanskrit, attempted at an epoch when the latter had already been established in common use. The progressive march by which it gradually approximated classical forms as well as its feeling its way in matters of detail, would be, under this hypothesis, without any possible explanation. Its tendency towards an etymological and regulated orthography is everywhere visible. If it had had before its eyes a fixed, a definitive model, previously realized by writing and literary practice, it would from the first have imitated it in all its particulars. It would not have waited three centuries before doubling its consonants in writing. As it constantly tended to go as close as possible to the orthographical conditions, of which the learned Sansklit is the completed perfect type, it would have gone right up to it. From the moment at which real Sansktit appears, Mixed Sanskrit disappears, and this most naturally; for, in face of real Sanskrit, Mixed Sanskrit is without reason for existence, its efforts would be without honour, and its shortcomings without excuse. "Far, therefore, from being able to pass for an imitation of pre-existing Sanskrit, Mixed Sanskpit proves, by its very existence, that Literary Sansksit did not exist, I mean for current use. The date on which the classical language appears in the monuments, coincides with that at which the Mixed Sanskrit ceases to be employed, and marks very exactly the epoch at which the learned language took possession of that empire which was destined never to escape it. This conclusion is further strengthened by the fact that the current of this diffasion may, at least in one direction, be traced by the monuments. Regular Sanskrit can be considered as under process of establishment in the north-west towards the end of the first century of our era. The practice immediately began to spread towards the south. In the second half of the following century, the inscription of Rudradaman presents to our notice, in Gajarat, the first incontestable monument. It was the influence of the same sovereign which caused it to extend still further, for in an inscription of his daughter it makes its first appear. ance in the dominions of the Andhrabhsityas. Until then these princes had only employed a Monumental Prakrit now and then affecting the appearance of Mixed Sanskrit. Although Mixed Sansktit is not a direct imitation of a pre-existing Sanskrit, the close connexion between the two terms is evident. But is, therefore, Mixed Sanskrit the source of Classical Sanskrit? Is it Classical Sanskrit in course of formation ? By no means, any more than the converse case is true. The reasons are peremptory. All the elements from which Sanskrit, in its classical form, has been built up, were pre-existing in the Vedic language. Its system of phonetics, which is that which gives it its special character in comparison with the popular idioms, had long been fixed and analysed for the purpose of religious recitation. In order, therefore, to fix Sanskrit, there was no room for much feeling of the way. So far as there may have been any, it was certainly not of the kind we witness in Mixed Sanskrit. In fixing classical Sanskrit, a regular course would have been followed, instead of the constant alternate progress and retrogression which we find in the mixed variety. We do not find in it side by side the two-fold reflexion, the learned and the
Page #264
--------------------------------------------------------------------------
________________ 248 THE INDIAN ANTIQUARY. [AUGUST, 1892. popular, of the same forms. So also, the classical language, being derived directly from the learned and Vedic tradition could have made no delay in noting the duplication of consonants. It should not, however, be assumed that Literary Sanskrit must have sprung at once from the schools into public life. The necessary grammatical elaboration, even the accommodation of the alphabet to its needs, must have required a greater or less length of time, but the course of its development was certainly not the same as that which the inscriptions allow us to see in the case of Mixed Sanskrit, with its inconsistencies, and its blunders. While Mixed Sanskrit is neither the reflected imitation nor the source of classical Sanskrit, it is, nevertheless, something of both. If Sanskrit had previously existed in common use, Mixed Sansklit would never have existed at all; but at the same time, unlees Sanskrit had been in existence to serve for its type, the existence of Mixed Sanskrit would have been equally impossible. This paradox is not difficult to solve, if we place before us the very peculiar conditions which have ruled the linguistic development of India. Sanskrit presents itself to our notice under an aspect calculated to perplex the observer. Literary languages are usually vulgar tongues in current use, which, being applied, at a moment of high intellectual development, to works destined to endure as abiding national monu. ments, have been through the means of these works crystallised into a shape which becomes the norm for fature writers. Not so with Sanskrit. It does not issue directly from the popular idiom. It first appears at an epoch when the vulgar and general tongae had, for centuries, arrived at a much further advanced degree of phonetic and grammatical degeneration. It represents an archaic language preserved at first by oral tradition, and subsequently retouched by the labours of learned men. It is, in a manner, a literary language in the second degree, - a profane language, grafted on a more ancient religious one; or, to state the matter more accurately, it represents the reform of an earlier literary language. The oral preservation of the Vedio hymns down to an epoch when the language in which they were composed had long ceased to be used by the people, is a cardinal point in the linguistic history of India. A caste bad kept guard over the treasure of religious songs. Their importance for ritual assured their conservation to the most minute degree; the necessity of protecting their efficacy together with their material form gave rise to rules of pronunciation. These gradually developed into a phonetic system which was refined even to subtilty, and which prepared the way for the study of grammar properly so-called. The religious bearing of the hymns inspired the zeal necessary for assuring their oral transmission; and the fear of making the privilege common to all, maintained the oral tradition even down to an epoch when it would have been easy to substitute for it preservation by the art of writing. Whatever may have been the authority of this tradition, the knowledge of writing could not have failed to exercise a sensible action on the future of the language, and this action was the more certain, because the attention already paid to the phonetic questions had the better prepared men's intellects for the application of writing and for the comprehension of the questions of grammar. Being given this state of things and the introduction of so new and so powerful a factor, we have now to see how affairs actually occurred, and how, on the one hand Classical Sanskrit and on the other hand Mixed Sanskrit were developed. Sanskrit by its roots which dive deep into the language and the tradition of the Vedas, by its regularity founded on earlier phonetic studies, by its most ordinary applications, is essentially a Brahmanical language.63 By the manner in which it was constituted and fixed, it is a scholastio language, born and elaborated in restricted and exclusive surroundings. This character is so marked, that the foot, that such inscriptions is those of NAnaghat, although entirely devoted to the commemoration of liturgic ceremonies, are couched in PrAkrit, would almost of itself suffice to prove that, at the period to which they must be referred, Sanskrit had not yet expanded into exterior use. At any rate, it furnishes a remarkable confirmation of the conclusions on which I am endeavouring to throw some light.
Page #265
--------------------------------------------------------------------------
________________ AUGUST, 1892.] THE INSCRIPTIONS OF PIYADASI. 249 It is quite otherwise with Mixed Sanskrit. Every application of it which is known to us, whether in monuments or in literature, is, without exception, Buddhistic. The irregularities and inconsistencies of its grammar and of its orthography mark it with an evident character of spontaneity. It is not a dialect which has undergone alterations and after-touches, or which has bowed itself to those precise rules which denote the idea of a really literary language. From this two-fold point of view, therefore, the contrast between the two dialects is as marked, as, in other respects, their analogies are striking, and such hints are of considerable value to us. There is little appearance of the every day use of writing in India much before the time of Asoka. The inscriptions of Asdka are certainly the most ancient examples of the art which have hitherto been accessible to us. At this period we know of the existence of an archaic religious language preserved by a privileged caste in memorials, which are surrounded by a traditional reverence, and which, though it has never been written, has still been the object of a certain amount of culture. The Brahmans, the exclusive depositaries, through the oral tradition, of a religious literature on which their authority was founded, have always shewn themselves little disposed to deprive themselves, by writing, of their monopoly. At that time their disposition must have been the same. On the other hand, it is natural that the habitual study of the Vedic texts and the continuance of their religious avocations should have led them to preserve, or, in a measure, to evolve for their personal use an idiom akin to that of their traditions, and very superior, in its general aspect of preservation, to the contemporary dialects of the common people. The Buddhists must, on the contrary, have been anxious to avail themselves of the art of writing to spread abroad their doctrines. The monuments of Piyadasi bear witness to this, and the vulgar tongues were the necessary instrument of this propaganda. When people set themselves to the task of fixing, by writing, the current tongue, the religious language, and the experience gained in the efforts devoted to assuring its integrity, cannot fail to have exercised a certain amount of influence. This is exactly what we find in the orthography of the edicts. This influence continued, and gained increased power with time, and explains the continual progress with which, from Kapur di Giri to Sue Vihar, and from Sae Vihar to Mathura, the popular orthography comes nearer and nearer to learned accuracy. At the same time, the practice of writing exercised upon the culture of the religious language a reaction which was none the less certain because it was indirect. People might refuse to write it, but it was impossible that the ase of the alphabet should at have acted as a stimulus towards phonetic and grammatical studies. The attempts to fix the orthography of the vulgar tongue must have suggested and urged on the definitive fixation of the more learned language, the idea and general prototype of which mast have long been dormant in the Brahmanical schools. The labour devoted to this must, in its turn, have extended its influence to the vulgar orthography. The Buddhists, as we know, were recruited from the Brahmanical, as well as from the other castes, and they were, to a certain degree, initiated into its learning. This explains how their orthography, in Mixed Sanskrit, continually tended to approach nearer and nearer that of correct Sanskrit. It followed it from afar, if not step by step, at least in its general direction. It was, without doubt, in this manner the Buddhists who unoonsciously determined, partly the final constitution, and certainly the diffusion of Sanskrit. It was they who, little by little, introduced into wider circulation the habits of an orthography which was inspired by the labours and practice of the schoolmen. They followed on that track, though, it is true, with imperfections and shortcomings. By this slow and instinctive revelation, the secrets of the learned so to say, became public. All that remained for the Brahmans to do was to recover their vantage ground on the strength of their superior technical knowledge, to take the initiative again by teaching their learned language in its correctness, and to develop its public use, both oficial and literary. It was thus that the diffusion of Sanskrit
Page #266
--------------------------------------------------------------------------
________________ 250 THE INDIAN ANTIQUARY. [AUGUST, 1892. found itself secured. It suppressed the use of Mixed Sanskrit, after having, nevertheless, been one of its principal factors. Before, however, the latter disappeared from current use and from the monuments, it had already secured a future course for itself as a literary language. The very aspect of the Buddhist dialect of the Gathas," so nearly does it approach Classical Sanskrit, proves that it was first settled at a period close to the definitive domination of the latter. In this respect, the tradition which places the arrangement of the Canon of the Northern Buddhists in the time of Kanishka, agrees very well with the conclusions to which we have been led by epigraphy. Not, indeed, that we are to assume that all the works or fragments written in Mixed Sanskrit are necessarily so ancient as that; but that the fixing of this system of orthography and the application to literary use which assured it its survival, must be referred to that epoch, which marks, together with the diffusion of cli.ssical Sanskrit into general use, the hour in which Mixed Sanskrit, when on the eve of being absorbed into it, borrowed from it the largest proportion of learned elements. We thus see how, under the common, but on the one hand direct and on the other indirect, influence of an ancient religious language, there was produced in parallel lines, and not without reciprocal reactions, the two-fold development of Classical and of Mixed Sanskrit. Their final fusion, to the benefit of the classical language marks the hour of its definitive establishment, of the commencement of an undisputed supremacy which yet endurds. Thus is explained the apparently paradoxical formula within which we found ourselves shut up. The endless chain is broken. Mixed Sanskrit is, to speak exactly, neither a copy nor the source of regular Sanskrit, but is something of both. Classical Sanskrit, without enjoying a public and consecrated existence at the time when the early form of Mixed Sanskrit makes its appearance, nevertheless did exist in the close circle of the schools, in a stage of formation more or less advanced. It will be understood how the Vedic language could, without being written, exercise a profound action, and how the Brahmans, in spite of their distaste for writing, were led to fix and to put into circulation that great instrument of literary production in India, Sanskrit. This profane language did not compromise the privilege belonging to their religious language, of which they still remained the jealous guardians. MISCELLANEA. XOTES ON THE TRADITIONAL AND the Hova tribe in the Province of Imerina, in MYTHICAL MEN AND BEASTS OF THE which are the Highlands they now occupy. These MALAGASY. prople say that their forefathers came from someFrom the general appearance of the Malagasy, where unknown, and drove out a race of men called especially of the leading Hova tribe, and from the Vazimba, which, they say, is now extinct, their language, we can easily see that they are of but was a diminutive race, with the head small Malay extraction. Their numerals, for instance, in proportion to the body. The phrase Vazimba up to ten are identical; and it is a curious fact, loha (Vazimba-headed) is still occasionally used that in the Malagasy language we find words to express anything, such as a nail, that has an from almost all of the many different dialects unusually small head. But whether the tribe in spoken in the Malay islands of the Archipelago. question is extinct is a matter of doubt. A friend, However, in their customs, folklore and when exploring an unknown part of western religion the Malagasy have, I believe, but | Madagascar, came across people of a distinctly little in common with the Malays. I have negro type calling themselves Vazimbas,' and never heard of any tradition among the native of having, as aborigines, an hereditary right over the Madagascar as to their arrival in the island, and river traffic, albeit in subjection to the Beteiriry river traffic. albeit in subiection to they are entirely unconscious of any relationship tribe of the Sakalavas. They had not, however, to the Malays. as far as he noticed, anything peculiar in the forThere is, however, a tradition of the arrival of mation of the cranium. I may add, while speak. 1 They are not in any way a seafaring people, except Stanley, I think, mentions a tribe called Wasimba the Bakalava tribe on the west coast, and this tribe in Central Africa. Some derive the name from the is very much more akin to the Negro type than the Swahili word wasimu, an ogre or madman, others from Nalay. kuzimu, in the grave.
Page #267
--------------------------------------------------------------------------
________________ MISCELLANEA. AUGUST, 1992.] ing of the Betsiriry, that the same explorer saw one individual of a tribe of aboriginal dwarfs, who live in caves and are very shy, and speak a distinct language of their own; whereas all the other tribes in every part of Madagascar speak dialects of Malagasy. The Hovas greatly venerate the graves of the Vazimbas, and imagine that the spirits of these people, whom their fathers drove out, exert great power over the living. There are many such graves close to the Capital, to which offerings are constantly taken, and it is considered a heinous sin to desecrate, in any way, the places in which these spirits are supposed to dwell. The consequences can only be averted by superstitious rites entailing considerable trouble. The dwelling place of a spicit seems to be more or less arbitrarily chosen: sometimes it is an old tomb, sometimes it is a running brook, or a marsh in which the bararatra reed (Phragmites communis, Trin.) grows, sometimes it is a whole mountain on which it is wicked even to burn the grass in the manner customary with the Hovas. Consequently the touchy spirits are often unwittingly offended by some unfortunate stranger. Then again each, or almost each, spirit has his particular likings and aversions. Some like mutton, others cannot endure tobacco and onions; while all dislike pork. To make a wrong offering is quite enough to bring disease, if not death, to the offender. Great is the dread among the people of these spirits, and I remember a few young sceptics offering tobacco out of sheer bravado, to a spirit who disliked it, and so overwhelming was the fear of one of them, after he had committed the offence and the excitement had worn off, that he actually frightened himself into a serious illness. I must now pass on to a description of some of the mythical animals. First and most renowned is the Bongomby. This word is used figuratively by the natives to mean lion-hearted, showing the courage they suppose the animal to possess. It is said to be an animal somewhat resembling a horse, but with large, hanging ears, and a heavy mane: so large, in fact, are the ears that when the animal is running down hill they fall over its eyes and blind it. Hence the natives will tell you that in case you are pursued by a songomby your only chance is to run down hill! It is a most ferocious animal, having a predilection for young children, and hence many a poor little child is threatened with this awful beast, if it oversteps the patience of its parents. It is said to live in caves, but to be so wary that it is seldom seen and never captured. When horses were first introduced the natives thought them to be a kind of songomoy caught by the white men; and when 251 riding in outlying districts, where a horse had never been seen, I have often put a whole village to rout, for the sudden appearance of a white man, (never perhaps seen before,) riding a songomby was enough to strike terror into the boldest. I remember quite well one poor woman stealing back after a general stampede caused by myself to save her child, when my men stopped her and quieted her fears. After confidence was restored she confessed to having thought we should want a baby or two to feed the horse with. It often took one hour or more to gain the people's confidence. Next to the songomby is the Fananim-pitoloha, the Hvdra with seven heads. This is not an awe-inspiring reptile, as one might easily imagine; far from it, it is respected and venerated. It has its origin in man, and the spirit of the person from whom it springs is embodied in it. As a rule it springs from the entrails of the dead. Among the Betsileo tribe living to the South of the Hova Province of Imerina, it is said to be a common custom to take a portion of the entrails of a dead relation and place them near a running stream or pond, in order that a fananim may be generated and an embodiment of the spirit effected. If such should happen the hydra proceeds to the village, and those of the inhabitants, who have lost a relative, ask it who it is, by repeating the names of the departed. Should the fananim wave ita head sideways it is not the person named, but should it nod, there is a g. at rejoicing among the relations of the person named, and offerings are given daily to it. The appearance of the fananim is variously described, but the most authentic accounts state it to be striped, and of a dull brown colour, with seven heads. When it has reached maturity horns grow on each head. There are many curious fables about this hydra. Here is one. Once upon a time one attacked a bull, but the seven horns being broken, for it butted and did not bite as one might suppose, it was despatched by the bull. This took place near a village, and next day the fananim had swollen to such an extent, that it was like a mountain overshadowing the houses, so that the inhabitants had to flee the place during its putrefaction. Sometimes we are told they grow so large that they can span a mountain at its base, but as soon as the tail overlaps their heads they bite off the extra piece, and, fixing the stump firmly in the earth, rear themselves up on it and shoot into heaven! ( am assured that the reason so few are seen with seven heads at the present day is that they are all young, and that it takes many years before they gain their full complement.
Page #268
--------------------------------------------------------------------------
________________ 252 THE INDIAN ANTIQUARY. (AUGUST, 1892. Another mythical animal is the tokan-dia," run away. Its eyes become red like fire, and its the single step. This is a large white animal nails long as talons. It loses all likeness to the with one leg in the middle of its body and one in living, except ite human form. It is harmless from its chest, and although only gifted with these want of strength, only prowling about and stealing two legs, it travels at the most extraordinary such food as it can lay its hands on. This is speed. It eats men, and is, but seldom, if ever, a Betsileo superstition, and it is said that some seen now! people leave their tombs open, so as to allow their Then there is the most uncanny of all the relatives the chanoe of becoming kinolios. fabulous beings, the kinoly. It is a supposed Suoh are the chief myths among the natives resurrection of the body after partial decom- of Madagascar. I have heard also of a few others position. Should a tomb - the natives always of unicorns and mermen, whose distinctive feature bury in large vaults in Imerina and Betsileo - is, curiously, their long hair, and of a hairy tribe be opened as soon as the bowels and skin of a of dwarfs that live in trees. oorpse have become putrid, the corpse is said to C. P. Cory. NOTES AND QUERIES. SUPERSTITIONS IN MADRAS. phemisms have generally arisen from an under. It is a superstitious belief in Southern India that current of superstition that it is unlucky to use we should not eat at evening twilight, as it unpleasant expressions, a belief which has univeris said that the Asurns of the infernal regions sally prevailed at all times. E.g., the express wander over this world at that time, and when I asi on taking leave means 'let me go,' and is food is served they will come in and partake of it, never understood in its real sense of 'let me leaving for us mortals only the remainder of come. The reply is invariably e88,' or politely what they have eaten. astvin' which means you may go,' while their real sense'is you may oome.' If a person dies in the house on an unpropitious day, the house is shut up for six months GAURDAS BYSACK. Calcutta. continuously. After the expiration of this period, the usual ceremonies for cleansing the house must be performed, and then it becomes habitable. ORIGIN OF ALOMPRA. Don't shave during July, August, (Adi); The story that Alompra (Alaungp'ay) was a September, October, (Purattasi); December, hunter, as stated by most European historians of January (Margazhi); February, March (Mdai); Burma is a pare myth. He belonged to a resSunday, Tuesday or Saturday. pectable well-to-do family, and to a class, which If you anoint your body with oil or bathe would be called the landed gentry in England. in hot water on Sunday you will get heart The very fact of his being ablo, in a short time. disease, on Monday health, on Tuesday death, to rally round himself a large following, and of on Wednesday gain, on Thursday loss of a child, his possessing the respect and confidence of his on Friday loss of money, on Saturday increase adherents, proves the unsubstantial basis of the of age. K. SRIKANTALIYAR. story. For in Burma, from time immemorial, Ootacamund. the hunter and the fisherman has always been looked down on, and treated as an outcast, beyond EUPHEMISMS IN BENGAL. the pale of refined society. Had Alompra been a In colloquial Bengali euphemisms are hunter his assumption of leadership would not have been tolerated by his followers. common with a view to avoiding the use of expressions of unpleasant import. Such eu TAW SEIN Ko. 1 I have often wondered if this is the last tradition of the huge extinct bird of Madagascar, apyornis matimus. * See Phayre, Hist. of Burma, p. 150 ff. 4 [Phayre, History of Burma, loc. cit., says in effect that Alompra was originally "hunter captain," who, on succeeding against the Talaings, claimed royal des cent. There were many instances of sham 'princes' amongst dacoit leaders (608) from 1885 to 1890 against the English. One was whilom a schoolmaster of the Ednca tional Department in Lower Burma. There is in fact much to be said both for Phayre's view and for Taw Sein Ko's. No doubt future search will settle the point. -Ed.)
Page #269
--------------------------------------------------------------------------
________________ SYSTEM OF TRANSLITERATION The system of transliteration followed in this Journal for Sanskrit and Kanarese, (and, for the sake of uniformity, submitted for adoption, as far as possible, in the case of other languages),- except in respect of modern Hindu personal names, in which absolute purism is undesirable, and in respect cf a few Anglicised corruptions of names of places, sanctioned by long usage, - is this :Sanskrit. Kanarese. Transliteration. Sanskrit. Kanarese. Transliteration. Ja A 9 o jha tha 3 S tha Etualal 3 sold & 122 X 3 3 3 da dha na ra Visarga pla ba bha ma Visarga Jihvamiltya, or old Visarga before and s Upadhaniya, or old Visarga be fore and 5 Annisvara Anunasika Anusvara & ces & kha 449 AM al al ga gha in clin chha ha A single hyphen is nsed to separate words in composition, as far as it is desirable to divide them. It will readily be seen where the single hyphen is only used in the ordinary way, at the end of a line, as divided in the original Text, to indicate that the word runs on into the next line; intermediate divisions, rendered unavoidable here and there by printing necessities, are made only where absolutely necessary for neatness in the arrangement of the Texts. A double hyphen is used to separate words in a sentence, which in the original are written as one word, being joined together by the euphonic rules of saridhi. Where this double hyphen is used, it is to be understood that a final consonant, and the following initial vowel or consonant-and-vowel, are in the original expressed by one complex sign. Where it is not used, it is to be understood of the orthography of the original, that, according to the stage of the alphabet, the final consonant either has the modified broken form, which, in the oldest stages of the alphabet, was used to indicate a consonant with no vowel attached to it. or has the distinct sig that the following initial vowel or consonant has its full initial form. In the transcription of ordinary texts, the double hyphen is probably unnecessary; except where there is the samdhi of final and imtial vowels. But, in the transcription of epigraphical records, the use of this sign is unavoidable, for the purpose of indicating exactly the palaeographical standard of the original texts. The avagraha, or sign which indicates the elision of an initial a, is but rarely to be met with in inscriptions. Where it does occnr, it is most conveniently represented by its own Devanagari sign. So also practice has shewn that it is more convenient to use the ordinary Devanagari marks of punctuation than to substitute the English signs for them. Ordinary brackets are used for corrections and doubtful points; and square brackets, for letters which are much damaged and nearly illegible in the original, or which, being wholly illegible, can be supplied with certainty. An asterisk attached to letters or marks of punctuation in square brackets, indicates that those letters or marks of pt that those letters or marks of punctuation were omitted altogether in the original, As a rule, it is more convenient to use the brackets than to have recourse to footnotes; as the points to which attention is to be drawn attract notice far more readily. But notes are given instead, when there would be so many brackets, close together, as to encumber the text and render it inconvenient to read. When any letters in the original are wholly ill re wholly illegible and cannot be supplied, they are represented, in metrical passages, by the sign for a long or a short syllable, as the case may be ; and in prose passages, by points, at the rate, usually, of two for each akshara or syllable.
Page #270
--------------------------------------------------------------------------
Page #271
--------------------------------------------------------------------------
________________ SEPTEMBER, 1892.) MUNGIR GRANT OF DEVAPALADEVA. 253 THE MUNGIR COPPER-PLATE GRANT OF DEV APALADEVA. BY PROFESSOR F. KIELHORN, C.I.E.; GOTTINGEN. THE plate containing this inscription - so far as I know, the first Sanskrit inscription that I was ever brought to the notice of European scholars - was found about 1780 by Colonel Watson' at Mungir, the chief town of the Mungir District of the Bengal Province, on the south bank of the Ganges. The inscription was translated by Charles Wilkins in 1781, and his translation was published, with a few notes by Sir W. Jones and a lithographed facsimiles (but without a transcript) of the original text, in 1788, in the Asiatic Researches, Vol. I. pp. 123-130 and 142. The plate having been lost, I now venture to edit the inscription from the published lithograph, which, with all its defects, is by no means so valueless as may appear to be the case, at first sight. The plate was a single one. Judging from the lithograph, it was surmounted by an ornament, fixed on the upper part, and advanced some distance on the plate so as to occasion a break in the upper lines. As in the case e.g. of the Dinajpur plate of Mahipaladeva, this ornament in all probability contained a seal, across which were engraved the words ari-Devapaladevasya which in the lithograph are put at the top. The plate itself contained 52 lines of writing, 36 of which were on the front and 16 on the back of the plate. The writing was well preserved throughout. The characters clearly were of the same type as those of the Badal pillar inscription and of the Dinajpur plate. Thus, to mention a characteristic feature of this alphabet, there can be no doubt that the letter t, preceding another consonant, was ordinarily denoted by a short line, sideways attached to the right side of the akshara of which forms part. By the lithographer this short line has been altogether overlooked, and accordingly tho letter ris omitted in the lithograph about twenty-five times. Similarly, the peculiar way in which medial d, e, ai, 6 and au were written in the original plate, has often caused the engraver of the lithograph to omit the signs for the medial a and e, and to put a, e and o in the place of o, ai and au. The sign of the avagraha was exceptionally employed in the original in murtta s thava, in line 16, and 5 kinchitpragrahyo, in line 40. The language is Sanskrit. Excepting the introductory om svasli, the inscription is in verse down to the commencement of line 24. Lines 24-46, containing the formal part of the grant, are in prose; they are followed, in lines 46-50, by four of the customary benedictive and imprecatory verses; and the inscription closes with another veree, in lines 50-52, which gives the name of the dittaka of this grant. The inscription was written and engraved with great care, and in regard to orthography I need only state here that 6 throughout is denoted by the sign for v, and that instead of anusvara the guttural nasal has been employed in the word (va*]nsa, in line 50. In writing out my text, I have not considered it necessary to record all the very numerous minor errors and omissions of the lithograph. The only passages about which I am at all doubtful, and in which the rediscovery of the plate may prove me to have gone wrong, are the words suvinayinam, in line 5, rajakuliya-samasta., in line 40, and kara-hirany, in line 45. For the rest, my text will, I trast, speak for itself. The inscription is one of the devout worshipper of Sugata, or Buddha, the Paramesvara, Faramabhattaraka and Maharajadhiraja, the illustrious Devapaladove, who meditated on the feet of the devout worshipper of Sagata, the Paramesvara, Paramabhalldraka and Mahardjadhi. 1 See Asiatic Researches, Vol. I. p. 132. . The statement of the late Dr. Rojendrall Mitra (Indo-Aryans, Vol. II. p. 219), that the translation was published without any facsimile, is of course incorrect. In the lithograph it is often quite impossible to distinguish between P, m, and y, or even 8. D is engraved instead of n, orm, or y, or v; d4 instead of ; nd instead of nt, or ndh, ornn; bh instead of s; y instead of chy, or dy, or sy: v instead of ch, or #, Or T, QE rth. The signs of the original for ksh and d are aruwn quite wrongly. And the signs of an usvara and visarga, and those of the subscript u, ri, and r, are often omitted. But it is one great advantage that the lithograph was prepared by an artist who did not understand the language of the original,
Page #272
--------------------------------------------------------------------------
________________ 254 THE INDIAN ANTIQUARY. [SEPTEMBER, 1892. raja, the illustrious Dharmapaladeva (lines 28-29). After the words osi svasti and a verse in honour of both Buddha and the ruling king, it gives (in lines 4-24), in thirteen verses of which a full translation will be given below, the genealogy of Devapaladova. All we learn from this part of the inscription is, thut Devapala was the son and successor of the king Dharmapala and his wife Rannadovi, who was a daughter of the illustrious Parabala of the Rashtrakuta family, and that Dharmapala aguin was the son and successor of the king Gopala. Devapala, as well as his father and grandfather, are eulogized as very powerful monarchs, who each of them are represented as baving conquered almost the whole of India. I have already had occasion to state that in later inscriptions of the same dynasty Devapala is described as the brother's son of Dharmapala, and that I would identify his father-in-law Parabala with the Rashtrakuta Govinda III, also called 'Srivallabha (or 'Sriballaha), etc., but I must add here that my chief reason for proposing this identification is the circumstance that we know Govinda III to have ruled at the beginning of the 9th century A. D., and that this would be about the time when Dharmapala's father Gopala may be supposed to have lived. The wording of the formal part of the grant (lines 24-46) is much the same as in the three other known copper-plate grants of the so-called Pala kings. As regards the object of the grant, Devapaladova, from his camp at Mudgagiri on the Ganges, informs his officials and the people concerned that he has given the village of Meshika, which was in the Krimila riskaya of the Srinagara bhukti, to the bha!!a Vibekaratamiara, a son of the bhafta Srivara harata and son's son of the bhatta Visvarata, of the Aupamanyava gotra and Asvalayana sakha; and he orders the people to make over to the donee wbatever may be due to him in accordance with this donation. Among the numerous officials, enumerated in this part of the grant, two occur who are not mentioned in the other Pala grants, the pramatri and sarabhanga (in line 32). I am unable to explain these terms, and can only state that the same officials are mentioned, nnder the names of pramatara (or perhaps maharajaprandtara) and sarabhanga, in line 11 of the Pandukesvar grant of Lalitasuradeva, published in the Proceedings, Bengal As. Soc., 1877, p. 73; und that we find prametri in Epigraphia Indica, Vol. I. p. 88, 1. 49, p. 115, 1. 32; pramatara, ib. p. 72, 1. 9; and mahapramdtara, ib. p. 73, 1. 17. The formal part of the grant closes (in line 46) with the date, the 21st day of the month Margasira of the year 33. Lines 46-50 contain, as already stated, four of the usual benedictive and imprecatory verses. And these are followed (in lines 50-52) by another verse which will he translated below, according to which the king had appointed, as dutaka of this grant, his own son, the Yuvaraja, the illustrious Rajyapala. The year 33 of the date must of course be referred to the king's reign, which I agree with Sir A. Cunningham in assigning to about the end of the 9th century A. D. Of the localities mentioned in this inscription Mudgagiri and Srinagara have already by Sir Charles Wilkins been identified with the modern Mungir and Patna respectively. The Krimila vishaya and the village of Meshika I am unable to identify. TEXT.5 First Side. 1 Om svasti | Siddharthasya? para[rtha)-susthira. 2 matol saumargam-abhyasyat asosiddhis-siddhim-a3 nattaram=bhagavatas tasya praja su kriyat | yasetraidbatuka sat[t]va-siddhi-padavire atyugra-viry-dayaj-jitva nirvsiti. 4 m-asasada sugatah sarvvartha-bhumisvarah 11 Saubhagyano-dadhad-atulam briyas= sapatnya Gopalah patir=abhavad-vasu * See above, p. 99. * Expressed by a symbol. & From the lithograph in Asiatic Researches, Vol. I, p. 123. * Metre, Bardulavikridita, * Metre, Praharshini.
Page #273
--------------------------------------------------------------------------
________________ SEPTEMBER, 1892.] MUNGIR GRANT OF DEVAPALADEVA. 255 5 ndharayal drishtunte [suvinayinam] surajoi yasmin-sraddheyal Prithu-Sagara[dayo]-py-abhuvan 1 Vijityalo yen-u jaladher-vasundha 6 ram vimochitan mogha-parigraha iti I savashpam-udvashpa-vilochanan=punarvvaneshu va(ba)ndhun-dadri[su]r-mmatangajah Cha 7 latav ananteshu va(ba)leshu yasya visvambharaya nichitam rajobhih padaprachara-kshamam-antariksham1-vihangamanam suchiram-va(ba)bhuva II 8 Sastrartha1-bhaja chalato-nusasyal varnuan-pratishthapayata sva-dharmme sri Dharmmapalena sutena so-bhut-svarga-sthitanam-anrinah 9 pitrinam Achalairl-iva janga mair-yadiyair-vichaladbhir dviradaih kadarthyamaua | nirupaplavam-amva(mba)ram prapede en 10 ragam renu-nibhena bhuta-dhatri II Kederele vidhin-opayukta-payasam Gangasamet-amvu(mbu)dhau Gokarnn-adishu ch-upy-anu sukham=eva yasya Tair-tair-digvijay-avasina 11 shthitavatam tirtheshu dharmmyal kriyah bhrityanam sakalan-uddhritya dushtan-iman17 lokan sa 12 dhayato-nushanga-janita siddhil paratr-apy-abhut 1 samaye samprezhitanam-paraih sa 13 tkarair-apaniya khedam-akhilam SVAM svan=gatinam bhuvam bhavayatam yadiyam-uchitam pritya nripanam-abhut-so14 tkantham hridayam divas-chyutavatam jatismaranam-iva Sri-Parava(ba)lasya duhituh kshitipatina Rashtrakuta-tilakasya 15 Bannadevyah panir-jagrihe grihamedhina tena II Dhrita-tanur1-iyam Lakshmih sakshat-kshitir-nu saririni kim-avani-pateh suchy-achara vitarkavatih 16 kirttir murtta sthava grihadevata iti vidadhati praja[b]20 prakriti-gurubhir-ya suddhantam gunai17 r-akarod-adhah Slaghya pativrat=asau makta-ratnam ari-Devapaladevam prasanna-vaktram sutam=asuta || 18 Nirmmalo manasi vachi samyatah kaya-karmmani cha yah sthitah suchau samudra-suktir=iva I rajyam pa nirupaplavam piturwvo(b)dhisattva iva 19 saugatam padam Bhramyadbhir 3-vijaya-kramena karibhi[b sva]m-va Vindhyatavim-uddama-plavamina-vashpa-payaso drishtah punar-va(ba)ndha 20 vih Kamvo(mbo)jeshu cha yasya vaji-yavabhir-dhvast-anyaraj-aujaso hesha-misritahari-heshita-ravah kantaa-chiram vikshitah || 21 Yah purvvam-Va(ba)lina kritah krita-yuge yen-agamad-Bhargavas tretayam prahatah priya-pranayina Karnnena yo dvapare vichchhinnah kali22 na Sakadvishi gate kalena lokantaram yena tyaga-pathah sa eva hi punarvispashtam-unmilitah Ass Gang-agama-mahita 23 t-sapatna-sunyam-a se [to]26 prathita-Dasasyaketu-kirtteh | urvim-a Varuna-nike[to]nach cha sindhora Lakshmi-kulabhavanach-cha yo 24 vu(bu)bhoja II Sa khalu Bhagirathi-patha-pravartta mana-nanavidha-nauvataka-sampadita-setava(ba)ndha-[ni]hita-saila-sikhara-are 25 pi-vibhraman = niratisaya - ghana - ghanaghana - ghatta(ta) - ayamayamana - vasaralakshmisamaravdha(bdha)-santata-jaladasamaya-sa krityam * What the lithograph actually has, is sadinatinam; but the second akshara, di, is very oddly shaped. The English translation has by comparison of the learned.' 10 Metre, Vareastha. 11 Metre, Upajati. 12 Read "ksham. 18 Metre, Indravajra. 14 The lithograph apparently has sye. 16 Metre, Aupachchhandasika. 17 Read imarllo. 16 Metre, Sardalavikrijita; and of the next verse. 18 Metre, Arya. 10 Metre, Harini. 2 Metre, Rathoddhata. 1 Metre, Arya. The lithograph omits the visarga. 23 Metre, Bardalavikridita; and of the next verse. 24 In the lithograph there is no visarga, and the syllable, here read sud, looks rather like pra or mra. 25 Metre, Ratthoddhata. The lithograph apparently has setu (or bhetu). 27 The lithograph has nikinachcha (or vikenachcha).
Page #274
--------------------------------------------------------------------------
________________ 256 THE INDIAN ANTIQUARY. SEPTEMBER, 1892 26 ndenat 28 udichin-aneka-narapati-prabh sitikrit-aprameya-haya-vahini-khara-khur-otkhata dhuli-dhusarita-di27 gantaralat 129 paramesvara-seve-samayat-asesha-Jamva(mbu)dvipa-bh u pala-padata-bhara namad-avaneh 130 sri-Mudgagiri-samava29 sita-srimaj-jayas kandhavarat paramasaugata- paramesvara - paramabhattaraka - maharaja - dhiraja-sri-Dharmapaladeva29 padanudhyatah paramasaugatah parameavara[h] paramabhatarako maharajadhi rajah sriman=Devapaladeva[h]kusali 30 Srinagara-bhuktan Krimildvishay-antahpati - svasamva(mba)ddhavichchhinna-talopeta - M&shikagrame samupagata31 n saruvan=eva ranaka-1 rajaputra-l amatya-l mahikarttakritika-I mahadandanayaka-1 mahapratihara-I mahas32 manta- mahadauhsadhasad hanika- mahakumaramatya- pramati- sarabhaiga-1 rajasthaniya- uparika. dasa33 paradhika- chauroddharanika-1 dandika-1 dandapasika-1 saulkika gaulmika [ksh]trapa-l printa pala- kottapala-(0) 34 khandara[ksha)- tadayaktaka-I viniyuktaka-1 hasty-asv-8shtra-va(ba)la-vyi pritaka- [1] kisora-va[da]va-go-mahishy-aj-avik-adhyaksha-l dutapraishani. 35 ka-l gamigamika- abhitvaramana-vishayapati-l tarapati-l tarika-1 Ganda-MAlavn Khasa-HOna-Kulika-Karnnata-La[ta-cha]ta-bhata36 sevak-adin anyars-ch-Akirttitin sva-padapadm-opajivinali prativasinas-cha vra(bra)hman. Ottaran mahattara-kutumvi(mnbi)-paroga-med-& Second Side. 37 ndhraka32.chandila-paryantan [ra]majna payati [*] Viditam - 38 sta bhavatam yath=oparilikhita-Meshikagramah sva-si39 ma-trina-yuti-gochara-paryantah satalah soddesah samramadhukah sajalasthalah samatsyah satrinah soparikarah sadas40 paradhah sachauroddharanah parihsita-sarv vapidah 33 achatabhata-pravesa Ski rohitpragra byo rajakuliya-(samasta-pratyaya-same. 41 to bhQmichchhidra-nyayeama-chandr-frka-kshiti-samakalah purva-datta-bhukta-bhujya mana-deva-vra (bra)hma-deya-varjito maya ma ta-pitror=itmanas=cha pu42 nya-yaso.bhivsiddhaye vedartha-vido yajvano bhatta-Visvaratasya pautraya vidy Avadata-chetasd bhatta-'Srivaraharatasya putriya 135 43 pada-vakya-pramana-vidya-param gataya 136 Aupamanyava-sagotraya 137 Aslayana savra(bra)hmacharine bhatta-pravara-Vi[he karata-misraya 44 basaniksitya pratipaditah [1] Yato bhavadbhih sarvvair-eva bhumerdina-phala gauravada paharane mahanaraka-pata-bhayach=cha danam=i. 45 dam=animodya palaniyam prativasibbilkshetrakarais-ch-ajna-bravana-vid heyair bhutva samu(chijta38 (kara-hirany]30-adey-adi-sarvva-pratyay-pana46 yah karya iti * Samva+40 33 Marga-dine 21 Tath cha dharmanuaasanas. slokal, Sarvan tan bhavinah parthivendran 26 Read -had-udt. 20 Read "latpara. * This sign of punctuation is superfluous. The lithograph omits these signs of visarga. 31 The published text of the Bhagalpur plate of Nar yanapala has medandha; but the original plate has medandhra. 83 Read opido-chata. ** I am doubtful about this word. What the lithograph has may possibly be intended for paryanta. 36 This sign of punctuation is superfluous. 88 Read gatay-Aupa. 37 Read trdy-Asvaldyana.. The lithograph actually has so muchata. * The words in those brackets are, I believe, certain; but the lithographa gives kamakaran. ** Read sarwat. 41 Probably, the reading intondod was dsinah. The lithograph notually has sasana. 12 Metre, Selini.
Page #275
--------------------------------------------------------------------------
________________ SEPTEMBER, 1892.] MUNGIR GRANT OF DEVAPALADEVA 257 47 bhyo bhuyah prarthayaty-esha Ramah samanyo=yam dharma-seturentipanam kald kale palaniyah kramenah | Va(tu)hubhirvasudha 48 datta rajabhih Sagar-adibhih [i*] yasya yasya yadan bhamihte tasya tasya tada phalam il Sva-dattam-para-dattam=va7 yo hareta vasu. 49 ndharam [*] sa vishthayam krimir=bhutva pitsibhis-saha pachyata [11*] Iti49 kamala-dal-imvu(mbu) vindu-lolam 50 sriyam-anuchintya manushya50 jivitan=cha sakalam-idam=udaheitan=cha vu(buddhva na hi purusbaih para karttayo vilopya[h] # 'Sreye-vidha y52--ubhaya-(va*]osa63.vi. 51 suddhi-bhajam raj=ikared=adhigatatma-gunam gana-joahi atm-knurupa charitam sthira yanvarajyam sri-Rajyapalam=i. 52 ha dutakam=atma-putram TRANSLATION OF LINES 1-24 AND 50-52. Om! May it be well! May the perfection of that venerable being, whose objects are accomplished, whose mind is steadfast in the cause of others, and who is ever treading the path of virtue, procure for his people unsurpassed perfection, that being who, a Sugata54 and in all things a lord of the earth, having excelled the ways of perfection of the creatures of the three worlds by the display of his awful might, has attained unto bliss ! (Line 4.) Possessed of matchless prosperity, Gopala was the husband of Fortune as well as the lord of the earth. While he, the type of a well conducted (king), carried on his beneficent rule, even (kings) like Prithu and Sagara came to be believed in. When he had conquered the earth as far as the sea, he set free his elephants, regarding them a useless train; and they with tears (of joy) saw again in the forests their kindred whose eyes became filled with tears. When his innumerable forces were marching, the sky continually was so filled with the dust of the earth that the birds of the air could walk upon it. (L. 8.) He paid his debt to his forefathers in heaven by begetting the illustrious Dharmapala, who, conversant with the precepts of the Sastras, by restraining those who swerved from the right course, made the castes conform to their proper tenets. By the elephants of this prince, who were moving about like walking mountains, the earth was so tormented that, in the guise of the dust, it took refuge in the peaceful heavens. With ease uprooting all the wicked and subduing this world, he at the same time secured for his followers the blessings of the world to come ; for (on his expeditions) they bathed according to precept at Kedara (and)56 where the ocean is joined by the Ganges, and performed holy rites at Gokarna and other sacred shrines, When he had completed the conquest of the regions, he released the princes (ichom he had made captive); and they, made to forget all their distress by the various great honours shown to them, and having each returned to his own country, pondered upon his generous deeds, and 48 Read nripandu. + Read kramena. 6 Metre, Sloka (Anushtubh); and of the next verse. +6 Read bhamis-tasya. 7 Read - dattoris vi. Read pachyata. 49 Metre, Pashpitagra. 60 Read .25141f sriyam. 61 The lithograph omits this visarga. 52 Metre, Vasantatilaka " Read -vamia- 64.e. either a Buddha or, applied to the king, a follower of Buddha, a Buddhist. For, like the verse at the commencement of the Dinajpur, Bhagalpur, and Amgachhi plates, this verse is applicable both to the founder of the Buddhist religion (Siddhartha, Sugata, Sarvarthasiddhi) and to the king, in this case Devapaladiva, who issued this grant. 65 Literally, 'Gopala was a lord of the Earth who was the fellow-wife of the goddess of fortune.' 56 It appears necessary to add this particle, because, so far as I know, there is only one kiira, which is situated in the Himalaya mountains. Gokarna is in the North Kanara District of the Bombay Presidency; it is even now a place of pilgrimage frequented by Hindu devotees from all parts of India.
Page #276
--------------------------------------------------------------------------
________________ 258 THE INDIAN ANTIQUARY. (SEPTEMBER, 1892. their hearts were fondly longing for him, as of mortals banished from heaven who remember their former existence. (L. 14.) As a householder, that lord of the earth took the hand of Bannadevi, the daughter of the illustrious Parabala, the ornament of the Rashtrakata family. By the purity of her conduct causing the people to deliberate as to whether she might be Lakshmi incarnate, or the earth embodied in human form, or the king's fame in visible shape, or his household goddess, she surpassed the ladies of the court by the excellent qualities with which nature had endowed her. As the shell of the sea yields the precious pearl, so that praise-worthy husband-devoted lady bore a son with a pleasing countenance, the illustrious Dovapaladdva. (L. 18.) Unsullied in thonght, controlling his speech, and steadfast in the performance of blameless actions, he inherited the kingdom of his father free from troubles, as a Bodhisattva attains the status of a Buddha. In the course of conquest his elephants, roaming over their own Vindhya forest, met again with their kindred who shed plentiful tears (of joy); and, after he had crashed the power of other kings, his young chargers in Kamboja at last saw their mates, and it was a pleasure to hear them loudly neigh at each other. He indeed has again clearly opened that road of liberality which was first made by Bali in the Krita age, on which Bhrigu's descendant walked in the Treta age, and which was trodden by Karna, dovoted to his friends, in the Dva para age, but which had been choked up by the Kali age, ever since the enemy67 of the 'Saka went to heaven. He has ruled the earth, free from rivals, ap to the mountain) celebrated for Ganga's descent, as far as the bridge which proclaims the fame of Ravana's foe, as far as the ocean which is Varuna's home, and as far as that other ocean which 18) Lakshmi's birthplace. . (L. 50.) The king, who knows how to appreciate excellent qualities, has made his son, the illustrious Bajyapala, who is of pure descent on both sides, who has acquired the excellent qualities of his parent and whose conduct resembles his, and who is firmly appointed as Yuvaraja, the ditaka for this deed of merit. THE INSCRIPTIONS OF PIYADASI. BY E. SENART, MEMBRE DE L'INSTITUT DE FRANCE. Translated by G. A. Grierson, B.O.S , and revised by the Author. (Concluded from page 156.) PART III. MONUMENTAL AND LITERARY PRAKRIT. In the period which extends from the 2nd century before our era to the 3rd century A. D., all the inscriptions which are not in Sanskrit or in Mixed Sanskrit are couched in a dialect which may be designated by the name of Monumental Prakrit. In all the places where it is found it is essentially identical. This does not mean that the monuments present no inconsistencies between themselves. These inconsistencies and irregularities are many, and as they are also instructive, it is worth the trouble of quoting a certain number of them. They are of two kinds. On the one hand, the writing varies for the same words or for identical sounds; and, on the other, forms unequally altered, 61 .. the kreut kiny Vikramidity:, tho roputod destroyer of the tyrant Baka. See ante, Vol. XIX. p. 261.
Page #277
--------------------------------------------------------------------------
________________ SEPTEMBER, 1892.] THE INSCRIPTIONS OF PIYADASI. 259 and, consequently, belonging to different linguistic strata, are found in justa position on the same monuments or on monuments of the same date. In the first category, the most general fact is the inconsistency with which the dental n and the cerebral are employed. Sometimes one or other is introduced indifferently into the same word, or they are even applied in a manner contrary to every known rule; and sometimes one or other is exclusively used. This cannot be a question of dialectic divergencies, for instances occur in contemporary and neighbouring monuments. I quote a few examples! Nas. 11 A; anapayati and dnata : the same in Nas. 15. C.T.I., p. 33, No. 13: nadiya, yapanatha. Nas. 22: senapati. Kanh. 15 : dnanda, apano. C.T.I., p. 46, No. 14: udeseta ; p. 55, No. 33: yavana, bhojana; p. 44, No. 8: bhatunas, dana ; p. 42, No. 2: bena janana; p. 30, No. 6: dhenukakatakena ; p. 6, No. 5: bhagineyiya. Kaph. 28: bodhikana, paniya, sainghanan, dina. Kayh. 15: ana[t]dena, sanghena, &c. Nas. 12., Kanh. 10., C. T. I., p. 38, No. 2; p. 18, No. 25, &c., use exclusively n: C.T.I., p. 44, No. 9; p. 9, No. 9: Amravati, No. 175, &c., use exclusively the dental n. Inconsistencies of orthography are manifested in an infinity of other cases. Take the weakening of hard consonants into soft ones ; sugha, Karli, 22; Kanh. 15, 28, &c.; mugha C. T. I., p. 29, No. 4, No. 6, beside sukha, pamukha (e. g. Amrav. No. 196); kuduribini, Kanh. 15, Nas. 8-9, C.T.I., p. 38, No. 2, &c., beside kutumbini (e. g. Kauh. 4); dhenukakada, C.T.I., p. 38, No. 2, beside dhenukakala, C. T. I., p. 24, No. 4; p. 31, No. 7; thuba, Kanh. 10 (of the time of Vasithipata Palamayi), beside thupa, O. T. I., p. 24, No. 3; p. 26, No. 1. The inscription of Madhariputa (C. T. I, p. 60, No. 2) gives patithapita, while elsewbere, as for example Amr. 8 (pp. 52-53), we find patithavita, and again elsewhere the spellings padithapita (Kanh. 15), padidatava (Nas. 7, time of Nahapana), patiasiya (Kaph. 4) and padiasitava (Kanh. 16-18), of the time of Siriyana Satakani, paithana (Kaqh. 5) in an inscription of earlier date. Of two monuments of Gotamipata Satakaai, one (Nas. 11 A) has Sadakani, the other Satakani. C.T.I., p. 15, No. 19 has sadak[elra, while p. 4, No. 1 and p. 9, No. 9, which belong to exactly the same date, have sudageri. Sometimes the alteration is still more complete such as in goyama equivalent to gautama (mi), O.T. I., p. 15, No. 160. In several instances the suffix ka is changed into ya ; C.T.I., p. 49, No. 20 presents to us, side by side, bharukachhakanann and langudiyanari for larkutikanain; in Karli, 22, we read mahasainghiyanari in a passage dating from the 24th year of Pulumayi, and which retains several genitives in asya, beside the Prakrit form in asa. It is true that, at about the same period, the Wardak vase presents the intermediate form mahasainghiganan; and that, at Kapheri, Nos. 12 and 20 have, at the same epoch, the spellings Sopdrayaka and Sopdraga respectively. As a general rule, it is the soft consonants of Sanskrit which thus disappear or which leave y as the only trace behind them : payuna (Nas. 7, an inscription of the time of Nahapana) and pauna (C. T. I, p. 47, No. 6) equivalent to padona ; bhayarita, C. T. I. p. 18, No. 25; p. 24, No. 4; p. 50, No. 22, &c., or bhaanta, C. T. I, p. 24, No. 3, beside bhadainta ; siaguta, C. T. I, p. 38, No. 2, beside sivabhutimhd, p. 9, No. 9; pdvayitika, C. T. I., p. 6, No. 5, or pavaita, p. 6, No. 5; p. 37, Nos. 21, 22; Kanh, 21, 28, &c., beside pavajita ; bhoja, C. T. I., p. 14, No. 17; p. 4, No. 1; p. 9, No. 9, beside bhoya, in an inscription emanating from the same family (p. 15, No. 19), bhoa (p. 2, No. 9), bhoigiya, (Kanh. 24, earlier than Gotamiputa Satakaoi), and even mahd)bhuviya (C. T. I., p. 100). It is clear that, when y is introduced, it is done in a very arbitrary fashion. It is also on several occasions omitted. In an inscription, No. 21, of Kanheri, beside bhayanta, theriya, &c., we find pavaitikka ponakaa sanaa, and chiarika beside chivarika of the preceding numbers which are exactly contemporary. V and y are here subjected to the same treatment, and we, therefore, need not 1 I quote in general Cave Temple Inscriptions according to number and page in the collection of Messrs. Burgess and Bhagwanlal. For N Asik, I follow the numbers given in the Arch. Suru. IV, 98, &c. For Kanberi, the numbers of the order in the same collection, V. pp. 74 and ff.
Page #278
--------------------------------------------------------------------------
________________ THE INDIAN ANTIQUARY. [SEPTEMBER, 1892. be surprised at sporadic instances of orthography such as purisadatava (Nas. 24), bhayava velidatava and uyaraka (C. T. I., p. 17, No. 23), beside the usual ovaraka, and the terminations in aya. So, also, we find in the inscriptions of the north, side by side, samvatsaraye, athasatatimae, tachhasilaye, puyae (Taxila), &c. We find kaliana (Kanh. 13, 24, &c.) as well as kaliyana and pulumai, pulumayi, and pulumavi (Nas. 12, 13, 15); dhutua, mutua (Kaph. 27) beside dhutuya, matuya, &c.; ya and ja are used indifferently the one for the other, when it is necessary to represent an etymologicalj: on the Wardak vase we read puyae, beside raja, at Taxila, raya beside puyae, and, to confine ourselves to the cave inscriptions, Kaph. 18 reads puyatha[m], C. T. I., p. 16, No. 20, vaniyiyasa, Amr. 26 B, vuniyasa; while on the other hand, beside the usual bhaya (equivalent to bharyd), we have bhajaya, Kanh. 19, bharijaye, Nas. 11 B. 260 Inversely, a hard consonant is sometimes substituted for a soft one. For example, nekama, beside neguma (C. T. I., p. 60, No. 2), nakanaka (Kanh. 2), nakanika (Amr. 121), nakachanda (Amr. 56), in the frequently occurring ma[m]tapa, beside mandapa and mamdava; Kanh. 16 reads bhaka for bhaga; Amr. 222, legaticha equivalent to lekaditya, and bhagapato for bhagavato. Although the palatal nasal n is not unknown, its use is very irregular. Karli 20 has and equivalent to anyah; Kanh. 5, anani, Kanh. 27, punam equivalent to punyam and nati equivalent to jnati. The same spelling nuti occurs again at Amravati, e. g. in Nos. 232, 249, while, on the other hand, I have noted in two inscriptions (C. T. I., p. 53, Nos. 28 and 30) kalianaka. Similarly, other modes of orthography sometimes bring us nearer to, and sometimes take us further from, the learned standard. I may mention amasa[n]taka, Nas. 11 B; bammaniya beside bammhana, C. T. I., p. 14, No. 15; these methods of writing are the more worthy of note because, long before, at Kapur di Giri, we regularly find the spelling bramana. C. T. I., p. 46, No. 14, writes shanuvisa equivalent to shadvimsati, an absolutely sporadic instance of the use of sha in this Prakrit: a similar inscription, no less Prakrit, writes putrasa beside putasa, (C. T. I., p. 40, Nos. 3, 5, 6, 7). These inconsistencies of orthography are all sporadic. That they certainly do not depend on differences of time, can easily be proved by reference to the monuments from which the examples have been drawn. These monuments are dispersed over a very wide area. Now, between the inscriptions of Gujarat or of the caves of the Western coast, and those of Amravati at the mouth of the Krishna, those of Khandagiri in Orissa, of Sanchi in Malava or of Bharhut in Bihar, we find no trace of differences of dialect. They extend over at least four centuries, from the second century B. C. to the 3rd century A. D., without disclosing, between the most ancient and the most modern, any appreciable variation. In an area so extensive, the vulgar tongue certainly could not have failed to divide up into numerous dialects. This is a phaenomenon escaped by no language. Literature bears witness to it for the following period, and no one can be tempted to imagine that the fact was then a new one. On the other hand, it is clear that a language cannot pass through four or five centuries in the mouth of the common people without decay and transformation. The earliest literary specimens which we possess of the Prakrits, the stanzas of Hala, and the Prakrits of the most ancient dramas, although in origin but a short distance from the end of the period to which we refer, reveal a phonetic alteration which was much further advanced. Let us, therefore, bring ourselves face to face with the orthographical facts which have just been pointed out. The parallel employment of forms unequally altered, belonging to different strata of the language shew that this dialect of the monuments, however near we may suppose it to the living popular language, is neither its direct expression nor its faithful imitation. It conceals under a level in part conventional, a more advanced degeneration of the current language - a degeneration of which the distortions are reflected in those more corrupted spellings which accidentally escaped the engravers.
Page #279
--------------------------------------------------------------------------
________________ SEPTEMBER, 1892.] THE INSCRIPTIONS OF PIYADASI. 261 The frequent inconsistencies of the methods of writing shew that we, nevertheless, are not dealing with a language which is rigorously subject to minuto rules, and fixed by studies so definitive that their authority had cut short all individual caprices. Nor can we, on the other hand, see in it the spontaneous efflorescence of local dinlects freely expanding in their native diversity. The language is, therefore, neither purely popular, nor entirely subject to rulos. Taking all in all, it is to Mixed Sanskrit that the Prakrit of the inscriptions can be most exactly compared. Both, by the general use to which they were subjected, and by their relative stability, were raised above the character of simple local dialects. In each case each represented an analogous effort, - though arrested at unequal stages, - to compass a regularity, a unification, which, not being yet defined, left more or less room to hesitation and to caprice. We have just now had to investigate the relationship which united Mixed Sanskrit and Classical Sanskrit; it is no less necessary to determine what, in the linguistic series, were the respective positions which we should assign to this Monumental Prakrit, and to the Literary Prakrits. People are accustomed to call this dialect of the inscriptions, which I designate by the name of Monumental Prakrit, simply Prakrit, or, more often, Pali. This name lends itself to serions misunderstandings. If all that is meant is that in its constituent elements it is very analogous to the Prakrits, of which Pali is only a particular form, that is all right; but, so great is the danger arising from the use of ternis, which are either imperfectly defined or inaccurately employed, that people are ordinarily prepared to go much farther. They admit, as proved, or simply as self-evident, the identity between the two dialects; and such an identity in no way exists. It is, on the contrary, a very reinarkable fact, the explanation of which will have to be methodically searched for, that the literary Prakpits never appear in the epigraphic monu. monts: and that the Prakrit of the monuments never appears in literature. The material elements being in each case identical and drawn from the same popular source, the points of difference deal more with the form than with essentials. They have less to do with inflexion than with orthography, but they, none the less, certainly exist. Compared with monumental Prakrit, two features above all others characterize the Prakrits of literature: on the one hand the regularity with which the orthographical rules peculiar to each are applied, and on the other, the invariable custom of writing double those homogeneous consonants whose doubling is etymologically justiflable, or which results from the assimilation of a non-homogeneous group of consonants. The few examples given above are sufficient to shew how unstable in its orthography is the Prakrit of the inscriptions. A reference to the monuments themselves will shew plenty of other proofs. Sometimes a medial consonant is elided, sometimes it is retained : a hard consonant is usually maintained unchanged, but is sometimes softened the cerebral n and the dental n are sometimes distinguished, and sometimes one is used alone to the exclusion of the other. The palatal ji is by turns used or abandoned in words of identical formation. What need we say about the perpetual omissions and confusions which affect the notation of the long vowels P There is nothing like this in the Prakrit of the books. In them the value of the vowels is everywhere strictly fixed. Does this Praksit weaken a medial hard letter to a soft one? Then it does so always. Does that elide a medial soft letter? Then it elides it in every instance. One dialect exclusively employs the dental nasal, another no less exclusively adopts the cerebral. If they use both, they do so under distinct and clearly defined circumstances. I know that in several of these peculiarities people have sought for traces of dialectic or of chronological variations, but we have seen what confusion reigns in a number of inscriptions which belong to the same region and to the same epoch. That confusion allows us to
Page #280
--------------------------------------------------------------------------
________________ 262 THE INDIAN ANTIQUARY. (SEPTEMBER, 1892. attribute to such causes only a very secondary action. It, in any case, assigns to Monumental Prakrit & place apart, nigh to, but independent of the Prakrits of the books. In order to be more accurate, it is indispensable to examine more closely those Prakpits of the books, - the Literary Prakrits. It has long been recognized that the Prakrits of the grammarians and of literature are, to a greater or less extent, languages which possess an artificial and & learned character. The very coinmencement (v. 2) of the collection of Hala is significant: Amian paua kavvain padhiuri soun a je na jananti kamassa tavitatantin lunanti, te kaha na lajjarhti ? It could, therefore, very well happen that people were unable to understand Prakrit poetry. A special study was required to follow it. This is not the only piece of evidence, but the very appearance, the nature of the language, and the way in which it was used, furnish, in this respect, still more decisive arguments. The more fact that the plays, even those reputed to be the most ancient, employ at the same time, dialects which have reached very different stages of phonetio decay, will not allow us to admit that these dialects have been really and simply conveyed from real life into literature. The way in which they are employed and their allotment amongst the characters of the play are regalated, not according to the birth-place of the speakers (who in general are supposed to belong to the same country), but in conformity with a comparative scale which assigns each dialect, according to its degree of corruption, to each character according to his social rank. It is needless to shew how arbitrary is such a state of affairs, and how it cannot have been a direct imitation of the truth. If the Maharashtri dialect is exclusively reserved for poetic use, it is so because it has been adapted to the purpose by special manipulations, so that it no longer really and exactly represents the language of Maharashtra. On this point, opinion is, I believe, unanimous, and no one doubts that literary custom and convention are in great part responsible for the emascalation of this language, which appears unable to bear a single strong articulation, and which is resolved into a confused murmur of vowels following one after the other. Even those dialects, which, like the Sauraseni, have not been deliberately reduced to this degree of weakness, have certainly not escaped a certain amount of retouching. Languages do not, by their organic movement, go again up the stream, down which they have been carried by the natural action of phonetic decay. If the languages spoken in India at the present day possess articulations which have disappeared in the Prakrits, the grammatical constitution of which is infinitely more archaic, the use in literature of which is anterior by twelve or fifteen centuries, it is evidently so because the orthography of these Prakrits does not absolutely represent the condition of the language at the time at which they were employed or fixed. In this respect the Prakrit grammarians themselves supply significant indications. It is exactly those disdained dialects, which were considered as inferior, that have had their forms least altered, and that are nearest to their etymological origin. The Paisachi preserves the medial consonants which the superior dialects elide (Hemachandra, IV, 324), and the Apabhramsa retains the articulation of rafter a consonant (ibid. IV. 398), which is everywhere else suppressed in the uniform level of assimilation. The names of the dialects, too, contribute their testimony. Titles, such as Apabhramba, i.e. corruption,' or perhaps, corrupted dialect,' Paisachi, the dialect of demons,' are not names of definite languages, really existing in a precise region. When we found further distinguished, the Chulika-Paisacht, or 'Little Paisachi,' the Ardha-Magadht, or SemiMagadhi,' we can scarcely doubt, a priori, that we have to do with dialects which are something quite different from simple provincial idioms. I know that my learned fellow-worker and
Page #281
--------------------------------------------------------------------------
________________ THE INSCRIPTIONS OF PIYADASI. SEPTEMBER, 1892.] friend, Dr. Hoernle, has, with reference to Apabhramsa and Ardha-Magadh, put forward propositions which would make them local dialects with exact boundaries. I do not think that these theories could be positively maintained. To tell the truth, his views regarding the first would appear to have varied. Recently, in the provisional introduction to the excellent Bihari Dictionary, he puts forward the Apabhramia as the peculiar dialect of the north-west of India. We see from the preface to his edition of the Prakritalakshana of Chanda (p. xx) that this opinion is chiefly based on one fact, viz., that the edicts of Kapur di Giri agree with the Apabhramsa in optionally retaining an r following another consonant. Such a basis of classification is insufficient. We have nothing in any tradition to authorise the localisation' of the Apabhramsa in the northwest. Do not we also find the sporadic retention of this r at Girnar, at Nanaghat, and in other -inscriptions of the west ? If the Apabhramsa thus combines apparently ancient forms with the most advanced instances of decay, this happens, not owing to a dialectic peculiarity, but to the habit, common to all the usual dialects, of drawing freely on the tradition of the learned language, orthography and pronunciation. The Apabhrama of Hemachandra (IV. 398, cf. 414, &c.), still retains the r in composition. Would any one dare to draw chronological deductions from this fact? It employs on occasions the vowel ri (IV. 394); are we to see in this use the local survival of a sound lost for so many centuries ? Dr. Hoernle was, in my opinion, much nearer the truth, when, in the introduction to his Comparative Grammar (pp. xix - xxi) he came into accord with the proposition so learnedly put forward by Prof. Pischel, who considers the Apabhramsa as the popular dialect, as really spoken, in opposition to the Literary Prakrit 263 He considers that there are as many Apabhramsas as Prakrits, and I think that, in this, he has gone too far; for a great deal is still wanted to prove that each Prakrit could be viewed as regularly corresponding to a definite local dialect (as we shall see at once in the case of Ardhamagadhi). But the main fact to be drawn from the passages which he has quoted, or to which he has referred, and from the authoritative statements of the grammarians themselves, is that the Apabhramsa is like a general category, into which the grammar throws pell-mell, without attempting to classify them into dialectic groups, a number of peculiarities probably borrowed from current usage and eliminated from the literary idioms. In this way we can explain how the Apabhramsa could appear sometimes more archaic, though usually more degenerated, than the learned Prakrits, in which the affectation of orthographic uniformity, has made the proscription of tatsamas, or at least of such as were toe apparent, as large as possible. [Note by translator. It is almost unnecessary to state that the fact of his being the translator of M. Senart's luminous arguments, in no way binds Mr. Grierson to either accepting or denying their cogency.] Academy, October 1870. At the same time I am unable to understand on what arguments the idea, expressed by Dr. Hoernle, that the Apabhraches would appear to represent the popular language spoken by the Aryans, and the Paisach? the same language as spoken by the aboriginal tribes, is founded. Such an arrangement looks really too systematic, nor is it sufficiently justified by the few divergencies which distinguish the Paissscht from the Apabhramea. Some of these, such as the hardening of soft consonants, are found now and then at all epochs, from that of Piyadasi to the Prakrit of the monuments. Dr. Hoernle has himself remarked that, in the more modern grammarians, the confusion. between the Paisacht and the Apabhramea is perpetual (Comp. Gram. p. xx, note). I believe, indeed, that they are only two names to distinguish two things which, if not identical, are extremely analogous. It is perhaps for this reason that Vararuchi does not mention the Apabhramea. It is probable that, at the period when his grammar was written, pedants had not yet pushed their taste for arbitrary differentiations so far as to distinguish between an Apabhramsa and a Paie Achi. It is certain that, when the distinction first comes to our notice, in the Prakritalakshana (III. 87-88), the two alleged dialects are characterised by traits, -use of the consecutive rin Apabbramsa, substitution of l and n for r and which could, in no way, be held sufficient to constitute a difference of dialect. They alone suffice to shew the secondary, theoretical, origin of the separation. When we are told that in Paifichi the spelling sata (=sta) for Sanskrit shta occurs, are we to believe that this debased dialect has naturally perpetuated the etymological spelling? We cannot do so, any more than we can believe that the Apabhramea preserved the consecutive r. It simply takes up in tatsamas, written with a liberty tolerated by its rudeness, and the borrowing of which this rudeness itself supports, the tradition which we have already found at work at Girnar, several centuries earlier, in spellings like seste, &c.
Page #282
--------------------------------------------------------------------------
________________ 264 THE INDIAN ANTIQUARY [SEPTEMBER, 1892. Dr. Hoernle's opinion regarding Ardhamagadhi rests, unless I am mistaken, on but a weak basis. He has endeavoured to establish from the inscriptions of Piyadasi a geographical partition of the ancient dialects, which I have already, I believe, shewn to have little foundation. We have, as a fact, no indication of the existence, at that ancient period, of a dialect intermediate between the Magadhi and the Maharashtri. I would add that, by its name of Arsha, the Ardhamagadhi is at once classed as a literary language. It would be a strange phaenomenon that we should have to take it as denoting a real idiom, - this dialect, whose sole peculiarity is the formation of the nominative singular in e, and which, in other respects, save a few insignificant exceptions, is just the same as Maharashtri. It bears clearly on its face the mark of its artificial origin, I shall indicate, later on, what we may conjecture as to its formation; and certainly, the first impression awakened by its name, the notion which that name gives of a scholastic idiom, is not one that will mislead us. It is true that, beside these instructive names, other dialects received local titles which connected each with a definite tract of country. I do not even wish to insist on the fact that the principal dialect, the one which serves as the basis for the teaching of the grammarians, instead of habitually receiving its name of Maharashtri, is called Prakrita, the Prakrit par excellence, which manifestly contrasts it, as an artificial language, with that other learned and literary language, which is Samsklita, the Sanskrit. This detail can well have only a secondary importance, and it remains certain that several Prakrits are designated by geogra. phical names ; Maharashtri, Sauraseni, Magadhi. It is natural to conclude that they are connected respectively with the countries of the Maharashtra, of the Surase nas, and of Magadha. But to what degree, and in what sense are they connected ? That each borrows certain characteristio peculiarities from the popular dialect of the country of which it bears the name, is a thought which will at once occur to the mind. Several facts confirm it. Some of the phenomena attributed to Magadhi by the grammarians - the formation of the nominative of a-bases in e, the substitution of 1 for r - are also found in the official dialect of Piyadasi, and the situation of the royal residence entitles us to consider that as approximately representing the idiom of Magadha. Whatever we may be led to think of the work of regularisation and of the cutting down to measure by the grammarians, it is certain that they have taken their materials for foundation, their constituent elements, from the vulgar dialects, and the names which have remained attached to the literary idioms, when they have a definite geographical meaning, deserve to be taken into serious consideration. Till the contrary is proved, they supply us with an historic basis, which we cannot abandon without committing a serious imprudence. So far as concerns the Maharashtri, the comparisons which the inscriptions of the western coast, in the land of Maharashtra, permit us to institute, shew that no incompatability exists between what we can identify as belonging to the popular language, and the rules of the grammatical idiom. The only thing is that we must clearly understand under what conditions these comparisons present themselves. Maharashtra, where we find at once both a long series of monuments, and, in the verses of Hala, an ancient, probably the most ancient, instance of the application of Pruksit to literature, is the tract most favourably circumstanced for us to form a clear ides, on actual evidence, of the manner in which the reform of the Prakrit grammarians was accomplished. On a consideration of the Prakrit inscriptions of the West we have been convinced that, although they are necessarily based on the popular language of the locality, they do not give us a rigorously faithful picture of it. Their orthography is not strictly representative; but, without having that stability which can only be assured by a complete grammatical culture, it tends to get as near as it can to etymology, that is to say to the orthography preserved by the learned language. It takes as the typical ideals of its writing those instances in which the pronunciation has departed least from the primitive form. The parallel use of Mixed Sansklit is there to prove that this conclusion does not arbitrarily attribute to the authors of the monumental orthography a predisposition which was not theirs.
Page #283
--------------------------------------------------------------------------
________________ SEPTEMBER, 1892.] THE INSCRIPTIONS OF PIYADASI. 265 What about the literary Maharashtri? We know, in the first place, that the grammarians distinguish two varieties, the ordinary Maharashtri, which is that of Hala and of a portion of the poetry of the plays, and the Maharashtri of the Jainas. We can for the moment neglect the shades which distinguish these two groups; taken as a whole, they closely resemble each other, as we should expect in the case of dialects which, bearing the same name, must have sprung up in the same soil. Between this literary idiom, and that of the monuments, numerous points of difference leap to the front the moment we examine them. We must consider these differences more closely. - The literary orthography ordinarily weakens into the corresponding sonant the hard; I have quoted above, from the inscriptions, the spellings mukuda, vadaka, dhenukakada, kudumbini, sadakani, sadagere, padidatava, padithapita, &c., by the side of the more usual writing which retains the consonant as in the standard Sanskrit. The literary language readily weakens p into bor v, and it completely elides the medial t; I have quoted above the sporadic spellings thuba for thupa (stupa), goyama for gautama (mi). The grammarians teach that a soft consonant between two vowels is elided; in the monuments, we have met words like bhayamta, bhaamta, beside bhadamita, siaguta for sivagupta, pavaita and pavayita for pavajita, bhoigi and bhoa for bhojiki and bhoja, payuna and pauna for padona, uyaraka beside ovaraka, chiarika, beside the usual chivarika, paithana for padithana, representing pratishthana. The locative singular of bases in a is formed in the Prakrit of literature in e, and more usually in ami; if in the monuments it is almost always formed in e, we, nevertheless, find examples like jambudipamhi (Karli No. 10, Arch. Surv. IV. 91); and, beside the locative tiranhumbi, the spelling tiranhumi (i. e., tiranhummi) (Arch. Surv. p. 106, No. 14). So, also, baimani beside baihmhana in the same dedication. These instances prove that the termination mhi was altered, in a manner more or less constant, into ammi in the vulgar pronunciation. The y is constantly changed into j in the regular writing, and, consequently, yy into jj, and the group rya into jja, through an intermediate yya. Cases like sihadhayanam, (C. T. I., p. 31), No. 7; for "dhajunamh, vaniyiyasa, p. 16, No. 20, puyatham, Kanh. No. 98, rayamacha, Arch. Surv. IV. p. 99, No. 4 (perhaps we might add bhoya beside bhoja), prove that in real pronunciation there was no distinction between y and j. Elsewhere, beside learned spellings like achariya (C. T. I., p. 100), acharia, Kanh. No. 17, we meet the forms ayyaka, Kanh. No. 19, C. T. I., p. 60, No. 2; bhayaya, C. T. I., p. 43, No. 6, &c., payavasdne, Arch. Surv. p. 114, No. 22; and the sporadic spellings, bhajaya, Kanh. 19, 27; bharijaye, Nas. 22; bhadrajanijja, Kanh. 27, beside paniyya, do not permit us to doubt that, between the grammars and the inscriptions, the difference was purely apparent, and simply graphic. I could quote other details, and, compared with the sutras I. 29; III. 129, of Hemachandra, point out, in the monuments, the spellings atevusini, Kanh. 28, Kuda 22, idagni, Arch. Surv. IV. 114, No. 3, &c., do, Kanh. No. 3, beside be (Mahad. 1), or ve (Junnar, 14). These comparisons suffice to put in its true light the character of the grammatical dialect. It is founded on the same local basis as the idiom of the monuments: both represent the same language but at slightly different periods of its history: both modify its appearance by an orthography which is in part arbitrary, but dominated in each case by divergent predilections. The one, when it is inspired with learned recollections, ordinarily chooses as its standard the least altered etymological form: the other goes, so to speak, to the extreme limit of existing corruptions; it prefers to take the most advanced facts of phonetic deterioration, as the level which grammatical elaboration imposes with a more or less absolute regularity on the system which it has consecrated. The arbitrary constructions of the school can, of course, work in more then one direction. We must expect not only to find different tendencies, but also to meet both partial instances of unfaithfulness to the regulative tendency, and also elements and distinc 5 Jacobi, Kalpa Sutra, Introd. p. xvii.
Page #284
--------------------------------------------------------------------------
________________ 266 THE INDIAN ANTIQUARY. [SEPTEMBER, 1892. tions which are purely artificial, mingled in a variable proportion with the elements which have been directly supplied by the popular speech. A comparison of the various literary Maharashtris, the parallel employment of which I have already mentioned, throws a striking light upon this point of view. Ay Professor Jacobi (loc. cit.) points out, the Maharashtri of Vararuchi and the poets differs from that of Homachandra and the Jains in two main peculiarities. The former does not use the ya-sruti, and everywhere substitutes the cerebral n for the dental >> : the latter retains the dental * at the commencement of words, and when it is doubled. It is quite natural that the origin of these divergencies has first been sought for, either in diversities of dialect, or in differences of time, but I should be surprised if anyone, with the knowledge which we are now beginning to acquire of Indian epigraphy, could persevere in this view. So far as concerns the first point, the introduction of a y between vowels - or, according to Hemachandra, more exactly, between two a's - which form an hiatus, I lay no stress on several circumstances, disagreement between the grammarians, disagreement between the rules of the grammar and the manuscript tradition, which a priori, appear to indicate that this rule is susceptible of arbitrary extensions and restrictions. I content myself with calling the texts of the inscriptions as witnesses. The ordinary orthography is too ready to adopt the niethods of the learned language to allow many hiatus to exist. I have, however, quoted many examples, and I could quote more; bhoa, bhoigi, pauna, chiarika, paithana, bhaasta, pulumai, phutua ; the spellings chetiasa (Kanh. 5), patiasiya (Kaph.4), the terminations pavaitikad, ponakiasanda, (Kanh. 21), bhayaa (Kaph. 27). It follows that from an epoch earlier than that of our literary authorities, the local pronunciation supported the existence of the histus in Maharashtra, as well as in the other provinces of India. It must be assumed that, there as elsewhere, but not more than elsewhere, the hiatus implied a light utterance-break analogous to the soft breathing. If this has been denoted by means of the y, whether in all, or in special cases, the choice can be explained on the one hand by the imitation of a certain number of terminations of the learned declension, and on the other by the fact that the change in every case of an original y to j, left the sign for y available for a special function. Sometimes the inscriptions apply v for this purpose, as in pulumdvisa (Nas. 15), bhayava velidatava (Kuda, No. 23), and the parallel employment in this last inscription of the spelling uyaraka, for uvaraka, clearly shews that neither the v in the one case nor the y in the other represented any actual pronunciation. They are merely equivalent expedients for concealing from the eyes a hiatus wbich the recollections of the cultivated language caused to be considered as clumsy and barbarous. It was a similar idea, and not a chimerical peculiarity of a local dialect, which has caused the employment of the ya-sruti by one school, and which has subsequently cansed it to pass into the rules of its grammars and into the usages of its books. As for the use of the dentel n and the cerebral , the case is, if possible, still more striking. At first sight, a dialect which invariably pronounces an initial in one way and a medial n in another, should surprise us and pat us on our guard. But the question is more general, and the case is susceptible of being argued with greater precision. I must confess that I cannot sufficiently express my surprise to see nowadays the distinc tion between the cerebral and the dental nasal taken as a basis of classification when dealing with the ancient Praksite. It will be remembered how the form of the cerebral I is known to none of the inscriptions of Piyadasi which are couched in the Magadhi orthography. The dental 1 is alone used. If this is a peculiarity of the dialect, it is very curious that, in the literary Magadhf, the dental >> should, on the contrary, completely disappear, and that the cerebral alone should be admitted. At Bharhat, the ordinary inscriptions know only one 1, the dental >> ; but there is, nevertheless, one exception, and it is characteristic. The royal inscrip * Jacobi, p. 16.-E. Muller, Beitr. Zur. Gramm, des Jainaprdkrit, pp. 8 and . * cf. Piscbel, Hemach. I. 180.
Page #285
--------------------------------------------------------------------------
________________ SEPTEMBER, 1892.) THE INSCRIPTIONS OF PIYADASI. 267 tion of the eastern porch, dated in the reign of the Saugas, ases concurrently both forms 1 and I ; bat in what way ? It has pote na, putena, putena, probably toranain and certainly upanna. If both forms are here known, it is quite clear that the distinction between them is, not popular, but arbitrary and learned. This is proved not merely by its inconsistencies and by its irregularities, but by the application of the cerebral to terminations in which its presence is explicable in Sansktit, but in Sanskrit only, by the proximity of an , which has disappeared in the vulgar idiom. At Girnar, at the time of the.edicts of Asoka, where the distinction between n and n is marked, the pedantic imitation does not go so far, - the cerebral never appearing in terminations. At Sanchi, the state of affairs is very analogous to that which is presented at Bharhut. In all the ancient dedications the I is unknown. It only makes its appearance in an inscription of the reiga of Satakani (No. 190), the introducer of Sanskrit into the epigraphy of the Andhras. At the other extremity of India, in the monuments of Ceylon, the signs I and I are evidently employed without distinction, and it is natural to conclude that the case was the same in the region from which that great island had borrowed its alphabet It is a curious fact that the only inscription (No. 57 of E. Muller) in which a deliberate distinction appears to have been made -- we have in it mahasarane, budhasaranagate, beside nati (natii), afhane, niyate - appears to be directly based on a Magadhi dialect, and yet, in its use of and I, it deviates equally both from the practice of Piyadasi, and from the rules of the literary Magadbi. Nowhere are things more clear than in the tract which interests us more immediately, the country of Mahar Ashtra. I have just drawn attention to the fact that in the root-portion of words, Girnar follows Sanskrit in distingaishing between the two n's. At Nanaghat, the ancient Andhrae know nothing but the dental n. The cerebral I reappears in the period following, we have seen above under what conditions. The confusion is continual. No fixed rule allows us to disentangle it. Neighbouring inscriptions make exclusive use, the one of 1, the other of I. The meaning of this hesitation, of this medley, is further accentuated by the parallel facts concerning the palatal n. This nasal has disappeared in the literary Maharashtris, and is replaced by the cerebral or by the dental. Nevertheless, in the inscriptions, we constantly find the genitive runo, and also forms such as heranika (C. T. I, p. 54, No. 32). On the other hand spellings such as kalianaka (C. T. I., p. 53, Nos. 28, 30) are of a nature to lead us to conclude that the i is no longer a living letter. We have, indeed, already quoted aranaka, an), and ni, heranika, puna, nati, &c., which shew that the use of the sign i is only a mere pedantic affectation. It is certainly not otherwise with the signs 1 and I. In the inscriptions they represent a value which is in both cages absolutely identical ; and if the grammatical reform of the literary dialects has assigned to them special roles, it is owing to an arbitrary differentiation which has no connexion with the actual variations of the current pronunciation. Although summary, these remarks are, unless I am mistaken, sufficient to mark the peculiar characteristics of Monumental Prakpit, and also, more especially, of the Literary Prakpits, and to present them under their trae aspect. This is an indispensable preparation for elacidating the problem with which we are concerned. It resolves itself into two terms; when and how were the Litorary Prakrits constituted P These two points embrace all the secondary questions. It is a trite observation that languages, in the normal course of their history, are invari. ably subject to a gradual decay of their phonetic elements. This is a current down which all float. None can, of itself, go up the stream by its natural movement. This has ordinarily, and very naturally, been made the basis of the relative chronology of the dialects of India: The . It is very powsible that this state of affairs www in reality mach more ancient. In fact, putting aside the peculiar spelling flaydou (G. VIII. 1), the edicts of Girnar, along with the ordinary orthography of fi for my have in one parenge VIII. 4) the rending Mirana. Inversely,' while the appears nowhere in the edicts in the Mgadht dialoot, Dhauli presente na unique example in patimit for pratis, alwaye supposing that the reading of the Corpus is exact, which I have great difficulty in believing.
Page #286
--------------------------------------------------------------------------
________________ 268 THE INDIAN ANTIQUARY. [SEPTEMBER, 1892. preceding remarks make evident with what particular reservations we should here surround the application of this principle. In themselves, the Sanskrit forms are certainly more arch ic; they are historically older than the Praktit forms of the time of Piyadasi. Yet that does not prevent Sanskrit, as a whole language, in the form in which we know it now, having only succeeded in conquering for itself an existence long after the rise of his Prakrit. So it is with the different Prakrits. The general phonetic appearance of Pali is certainly more archaic than that of Maharashtri. Have we any right to conclude that therefore it actually existed, in its definitive form and orthography, before Maharashtri? In no way. In short, we must carefully distingush between the constituent elements of the dialect, considered directly, and their atilization in the shape of a particular literary dialect, adapted to a certain order of production. We cannot apply to literary idioms, in part artificial and learned, the same measure as that which we apply to purely popular languages. They, the former, can, in a sense, go up the regular stream of their linguistic development. This is the very fact which we have proved for Mixed Sanskrit. When I speak of inquiring into the age of the Literary Prakrits I mean, not to determine the epoch to which the elements, morphological and phonetic, of which they are composed, can be traced up, but to fix the moment when they were arrested, crystallized, in & definite form for literary use. For this purpose the forms which are the most altered are those which are most instructive. They can be made to prove that such & dialect cannot be earlier than suoh & given epoch. The better preserved forms prove nothing. They may have been either subsequently reconstructed in the light of the learned language, or preserved for a greater or less period by tradition before receiving their place and their consecration in the special dialect of which they finally formed an integral part. The criterion, therefore, founded exclusively on the general phonetic appearance of the dialects must be resolutely put to one side, if we wish to avoid misconceptions regarding the most certain, the most characteristic features of the history which we are endeavouring to build up. This being settled, a two-fold object of inquiry presents itself. On the one side, the relation existing between the Prakrits of the monuments and that of the books, and of the other, the relation existing between the literary Prakrits and Sanskrit. To set to deliberately, to convert, by systematic work, popular dialects into literary dialects with forms fixed for ever, is not so simple an idea that it would suggest itself of itself, and that it should not require any explanation. Such an undertaking must evidently be regulated on a prototype, on some pre-established model. India possesses a type of this description, Sanskrit. Indeed, if we pay heed to the names, prakorita and samskrita are correlative terms. The actual bond which connects together the two series of facts is certainly no less close than the formal relationship of the names which designate them. Historically, the earlier term is Sanskrit. On that point there can be no possible doubt. It is the very elaboration and diffusion of Sanskpit which has served as the basis and model for the elaboration of the Prakrits. They have been regalarised in imitation of it. The recollection of this origin is perpetuated in the teaching of the grammarians. They take care to establish that Prakrit has Sansktit for its basis and for its source (Hemach. I. 1, and Dr. Pischel's notes). It would be a mistake to attribute to the Hindus, on the strength of such a remark, the idea of a linguistic genealogy founded on comparative analysis. When Vararachi and others (cf. Lassen, Instit. Ling. Prakrit, p. 7) declare that the prakriti of Saaraseni is Sanskrit, and that of Maharashtri and of Paisachi the Sauraseni, it is quite clear that we must not take the proposition in an historical sense. It is nothing but a manner of stating that Sauraseni, in various characteristics, approaches Sanskrit orthography more nearly than the other dialects, - that it is in a fashion midway between the learned language, and the dialects with a more altered orthography. It is not a genealogical classification, but an entirely practical one. It is something like a direct recognition of the method according to which these languages have received their grammatical fixation. This working has taken for its basis the grammar of the learned language, and for its principle the gradation of each of them on a determined level below the stage of Sanskrit.
Page #287
--------------------------------------------------------------------------
________________ SEPTEMBER, 1892.] THE INSCRIPTIONS OF PIYADASI. 269 I now come to the second object of inquiry. Monumental Prakrit and the Literary Prakrits start from the same source. Their main difference consists in this, that they have been unequally cultivated. The latter possess a character more stable, their mode of writing is more perfect. Is this to be explained by indifference to these particulars on the side of the former? Certainly not. The part which it plays as the official language of the inscriptions, the general level which it knows how to retain above the more altered locai dialects, allow us to recognise in it an idiom already refined, and with an inevitable tendency, as is universal in India, to establish itself as a fixed and regular language. How could we believe, if there already existed, in the Literary Prakrits, a parallel model of better regulated and more complete orthography, that the writers could have, when using the language for inscriptions, neglected to profit by it, and to utilize its experience ? Bat general considerations are not sufficient. Whatever it be worth, the demonstration, to be conclusive, must be connected with precise and characteristic phaenomena. The facts relating to the graphic representation of double consonants have afforded us valuable assistance for establishing certain essential points in the comparative history of Classical and Mixed Sanskrit, and the data of the same order are no legs instructive in the new ground on which we tread at present. The Literary Prakrits observe every doubling without exception. There does not exist a single Prakrit text which departs from this rule, or a single grammarian who does not explicitly teach it, or shew by evidence that he assumes it. The strictness with which it is uniformly introduced in all the dialects shews that we have here a rule which has from the very commencement exercised its influence on the grammatical work, This mode of writing seems, in itself, to be perfectly simple; it is only the expression of the actual pronunciation. But the matter is not so easy as that. Not only does the most ancient orthography, that of the edicts of Piyadasi, abstain from observing it, but we have seen that Mixed Sanskrit, in spite of the tendency which led it to approach historically older forms, adopted it slowly, and, as I have admitted, under the influence of Classical Sanskrit. It is no less a stranger to the Prakrit of the monuments throughout the whole period with which we are now dealing. We are entitled to affirm this as a general fact, though I shall shortly point out certain exceptions, which, far from weakening the rule tend to emphasize its correctness. This graphic usage of the literary Prakrits, which is inseparable from their very elaboration and from their grammatical establishment, was, therefore, not borrowed by them from earlier established customs. It is not met in epigraphy, nor in the current practice which epigraphy certainly reflects. It can only have been borrowed by them, as it was borrowed by Mixed Sanskrit, from the pre-existing orthography of Classical Sanskrit. I have just shewn that it was a priori more than probable that the very idea of refining the local dialects into literary tongues, and still more probably the principles under which the latter were elaborated, must have had their source in the existence, in the employment, and in the rule of profane Sanskrit. This orthographical peculiarity lends to this view a new and positive foundation in fact, and certain data borrowed from epigraphy shew it in its full light. I have said that the Prakrit of the inscriptions does not double its consonants. It remains, in this respect, faithful to the ancient tradition. This fidelity is not invariable, and does not endure to an indefinite period. From & certain epoch, we find some examples of doubling appearing sporadically. The last inscription of Vasithfputa Palumayi (4. S., IV. p. 113, No. 21) has setapharanaputtasya. The termination asya, which is repeated in sovasakasya, abuldmavathavasya, clearly shews that the engraver employed this doubling in a moment of Sanskritizing imitation. In the purely Praksit texts of Madhariputa Sakasena, we meet Amongst the neo-Aryan languages, Sindhi, re-adopting in its case the primitive inexactness of the Hinda orthography, noglects to note these doublings: but it none the less faithfully observes them in pronunciation.
Page #288
--------------------------------------------------------------------------
________________ 270 THE INDIAN ANTIQUARY. [SEPTEMBER, 1892. ayyakena (A. S., V. p. 19, No. 14), dyyaka na and buddha (ibid. p. 82, No. 19). The maintenance of the long vowel before the double consonant is here to reveal a Sanskrit influence, and an analogous action is altogether natural in the participle buddha, which is identical in the learned language and in the popular tradition. Doublings (even purely Praksit ones) are more numerous in No. 27 of Kanheri (4. S., p. 85): paniyyao, bhadrajanijjanain, etta, ekka, etto, puttana, savvaseva, fhitanari, tti. This inscription is, generally speaking, rather couched in Mixed Sansktit, forms like pratigrahe, putrasya, kulasya, bear witness to a more or less direct action on the part of classical orthography. Its linguistio level is, in other respects, very uneven, and side by side with these Sanskrit forms, appears a genitive like dhutua. Dr. Buhler, whose experience on this point is entitled to great respect, considers that this inscription, written in Andhra characters, contains some forms of more modern letters. It, therefore, most probably, belongs to the third century. These facts speak clearly. It is certain that Prakrit, as it was written on the monuments, was quite ready to accept the graphio doubling of congonants. From the moment when the diffusion of Sanskrit set the example of this doubling, this tendency shews itself in various dispersed instances, welling over from Mixed Sanskrit to introduce itself into Prakrit. These instances form the evidence of the movement which was inevitably destined to carry on the Prakpits in its course. They shew also that this movement had not yet resulted in the fixation of the orthography of the Praksits, for, in that case we should find in the Praksit of the monuments, instead of rare indications, & constant practice. Leter facts prove that this is not an unfounded conjecture. It will be remembered that after the commencement of the 3rd century, the series of epigraphical monuments is interrapted by an unfortunate lacuna. The most ancient inscrip tions which come next to carry on the chain of tradition, are, so far as is at present known, a few epigraphs of the Pallavas. The earliest is an endowment of Vijayabuddhavarman 10 Messrs. Barnell and Fleet agree, on palaeographical grounds, in attributing it to the fourth century. 11 of the four faces which are covered with writing, only the last is in Sanskrit. In the condition in which they have come down to us, the three first do not appear to be susceptible of a continued translation, but that is not indispensable for our present purpose. Whatever may be the difficulties and uncertainties, the general fact which concerns us leaps at once prominently into notice. Words like sirivijayak handavammamahardjassa, yuvamaharajassa, sirivijayabuddhavammassa, paduttare pase shew us a Prakrit which, for the first time in the series of epigraphs, doubles its consonants like the grammatical Prakrits. This, too, is not an accident or a caprice. The copper-plates of Hirahadagalli, which belong to the same dynasty, and to the same time, and which have been kindly communicated to me by Mr. Burgess, use on the whole the same orthography. The fact is of high importance. It conclusively testifies how the writing of the monumente was naturally inclined to adopt the more regular and accurate orthography used by the Literary Prakrits. If therefore, it had not adopted it sooner, it was because that use had not yet been established. It thus gives us a means for determining with sufficient approximation the epoch in which the final elaboration of the Prakfits occurred. To sum up. The reform of the Literary Prakfits was subsequent to the diffusion of Sanskrit in profane use, and cannot therefore, be earlier than the first centuries of our era. In the 4th century it had been carried out; at least, the general system had been established. This is borne witness to by the reaction which it exercised upon the Praksit of the monuments; all that we do not know is to what dialects it at first extended. The few examples of doubling which we find in the epigraphs of the end of the 2nd century, or of the beginning of the 3rd, would seem to mark this epoch as the period of this grammatical work. 10 Fleet, Ind. Ant. 1880, p. 100. 11 Ind. Ant. 1876, pp. 175 and #f. 1 It has since been published by Dr. Buhler in Epigraphica Indica, Part I.
Page #289
--------------------------------------------------------------------------
________________ SEPTEMBER, 1892.) THE INSCRIPTIONS OF PIYADASI. 271 Without being in a position to state with positive accuracy, we cannot be far wrong in asserting that the second and third centuries are the earliest time at which it can have been brought forward into practice. It is clear that this work cannot have been contemporaneous for all the dialects, and that, for several, it has only been carried out at a much later period. These conciusions compel us to accept an important consequence. This consequence is that all the Pali-Prakrit literature which we possess is, in the orthographical form in which we now have it, later than the grammatical reform of the Prakrits, and later than the 2nd or 3rd century. I must here do away with a scruple which might arise in the reader's mind, and suggest one explanation. My last inductions are principally founded on the date of the doubling of congonants in writing. Am I not exaggerating the importance of an orthographical detail ? It will first be remarked that the argument drawn from doubling, if I have been right in insisting upon it on account of facts which allow as to treat it with a striking degree of accuracy, comes simply to confirm and to circumscribe, from the point of view of chronology, a proposition which a priori compelled its own acceptance. Or can any one doubt that the regalarisation of the Prakrits, such as we find it both in grammatical manuals and in literary works, was not necessarily later than the final elaboration and diffusion into common life of Sanskrit, or that it was not inspired by and modelled on it? This imitation of Sanskrit perforce carries us, after what has been said above, to at least the second century. Moreover, we must take care not to minimize too much the importance of this graphic phaenomenon. For several centuries, through minor modifications, a certain orthographical system was maintained in the Praksit of the monuments, without undergoing any attack, or submitting to any compromise. All at once, we find, one day, this system modified, and modified in & regular, constant manner, in one of its most characteristic traits. The incident, from a grammatical point of view, is not so petty. By its very suddenness, by the strictness with which the new principle is applied, it indicates that a revolution of some magnitude has intervened. This doubling may pass for a detail, but it is not an isolated one. It forms an integral part of a more general reconstruction. It is one of the most apparent manifestations, but it is far from exhausting them. The fixation of the Prakrits by the learned has also touched other points. There is no appearance or indication of its having been executed in successive stages, and, so to speak, in several acts. It can only be understood & Taicing place at a single blow in the first dialects which were subjected to it. It could subsequently bave extended to the others by & natural process of imitation. If we prove the application of one characteristic feature of the system, we may be assured that that system in its entirety has just, for the first time, been put in practice. A decisive fact testifies to the importance of this moment in the history of the Prakrits. It is natural that one graphic system shonld disappear from use on the arrival of a system, which was more complete and more consistent to itself. That is what happened to Mixed Sanskrit in the presence of Sanskrit. Now, with the 3rd century, Monumental Priiksit disappears without return. The Pallava inscriptions are in puro Pali, and after that epoch, Sansksit remains, alone amongst the tongues of Aryan stoek, as the language of epigraphy. The objection, therefore, appears to me to be divested of serious importance. As for the explanation, I can be brief. Of Prakrit of earlier date than the grammatical reform, we possess no positive documents other than epigraphic evidence. All the literary works are written according to the system established by the grammarians, and they all bear evident traces of the levelling process whicu followed the scholastic reform. I conolude from this that all, from the Sinhalese canon the canon of the Jainas to the verses of Hals and to the dramas, are, in the actual torm
Page #290
--------------------------------------------------------------------------
________________ 272 THE INDIAN ANTIQUARY. (SEPTEMBER, 1892. which we now have them, of later date than the labours of the grammarians, and consequently, than the third century. Are we, therefore, to conclude that the dialects which the schools retouched, had never, before this epoch, been applied to literature ? Such is not my opinion. We shall see, on the contrary, that the use for which several have been specialized, the archaic form which several of them have preserved, can only be explained by the existence of certain traditions, either literary or religious. People composed stanzas in Mabarashtri before the collection of Hala was written in its present form. Long before the Sinhalese Tripitaka was fixed in the shape in which we now read it, there existed, amongst certain sects of Buddhists, & number of formulae, rules, and legends transmitted in a dialect in its essence closely resembling the Pali of our books. We must, nevertheless, take care not to exaggerate the accuracy or the importance of these earlier compositions. They must have remained purely oral, or, at most, had only received a written form, which was accidental and ephemeral. A sect, Buddhist, Jaina or other, which possessed, whether written, or even living in a finally established oral tradition, a definite and consecrated canon, would certainly never have consented to alter it by submitting it to a new grammatical remodelling. Moreover, this grammatical retouching must have been at first undertaken in answer to a demand, to give for the new requirements of editing and codification, the instrument which was necessary to them. The fixation and the reform of a dialect peculiar to the sect, which was used for its fundamental texts, can only be conceived as occurring at the date when they were for the first time united in a definitive collection of traditions, which had hitherto been either imperfect or dispersed. If they had been established sooner in a canonical corpus, the language of that corpus would itself have been the law. Its authority would have rendered reform both useless and impossible. This reform would, on the other hand, under the conditions in which it was produced, have been equally inexplicable, if we did not admit previous attempts at editing. Although imperfect and fragmentary, they have, in a general way, marked for each dialect the low-water mark of its phonetic development, and furnished the characteristic traits of its morphology. It is expressly subject to this reserve that we must understand the conclusions which I have indicated. At the present moment, I am only dealing with a special class of considerations. It is unnecessary to say that there are arguments of another nature which appear to me to confirm these inductions. I here leave them aside, and only wish to point out, en passant, one interesting instance of agreement. There are reasons for believing that the stanzas of Hala represent the most ancient specimen of Prakrit literature. In the course of his learned and ingenious labours on this valuable coliection, Prof. A. Weber13 has proved that the third century is the earliest date to which it is possible to refer it. I have now replied, so far as the documents on which I depend appear to allow, to this first question; - at what epoch did the Literary Prakrits begin to be fixed and to establish themselves? We should also like to know how and under the influence of what circumstances this blossoming forth took place. This question has hitherto been treated as a simple problem of linguistics. Each dialect has been considered as having been, at the epoch when it received its literary form, a spoken and living idiom. Taking this principle as a foundation, a series based solely on phonetic comparisons has been converted into a chronological scale. I have protested against this confusion, and indicated why, in my opinion, we must discard a criterion which has been adopted with too ready a confidence. The literary elaboration of the Prakrits cannot have been earlier than the second or third century. It has been in no way proved, and, indeed, it is hardly probable, that it should 13 Wober, Das Saptasatakar des Hala, p. xxiii.
Page #291
--------------------------------------------------------------------------
________________ SEPTEMBER, 1892.] THE INSCRIPTIONS OF PIYADASI. 373 have taken place for all the Prakrits at the same time. Once given the initiatory impulse, the new comers could have followed a movement to which they were originally strangers. In each case it is a special question, less of linguistics than of literary history, which is necessarily difficult and delicate, and which demands thorough investigation for each dialect. I am not called upon to enter, nor should I have the means of entering, upon such an inquiry, even admitting - and I am very far from admitting that each of these separate problems is at the present moment ripe for discussion. It is sufficient for me to indicate certain facts which appear as if they would throw some light on the problem as a whole. On looking at it nearer, it resolves itself into two questions. We must understand why some of the popular dialects were transformed into literary dialects more or less touched up by learned hands. We must discover how and under what circumstances each received the particular form in which it has been ultimately fixed. The previous existence of Sanskrit gives an easy reply to the first question. Learned languages have been settled in India in all parts and at all periods. The continged tradition of a religious language distinct from the current tongue, the ancient creation of a literary language fashioned on its model, a language consecrated both by its origin and by the privileged position of its authors, - all these very special conditions sufficiently explain the fact. To this must be added the influence of the social constitution. By the overruling authority which it conferred on the Brahmang, it assured to scholastic formalism, to the preferences and undertakings of the learned, an empire altogether surer and more powerful than could otherwise have been expected. I content myself, therefore, with merely pointing out the canses, the action of which has been so evident. The second question is more complex : why should such and such dialects and not such and such others have been the object of this literary culture P How comes it that dialects in very different degrees of degeneration could have been fixed under parallel circumstances, and, more, at an epoch long posterior to the linguistic period represented by their respective constituent elements ? What influences have determined the level at which each one has been arrested ? If the existence of a learned language, like Sansksit, is an indispensable postulate for the very existence of the Literary Prakrits, its influence was not confined to an initiatory impulse. It is manifest that the classical grammar has, in matters of detail, played the part of a regulator. The classical langnage fixed in all its parts, surrounded by so much authority and prestige, would present itself to learned labour as a type of perfection: its action could not fail to be powerful. It is the existence of it alone which can explain how such a partial reorganization, a partial levelling, could have taken place without throwing the whole into irremediable disorganisation. The model was there, at once a light and a restraint. If we take these dialects in tnemselves and in their separate destinies, it is not difficult to discern several factors which have not only rendered possible, but which have prepared the way for, and which have inspired, their definitive constitution. All the Prakrits have their roots diving deep into the popular language. The ethnic names which several bear, may, in one or more instances, be deceptive, but, certainly, all their essential elements are originally borrowed from the living language. This peculiarity is common to all, but all the popular dialects have not been raised to the rank of grammatical Praksits. This learned crystallization of several of them, occurring at an epoch when Sanskrit was coming into common use and had put in the hands of all an excellent literary instrument, must have had special reason for its motive in each particular case. Several such reasons, literary or religious, local or scholastic, will readily suggest themselves.
Page #292
--------------------------------------------------------------------------
________________ 274 THE INDIAN ANTIQUARY. [SEPTEMBER, 1892. If the definitive fixation of the Praksits, and, as a consequence, the drawing up into their present form of the works which have come down to us, cannot have been appreciably earlier than the third century, it is very plain that neither these languages, nor these works could have one day sprung from nothing. They must have had antecedents. There certainly existed, in a more or less rudimentary condition, long before this epoch, a popular and profane literature, hardly or not at all written, but nevertheless living. We find positive traces of it in the inscriptions. I need not refer, in the inscription of Siripulumayi (Nas. No. 14), to the wellknown allusions to the Epic legend. The religious sects could have, nay, must have, from the age of their foundation, preserved teachings and relations, and, at the same time, & more or less altered tradition of the language which had at first served for their propa. gation. It is from these sources that the arbiters of the literary renovation were able to draw the characteristic elements of the idioms to which they gave a definitive form. In several respects the situation of the Prakrits is altogether analogous to that of Sanskrit as I understand it, and as I have sketched it above. If Maharashtri has become, in preference to every other dialect, the language of song.. poetry, it is because it was in Maharashtra more than elsewhere, that there had spontaneonsly developed a poetry which served as a model for more learned attempts. The Jainas, while using the Maharashtri, have introduced into it the termination of nominatives masculine. The name Magadhi preserved for their dialect well shews that this innovation is, as it were, a last echo of the recollections which they had kept of this country of Magadha, with which more than one historic tie connected them. It is evidently an analogous recollection which is expressed in the application of the same name, Magadhi, to the language of the Sinhalese Tripitaka. A few rare Magadhisms can hardly pass for a mark of origin. Several traces of Magadhisms, however, appear in the most ancient inscriptions of Ceylon, which seem to testify that, as we might expect, it was a kind of Magadhi which was employed in the propaganda of Piyadasi. The Sinhalese canon pretends to descend directly from it; in reality, an altogether different influence rules the language in which it is couched, - an influence probably emanating from the west of India. The Mixed Sansktit of the Buddhists of the North-West is the Praksit orthography which was the most closely allied to Literary Sanskrit, and it was it which, in all likelihood, was the soonest fixed in a lasting tradition. It is very possible that PAli owes something of its archaic character to this leaning towards etymological orthography of which Western India has furnislied us with multiple proofs. The tradition of it must have been, to a certain degree, preserved by the sect to which we are to attribute the drawing up of the southern Tripitaka. From this point of view there is one fact which seems to me to be sufficiently striking to deserve being mentioned here. Three provincial Prakrits hold the place of honour in the grammars, the Maharashtri, the Magadhi, and the Sauraseni. It would give quite a false idea of the Prakrit grammarians to imagine that they claimed, under these three names, to include all the principal families of the popular dialects. Their only aim was always practical utility, and we shall be in no danger of wronging them if we affirm that they never conceived the idea of a general and methodical classification of all the Prakrit dialects. It is upon special conditions, local or bistorical, that the importance of these three dialects must be founded. Now, we learn from their origins, as indicated by their names, that they exactly correspond to the homes of the three systems of writing which the monuments allow us to descry in periods earlier than the grammatical one; the Maharashtri to the Monumental Prikrit of the West coast; the Magadhi to the official orthography of Piyadasi, and the Saurasoni, the one which possesses the most archaic aspect, to the Sanskritizing Prikrit of Mathura and the North-West. It seems that the more or less obscured recollections, the more or less interrupted perpetuation, of a tradition, founded on early attempts at writing, set in movement in these three homes, and at least facilitated the creation of literary dialects. Whatever may be the value of this conjecture, one conclusion is certain. It is only in
Page #293
--------------------------------------------------------------------------
________________ SEPTEMBER, 1892.] THE INSCRIPTIONS OF PIYADASI. 275 the circumstance of an earlier tradition, local, religious or Literary, kept up by means and under conditions which may have varied, that the grammatical reform, from which sprang the grammatical Prakrits in the form in which we know them, can have been possible. I am here content with pointing out the fact in its general aspect. I have not set myself to approach the thorny questions of literary history which surround the pecaliar origin of each of these dialects. I have at least wished to shew, while laying before the reader the proposition to which the facts of philology appear to me irresistibly to drive us, that as a whole it presents nome of those insurmountable difficulties which a mind pre-possessed by different theories might expect. In concluding, I wish to remark that this necessary allowance of a previous tradition, is an important corrective to what might seem too positive in my statements regarding the final redaction of the Pali or Praksit books. This reserve is indispensable. As for laying down the limits in each particular case, for accurately distinguishing between what is the work of the last editors, and what the inheritance of earlier tradition, such a task would be infinite. Perhaps we shall never be in a position to accomplish it in its entirety. PART IV. CONCLUSION. The above observations have led me to touch on most of the more general problems which the linguistic history of ancient India presents. I cannot conclade without summing up the principal conclusions to which I have been conducted. They are, in several respects, in conflict with generally received ideas; but we must consider that, hitherto, the examination of these questions is, as is admitted by all, far from having ended in categorical results.14 Our knowledge on this subject is still too incomplete, too floating, to allow a little novelty to excite surprise or to justify distrust. I have dealt with one sole order of considerations, with arguments based on epigraphy and philology, the only ones which were called forth by the principal subject of this work. I consider that these argaments furnish my views with it sufficiently solid basis; and I have every confidence that proofs of other kinds will come to add themselves to mine, and to gradually confirm them. I shall not be charged, I think, with having disdained these other sources of information. I well know all their value. Even if it be not true, as I think it is, that the series of facts to which I have confined myself is the one most likely to lead us to decisive results, the other considerations would hardly come within the limits which have been laid down for me. The principal literary dialects of ancient India are three in number; the Vedio language, Classical Sanskrit, and the group of Prakrits. To these we must add that idiom which was in a way intermediate between Sanskrit and Prakpit, for which I have proposed the name of Mixed Sanskrit. 1. So far as concerns the religious language of the Vedas, the inscriptions of Piyadasi indirectly testify that it was, at the commencement of the 3rd century before our era, the object of a certain amount of culture, and that this culture was purely oral. That is a point which has been discussed in the preceding chapter. 2. As for Classical Sanskrit, its elaboration in the Brahmanical world, essentially based on the Vedic language, and on the school-language which might have formed, so to say, its prolongation, but enlivened by the first applications of writing to the popular dialects, should be placed about the 3rd century B. C., and the time following. Its public or official employment only commenced to spread abroad at the end of the first or at the commencement of the second century. No work of the classical literature can well bo of earlier date than this epoch. 3. Mixed Sanskrit is only a manner of writing Prakrit, consisting in going as near as possible to the orthography and the etymological forms known to the religious language. 14 I nay refer the reader to the recent preface pat by Prof. M. Muller at the commencement of his Sanskrit Grow mar for beginners, p. V., and also to the preface of Prof. Whitney's Sanskrit Grammar.
Page #294
--------------------------------------------------------------------------
________________ 276 THE INDIAN ANTIQUARY. [SEPTEMBER, 1892. Its use, born spontaneously with the first attempts at writing, continually developed, fom the edicts of Kapur di Giri to the epigraphs of Mathura. Used specially by the Buddhiste, it stimulated the Brahmans to the codification and diffusion of a more consequent, more refined language, profane Sanskrit. The coming into use of Literary Sanskrit marks its disappearance. It had, in the meantime, owing to its diffusion in the reign of Kanishka, assured its own survival, as a semi-literary dialect, in certain Buddhistio schools. 4. There remain the Prakpits. Popular in their origin, they have, in the form in which they have been employed, and which has come down to us, undergone a process of fixation, and of orthographical and grammatical reform. It is Sanskrit, and the exactly analogous process of learned labour to which Sanskrit owes its own existence, that inspired and guided this process. It cannot have taken place before the end of the 2nd century, and towards the end of the 4th we may suppose it & completed operation. None of the grammars which teach the literary Prakrits, and none of the books couched in one or other of these dialects, can, under its existing form, be of earlier date than this period. At the same time, it must be clearly understood that, far from excluding the existence of literary attempts and of a more ancient tradition, this theory supposes them as an indispensable preparation. It only excludes the idea of works having received a definitive form, of a canonically arrested tradition, the existence of which would have rendered all grammatical reform both superfluous and impossible. It is needless to say that the correctness of the dates which I have just now mentioned depends, to a very high degree, on the correctness of the dates which wo attributed to the inscriptions. The chronological series of the monuments appears to me to be well established, and if we suppose that some corrections in it are necessary, I do not imagine that they can be found to be of sufficient extent to modify the main lines which I have sketched out. Everything, in this system, depends on, and follows, one natural and well-connected movement. The same tendencies, which we see at work in the earliest times, continue their action to the end. Throughout evolutions, each of which pre-supposes and engenders the next, the main motors remain identical. The continuation of the linguistic history during the period which we have surveyed, is the logical development of the tendencies which are revealed by the most ancient monuments. In this sense, this last chapter is closely connected with the direct object of our studies, the Inscriptions of Piyadasi. FINIS. THE DATES OF THE VAGHELA KINGS OF GUJARAT. BY G. BUHLER, PH.D., LL.D., C.L.E. In my review of Dr. Bhantarkar's most valuable Report on the Search for Sanskrit MSS., 1883-84, (ante, Vol. XVIII, p. 184ff.), I expressed strong doubts as to the correctness of the Vaghela dates, given in his new historical Fragment, p. 12, and by the Dharmasagara in his Pravachanapariksh, op. cit. p. 150. But I was unable to furnish strict historical proof that Dr. Bhandarkar's two authorities post-date the accession of Vi saladeva and of two of his Baccessor's by two years. Lately Rao Saheb D. P. Khakar, who has already furnished numerous valuable contributions to the history and archaeology of Kachh, has kindly sent me an eye-copy of a mutilated inscription, which settles the question. It is incised on & Palia at Khokhra in Kachh, of which Rao Saheb Khakar gives the following account: "The Palia has a figure of a cow, feeding probably on Indian corn (maize) and suckling her calf. This Palia is stated to have been in the Fort of Bhadreshwar. But a Thadeja daughter of the village of Khokhra, near Angar, having married in Bhadresh war, she thought that the cow might be worshipped in the Mahadeva temple in her father's village, and so she sent it there, where the inscription was all buried, and the cow was worshipped. When I learnt of it in Sam. 1939, I got with great difficulty the buried portion of the Palia excavated,
Page #295
--------------------------------------------------------------------------
________________ SEPTEMBER, 1891.] FOLKTALES OF HINDUSTAN. 277 and found that the portion of it on which the object of the inscription was written, had been broken and lost, and after a year's inquiry I got no trace of it." The fragment of the inscription, which appears to be written in the ordinary Devanagari oharacters of the thirteenth century, rune as follows: i Om | Samvat 1882 varshe Marga sudi 11 Sanav=ady-eha sri2 [ma]d-Anahillapatake samasta-rajavali(ya*)-samalamkrita-mahara3 jadhiraja-paramosvara-paramabhattara ka-pro-[prnu]dba-pratima(pa). Nari4 ya[q-]vatara-lakshmi-svayamvara-maharaja-sri-Saramgad va-ka5 lyan -vijaya-rajye eri-sri-karanado(dau) mahamatya-sri-Mava6 va-mahar radhi---sri-Kath8 samasta-vyaparan paripamri(tha)ya ........... The document belongs, therefore, to the reign of the Vaghola king Sarangadova and mentions a minister, called Kinha, i.e. Krishna. Its date Samvat, i.e., Vikrama-Samvat 1332, Marga sudi 11 Sanau corresponds, according to Dr. Schram's Tables with Saturday, Dec. 1. 1275 A. D. The year was an expired year, both according to the northern and the southern mode of calculation. The conflicting statements contained, the one ir. the Vicharasreni and Mr. BhQ Daji's Pattavali, and the other in Dr. Bhandarkar's fragment and the Pravachanapariksha, are : Visaladova ruled (I). V. S. 1300-1318; (II). V. S. 1302-1320. Arjunade va ruled until (I). V. S. 1331 ; (II). V. S. 1333. Sarangudeva (I). V. S. 1353; . (II). V. S. 1353. The date of RAO Saheb Khakar's new inscription proves that tho Fragment and tho Pravachanapariksha place Saranga's accession too late and do not deserve to be oredited. FOLKTALES OF HINDUSTAN. BY WILLIAM CROOKE, C.S. No. 2.-The Parrot Prince and his Princess. Once upon a time there were two parrot kingdoms at Dehli and Hansna Vihar. The king of the former had a son and the king of the latter an only daughter. The subjects of both the kingdoms advised that the prince should take a wife and the princess a husband. So they both left their respective kingdoms in search of a partner. It so chanced that one night on their journey they alighted on the saine tree, and the parrot prince hearing the leaves rattlo enquired who was there. Each told the other who they were : and they were thinking of marrying together, when the prince said, "All women are faithless." "So are all men," said the princess. Thus they went on dispating and they finally agreed to refer the matter to the arbitration of the king of the country in which they happened to be. So they both attended the king's court, and he said, " Produce your proofs." Then the parrot princess said, "Once upon a time seven sons of a king went out hunting and came upon a grand house in a jungle. Now this was the house of a demon (deb), and the owner was away, leaving his six daughters and their handmaid in charge of his palace. The seven girls made friends with the seven princes, and they lived together for some time in the greatest happiness. Now the youngest prince had taken the handmaid as his partner, and one night he heard her say in her sleep, "What a misfortune has come on the wretched mother of these poor princes !" Next night she said the same words. So, when eating time came, the youngest prince refused to eat, unless the girl told him what she meant. After 1 These letters cannot be correct. 1 According to Profossor Jacobi's ner Tablos, published in the Epigraphica Indira, the eleventh tithi ended ou Saturday about 41 ghalikls after mean sunrise (Lauks). 1 A folktalo told by Dasrat Kharwar - the Kharwar is an aboriginal tribo iu South Mirzapur.
Page #296
--------------------------------------------------------------------------
________________ 278 THE INDIAN ANTIQUARY. [SEPTEMBER, 1892. some hesitation sle said "The six girls, whom your brothers have taken to live with you, are the daughters of a demon, and he eats men. When he comes back he will devour all the six princes." "Is there any way of escapep" asked the prince. "Well!" she answered, "If you get hold of the horses of the demon and cross the ocean at & single jump you can escape. To-morrow make a pretence of going out to hunt and do this. They did so, and just as they were jumping across the ocean the demon rushed up and seized hold of the hind legs of the horse, on which the youngest prince was mounted. Then the handmaid called out to her lover "Take your sword and cut off the hind legs of the horse and you will escape." The young prince did so, and the demon was left behind, and they crossed the ocean in safety. When they got over, the daughters of the demon asked, "How did you manage to escape our father P" "By doing as the maid, who was with me, told me to do," replied the Prince, who could not keep the secret. Then the demon's daughters fell on the maid and tore her to pieces. "By this," said the parrot princess, "you may learn that a man is never to be trusted." "Now, what have you to say?" asked the king of the parrot prince. "Well," he replied, "there was once a Raja, who married a Rani, and was bringing her home in a litter. By chance he got separated from his followers, and as they were going along the Rani was suddenly taken sick and died. The Raja took her corpse out of the litter and laid it on a river bank. Seeing this dreadful sight the bearers all ran away. The Raja sat down by the corpse, and began to sing Ram ndmi. The God Mahaded, who generally lives in solitary places, came up and asked the Raja why he was lamenting. He told Mahade of the misfortune that had fallen on him. "If I bring the Rani to life, will you surrender half your life P" Asked Mahade8. "I agree," said the Raja. So Mabade8 poured a little water on the Rint out of his jar (leamandal) and the Rani came to life again. Mahad88 went away and the Raja and Rani lay down to rest. While the Raja slept a merchant (mahdjan) came up with a horse laden with gold mohars, and the faithless Rani abandoned the Raja, who had saved her life, and ran away with the merchant." "By this," said the parrot prince, "you may learn that all women are faithless." Then the Raja, who was trying the cause gave his decision-"Men as well as women," said he, "have their faults and the best thing you can do is to get married." And so they were married and ruled their two parrot kingdoms for many a year in happiness. NOTES AND QUERIES: SUPERSTITIONS ABOUT ANIMALS IN MADRAS. Kito there is a tradition among the Hindus of It is considered one of the greatest sins that a Southern India, that the bird serves as the vdha. man can commit to kill a cow or taste its flesh: nam (vehicle) of Vishnu, and on Sundays he is and it is also laid down that to eat curde, ghi, supposed to ride on it in the morning. Hence and honey together is an equal sin. the Brahmans especially anxiously look out for it on Sunday mornings, in order to pay their respects When cattle oross your path it is considered to Vishnu, through his sacred bird. On seeing a sin to pass through them. You must wait till it the ordinary Brahman recites the following the way is cleared and then go on. slkam, which he supposes to be Sanskrit :When flying-foxes are flying about during the Kunkumamkita varnaya day, it is a sure sign of a shower of rain Kundhandhu kavalayicha immediately. Vishnuvdhana namasthubhyan About the Garudan or Royal Eagle or White Pakshirdja athe namaha. (This is a very interesting variant of the notion of the difficulties that hedge round the folktale demon and life-index.-ED.) *[So sensible and moral an ending to a "tricks of women" story is well worthy of remark.-ED.]
Page #297
--------------------------------------------------------------------------
________________ SEPTEMBER, 1892.] BOOK-NOTICE. 279 4. Never look at the fox.or jackal in the morning, but note the proverb: - "Did you wake this morning with a fox in your face P" N. SANKUNNI WARIYAR. Some of the Brahmans believe that if a person sees this bird flying in the sky on a Sunday morning, at any time before breakfast, he will attain fulfilment of all his enterprises during the ensuing week. Among the lower castes of the Hindus the ceremonies have a different aspect. Their prieste buy a small quantity of flesh from the basdr and bring it home. With this they make it & point to feed the bird, and wait outside their houses for it to fly over them. When they see one they throw up bits of the meat, inviting the bird to take them. When the bits are all taken they pay obeisance to the bird and take leave. After this they bathe and take their meals, considering themselves to have received the benediction of Vishnu. K. SRIKANTALIYAR. MALABAR COAST. Lucky Actions. 1. Always throw the outer rind of the arecanut into the street, so that people walk over it. 2. Turn to the right when getting up in the morning from your bed. N. SANKUNNI WARIYAR. MALABAR COAST. Unlucky Actions. 1. Never let anyone tread on the nails of your fingers or toes, lost be become your enemy. 2. Never pour water into a chunam pouch at night. 3. Never take off the inner coating of the areca-nut at night. SPIRIT HAUNTS IN MADRAS. Hvil spirits seek always for their abode that portion of a tank or a river where someone has been drowned and lost his life, or the following trees : 1. Ficus Religiosa, pipal, (Arasu in Tamil); 2. Asadirachta Indica, Nim. (Vombu in Tamil); 3. Tamarind (Puliyam in Tamil), Hence virgins, or pregnant women, and children, are usually warned not to approach these places at any time during the day or night. K. SRIKANTALIYAR. Ootacamund. BOOK-NOTICE. JOURNAL OF THE MAHA-BODHI BOCIETY. Edited by H. DHARMAPALA, Caloutta, May 1892.No 1. Baptiat Mission Press, for the Buddha Gaya Mababodhi Society. The Buddha-Gaya Mahabodhi Society, or the Bud-Gayal Society, for it is a little difficult to make out its title clearly from the publication before us was, we find, established at Colombo on May 31st, 1891, under the auspices of Colonel H. S. Olcott. This is good and also bad. Good because the Colonel has already shown that he can control & Society and a Journal which can live, and bad because he has also shown that his views of the Buddhist Religion are as bold as they are delightfully yisionary. The complete and unconscious misapprehension of every aspect of the subject he affects to have deeply studied is indeed the most charming part of the addresses he delivers. He is always poetical and nearly always wrong in every view to which he gives expression. He is " chief adviser" of the new Society, and in the first number of its Journal are many echoes of his ideas. There is the same magnificent disregard of actual facta, and the same enchanting inaccuracy as to details in historical references on every page, that have always distinguished the writers on Theosophy. Here is a fine sample: "It is only a baseless tradition that Buddhism was destroyed by the Aryans. As yet no evidence has been forthooming to show that the vandalism was done by them. But, on the contrary, there are facts and historical data to prove conclusively that the catastrophe was accomplished by the Muhammedan(sic) invaders of India. The temples of Vishnu, Siva and other devatas (sic) did not escape the fire and sword of the devastating Moslem. The destruction of Buddhism dates from the time of the invasion of India by Muhamad (sio) of Ghazni." Could anything be more delightful than this Just before the above passage we are told "that Buddhism was destroyed seven centuries ago in 1 It is to be hoped that. Bud-Gaya' will be dropped as hopelesaly wrong etymologically.
Page #298
--------------------------------------------------------------------------
________________ 280 THE INDIAN ANTIQUARY. India is beyond doubt." Muhamad (speaking under Col. Olcott's correction we understand that the conqueror's name was, however, Mahmud) of Ghazni we thought lived nearer nine centuries than seven centuries ago. But then, two centuries of time are as nothing in the retrospect of a poet! And we are glad to hear, because it is news, that it was the wicked Muhammedan' (we follow the 'chiefly advised' writer in making 'Muhammedan' the correct adjectival form of Muhamad') who carried through the destruction of Buddhism in in India from start to finish. A little lower down we learn how it was done : "From the tenth to the twelfth centuries a systematic vandalism of sacred shrines was carried on by the devastating hordes of Arabs under Muhammedan generals." The armies of the Ghaznavi and Ghori generals were, of course, all Arabs! We are learning quickly indeed; but there is yet more to learn - much more than was ever dreamt of in our philosophy: "From the twelfth to the sixteenth century indigenous literature was not only not allowed to be cultivated, but every method was adopted to stamp out a national growth." O shades of Akbar and Jahangir and Dara Shikoh! O Chand Bardai! O Kabir! O Guru Nanak! O Tulsi Das! O ye Medieval Reformers! what say ye to this ? However, the Muhammedan' is evidently a red rag to the writers in the Journal of the Mahabodhi Society, and it may be that their personal feelings. have warped their sense of historical accuracy. The Journal is severe on those who differ from its views. Sciolists and superficial critics, failing to grasp the philosophy, and merely for the sake of notoriety, condemn Buddhism as atheistic." Granted for the sake of argument. Let us hear what the scientific and deep critic has to teach us - - for we confess to being with the sciolists in this matter: "The cherished gods of the Aryans, the mild Vishuu, the protecting Brahma, and the guarding Indra (the differentiation between protecting' and guarding' is distinctly good), besides most of the devas and devatas have not been relegated into the land of myths. They have a niche in the pantheon of gods in the Buddhist system." 4 "The pantheon of gods in the Buddhist system" exhibits a truly scientific appreciation of the Buddhist philosophy no doubt, but we shall remain sciolists' nevertheless. Passing by the muddling together of devas and devatas', as exhibited in the extracts already [SEPTEMBER, 1892. quoted, we have to note a peculiarity in the Journal, which is typical of the theosophic variety of the scientific man. Outer sciolists, who lay claim to some knowledge of Indian languages, have a habit, when transliterating, of diacritically marking certain letters to show their form in the original. The scientific theosophist always tries to do the same, and the result is invariably startling. We have fine specimens before us now, e. g., Vaishnava, Magadha (the country), Kusinagara, Priyadasi (this is most excellent, for it has the advantage of being neither Pali nor Sanskrit), and so on. And then again, if you write Siva and Saiva (p. 3), why write Sri and Sankaracharya. If the Mahabodhi Society's views of things ancient are astonishing, its ideas on contemporary movements are equally so: ultimate development, and it is impossible to go "The intellect of the educated has reached its back to the dualistic stage of religion, when scientific monism is gaining ground among the highest intellects of Europe and America. This scientific monism is the Advaita Philosophy of ancient India. This scientific and realistic monism in all its comprehensiveness was promulgated by Gautama Buddha twenty-five centuries ago." This is well conceived, but the following is better from the pen of the chiefly advising' Colonel himself: "Western dogmatism cannot stand before it (the Arya Dharma of Sakya Muni, miscalled Buddhism'). Western men of light and learning welcome it, the weary-souled begin to hail it with enthusiasm. The two chief reviving agencies, the two channels through which it is flowing, are a book and a Society- -the Light of Asia and the Theosophical Society. Ten years hence Buddhism will have gained an unshakable foothold throughout Christendom." This is enough for us! When Western man of light and learning accept the Light of Asia as a true exposition of Buddhism the Christian will deserve to go down before the Buddhist. We have thus dwelt on the errors in the Journal fully sympathise with the general aims of the of the Mahabodhi Society at length, because we Society, which are apparently to protect the remains at Buddh-Gaya from further neglect, to misappropriation, and to ensure the preservation secure the funds of the temple from further of Buddhist literature. The sooner therefore the conductors of the Journal of the Society cease to publish downright nonsense the sooner will they secure respect towards themselves, and general sympathy with their laudable objects.
Page #299
--------------------------------------------------------------------------
________________ OCTOBER, 1892.) TAMIL HISTORICAL TEXTS. * 281 TAMIL HISTORICAL TEXTS. BY V. KANAKASABHAI PILLAI, B.A., B.L. No. 3.-AN INSCRIPTION OF KULOTTUNGA-CHOLA! THE inscription, which I now publish, is on the southern wall of the Bhaktavatsalasvamin 1 temple at Tirukkalukkugram in the Chingleput District, Madras Presidency. It was copied by me on the spot, but I have not been able to make out a correct reading of the whole of the inscription, as it is much faded and in some parts illegible. It is in Tamil characters of the Eleventh Century A.D. The first part of it is a eulogy on the reigning king, and is in verse in High Tamil; the latter part is in ordinary prose and records the purchase of a piece of land by the temple authorities. The original text of the poetical portion appears to have been composed by a writer well versed in classical Tamil. It has beep engraved, however, either very carelessly or by ignorant hands; even common words have been misspelt, and no distinguishing mark has been made to denote the end or commencement of each line of the verse portion. The language being High Tami], and the characters somewhat indistinct, the deciphering of this part of the inscription would have been impossible, if I had not fortunately had with me copies of inscriptions, which I had taken from other temples in the Tamil country. Three of these, which I detail below, have been of much 180 to me in reading this text. INSCRIPTION No. 1. An inscription on the northern side of the Vimana of the temple dedicated to Pandava data-Perumal at Kanchipuram, which commences with the first 25 lines of the present test, and continues as follows: Text. Nan mani dramum tiruppayattalankalum pola viramum tiyakamum vilanka parmicha mevalar vananka vira chimmichanattu puvanamulutadaiyalodum virrirontaruliya Korajakogarivarmmarana Udaiyar sri-Kulottunga-Choladevarkku yanda anchavatu ....... Translation. In the fifth year of the lord sri-Kulottunga-Chladeva, alias KO-RAjaksarivarman, (here enter the translation of the first 25 lines) whose valonr and munificence shone like the necklace of faultless gems and the garland of flowers on his shapely shoulders; who deigned to sit on the throne of heroes with the goddess Earth, while his enemies bowed down to the ground before him. INSCRIPTION No. 2. An inscription in very clear characters, on the western wall of the Saiva temple at Kilpaluvur in the Trichinopoly District, which begins with the same words as in the present text up to the end of the 62nd line, and continues as follows: Text. Neritorum nilaika! iddaruli tiral ko! vira simhasana veddaruli ponkoliyaramum tiruppayattalankalum pola viramum tiyakamum vilanka parmichai mevalar vananka vira simhasanattu avanimulatudaiyalodum virsirauntaruliya Korajakesarivarmmarana Tiripuvanachakkaravarttikal sri-Kulottunga-Choladdvarkku gandu irupatavatu ........ Translation. In the twentieth year of the emperor of the three worlds, bri-Kulottunga Choladova, alias K-Rajakesarivarman, (here enter the translation of the first 62 lines) who erected on all the public paths boundary-marks of his territories) and obtained the throne of mighty heroes ; whose valour and munificence shone like the resplendent necklace and the garland of flowers on his sacred shoulders; who was pleased to sit on the throne of heroes with the goddess Earth, while his enemies bowed down to the ground before him. 1 The spelling of vernacular words in the English portion of this paper has been altered in accordance with the system followed in this Journal. The Tamil texts have been left intact, as no facsimiles were to hand.-ED.)
Page #300
--------------------------------------------------------------------------
________________ 282 THE INDIAN ANTIQUARY. [OCTOBER, 1892. INSCRIPTION No. 3. An inscription on the eastern wall of the Saiva temple at Tiruvidaimarud or in the Tanjore District, which begins with the first 66 lines of the text and proceeds as follows: Text. Chivanidattumaiyena Tinachintamani puvanamulutadaiyalodum kaokaiverrirantena man kaiyar tilatam lichaivallapi frelulakamadaiya! valiyumalarntinitiruppa aliyum tirumalakattuppiriyatena tirumakal tikallena Tiyakavalli taruma ulakudaiyaliruppa . . . pavanamolutudaiyalodum virsiruntaruliya Kovirajakosarivarmmarana Chakkaravarttikal brt. Kalottunga-Choladevarkku yandu 26 vatu nal narrelupattirandinil ....... Translation, On the 172nd day of the 26th year of the emperor bri-Kulottunga-Choladeva, alias KO-BAjakesarivarman, (here enter the translation of the first 66 lines) who, worshipped by the whole world, was pleased to sit in state with Dinachintamani, the mistress of the whole world, like 'Siva with Uma, and with Elibaivallabhi, the mistress of the fourteen worlds, the moet beauteous amongst women, like Ganga with Uma, and with Tyagavalli, the charitable mistress of the world, like Lakshmi who is ever inseparable from Vishnu, and with the goddess Earth. Comparing the above three inscriptions with that which is the subject of this paper, and which is dated in the 42nd year of the emperor bri-Kulottunga-Choladova," it will be seen that it is beyond doubt that all the four refer to the same sovereign, because his name is given as Kulottunga-Chola in all of them, and the events of his reign mentioned in the earlier inscriptions are repeated in the very same words in the later. Considering the facts that these inscriptions are found in places very distant from each other, and that the same verses have been used for describing the reigning king, it would appear that it was the custom during this period to adopt a prescribed form of preamble in drawing up any important deed ; and as that form was in verse, it is most probable that it was composed by a poet of the king's court and circulated under royal sanction. This is borne out by epigraphical records of other Cho la kings; for instance, the inscriptions of Rajaraja-Chola begin with the words "Tirumaka! pola perunilachchelviyum"; those of Vikrama-Chola commence " Pumalai milainta ponmalai tikala"; those of Rajendra-Chola open with the verse "Tiru manni valara irunilamadantaiyum." The four inscriptions of Kulottunga noticed in this paper furnish a short history of his life. While he was Yuvaraja, he first distinguished himself by storming Chakkarakottam. He surprised the enemy there and captured a number of elephants, but left no permanent trace of his conquest. Then he had to fight against the kings of Kuntala, that is the Western Chalukyas. About this time the Chola country came to be without a king, and he marched southwards, and by right of inheritance ascended the throne of the Cholas. Before the end of the fifth year after his accession he vanquished the Southern or Pandya king, who was either taken prisoner, or killed in battle; for the inscriptions state that his head lay, pecked by eagles, outside the Chola capital. Vikkilan, who is doubtless the Western Chalukya Vikramaditya VI., then invaded the Chola territory, but had to retreat before the superior forces of the Cholas, and was hotly pursued from Nangali in the Mysore province to Manalar on the banks of the Tungabhadra, where he crossed the river and sought safety within his own dominions. An expedition towards the west was next conducted by Kulottunga in person, and Kongumandalam was subjugated. Two expeditions were also sent to Singhalam, apparently with no great results. Then he wisbed to conquer the Pandimandalam, and equipped a large army. After the death of the Pandya king above alluded to, his kingdom evidently became dismembered, and five Pandya princes, who were in power, fled in dismay before the Cho's forces, and sought refuge in These were most probably the two Chode invasions mentioned in the Mahatansa (chap. lviii.) as having occurred during the early part of the reign of Vijayabahu.
Page #301
--------------------------------------------------------------------------
________________ OOTOBER, 1892.) TAMIL HISTORICAL TEXTS. 283 inaccessible jungles. The whole of the Pandya country as far as Cape Comorin and Kottara was annexed to the Chola empire. Then the pearl fisheries in the Gulf of Manaar and the wild elephants on the Western Ghats became the property of Kulottunga before the close of the 20th year of his reign. It was, I believe, after this important event that he proclaimed himself "emperor of the three worlde;" for in the inscription No. 1 his name is given as "Udaiyar sri-Kulottunga-Choladeva," whereas in No. 2 it is "Tribhuvanachakravartiga! eri-Kulottunga-Chladeva." Within six years afterwards the Kalingamandalam was conquered; but from the 36th to the 42nd year the empire seems to have enjoyed peace, no mention being made of any wars in subsequent inscriptions. Three of Kulottunga's queens are named in the inscription No. 3, viz. Dinachintamani, Elisaivallabhi and Tyagavallt; but only the last two are mentioned in the text, which forms the subject of this paper. No era or astronomical day is given in the inscriptions to enable us to ascertain the period of the king's reign; but from the leading events mentioned in them, it is certain that he is identical with the Kulottunga-Chola of the Kalingattu Parani. The poem speaks of his early exploits at Chakkarakkottam (canto x. stanza 23), the anarchy. in the Chola country (x. 26), his Bccession to the Chola kingdom (x. 32), the defeat of the five Pandya princes (xi. 69), the battles on the banks of the Tungabhadra (iv. 7) and at Manalur (xiii. 93), the conquest of the Kalingamagdalam (xii. 68), and the queen Tyagavalli (x. 55). All these particulars occur in the inscription also. I have in my article on the Kalingattu Para identified the Kulottunga-Chola of that poem with the first Eastern Chalukya king of the same name. And as it appears from inscriptions in the Telugu country that he bore the name of Rajendra-Chola before be acceded to the Chola kingdom, there is no doubt that he is also that "Rajiga, the lord of Vengi," who, according to the Vikramdikadevacharitat took possession of the throne of Kanchi on the death of the Chola king. From the Chellar grant we learn that Kulottunga's third son, Vira-Chadeva, was installed as viceroy of Vengi in A.D. 1078, and that before him, Kalottonga's second Bon, Rajaraja II., held charge of Vengi for one year, and his uncle, Vijayaditya, for fifteen years, It follows therefore, that Kulottunga succeeded to the crown of Vengi in A.D. 1063.5 But there is no record to show when he ascended the Chola throne. From Tami) inscriptions I find that a Chola king named Vira-Rajendradeva, alias KO-Parakesarivarman, claims to have "bestowed the vengimandalam on Vijayaditys who had bowed at his feet, conquered Kadaram for another king who had besought his assistance, forced som svara to give up the Kennaradesam and drove him out of that country, and reduced Irattapadi for Vikramditya who had sought refuge at his feet." The king's alluded to appear to be Vijayaditya VII., viceroy of Vengt (A.D. 1063 - 1077), the Western Chalakyn som bvara II. (A.D. 1069. 1076), and Vikramaditya VI. (A.D. 1076--1127). That Vijayaditya was in danger of being deprived of his power by the Cholas, is also evident from one of the Ganga grants, in which it is stated that, "when Vijayaditya, beginning to grow old, left the country of Vengi, as if he were the sun leaving the sky, and was about to sink in the great Ocean of the Cholas," Rajaraja of Kalinganagara (A.D. 1071-1078) "caused him to enjoy prosperity for a long time in the western region." The above records seem to indicate that Vira-Rajendra, alias Ko-Parakesarivarman, was the immediate predecessor of Kulottunga on the Chola throne, was contemporary with the Western Cbalakya Someavara II., and helped his younger brother, Vikramaditya in wresting from him a portion of the Chalakya dominions; also that Kulottunga did not take possession of the Chola kingdom till about A.D. 1071. This is confirmed by the Vikramankadevacharita, which states that "the lord of Vengi" seized the Chola sovereignty some time after the death of Somesvars I. which occurred in A.D. 1069, and before Someevara II. was taken prisoner by Vikramaditya VI. in A.D. 1076. If Kulottunga had reokoned his regnal years from the day of his accession to the throne of Vengt, the date of the following inscription, which is in the 42nd year of his reign, would fall in A.D. 1106. ante, Vol. XIX. p. 888. * Dr. Buhler's edition, chap. vi. verse 26. Dr. Haltssch's South-Indian Inscriptions, Vol. I. pp. 49-82. .See Dr. Fleet's article on the Eastern Chalukya Chronology, ante, Vol. XX. p. 276.
Page #302
--------------------------------------------------------------------------
________________ 284 THE INDIAN ANTIQUARY. [Ostovkv, 1892. The concluding portion of the inscription, which is in prose, records a deed of sale, executed by the Brahman proprietors of a village named Vanavanmahadevichaturvedimanga..am in Kumilinadu in Amarkottam in JayankondachoJamandalam. The property sold was a portion of the village, which was intended to be used as garden land for the Matha of Naminandi Adigal attached to the Saiva temple at Tirukkalukkupram. Naminandi is the name of one of the 63 devotees of Siva, an account of whose lives is given in the Tamil Periyapuranam, and the Matha was probably founded by him or by his descendants in his memory. The fact that the proprietors of the village met together in a Mahasabha or great assembly, and executed this deed of sale, is evidence of the ancient system of land tenure peculiar to the Dravidian people, under which the residents of each village were the common proprietors of all those parts of the village, which were not appropriated to any individual. Two taxes are mentioned, the peruvaram (great share) and silavuvari (expenditure tax). The first is the king's share, which is generally one-sixth of the produce; the second appears to be a local cess, levied to meet expenses incurred in the repair to tanks &c. in the village. TEXT. Svasti Sri! Pukal chulnta punari akal chulnta puviyil Ponnemi alavum tannemi nadappa Vilanku chaya makalai ilankopparuvattu Chakkarakkoddattu vikkiramattolilal (5) Pata manam punarntu mata varai Iddam Vayir akarattu vari ayil munai Kuntala arachar tantalam iriya Val urai kalitta tol vali kaddi Porppari nadatti kirttiyai nirutti (10) Vada tichai vakai chudi ten tichai Temaru kamala pamakal potumaiyum Ponni adaiyan nannilappavai Tanimaiyum tavira vantu punitaru Tiru mani makudam arimaiyil chudi (15) Tannadi irandum tada mudiyaka Tonnila ventar chuda munnai Manu varu peruka Kali yara varappa Chenkol tichai torum chella venkudai Irunila vilakam enkanum tanatu (20) Tiru nilal vennila tikala Oru tani meruvil puli vilaiyada Al kadal tivantatarttu pupalar Tirai vidu kuncharam murai saurai nirpa Vilaikiya Tennavan karuntalai paruntalait (25) Tidattan ponnakar purattidai kidappa Cholletir kodirrallatu tankai Villetir koda Vikkilan kallatar Nankili todanki Manalar naduvin (30) Tunkapattirai puka turatti enkanum Padda veikalirum kedda tan manamum Kuriya viramum Erina malaikalum mutuku nelippa Ilinta natikalum Arudaintoda [Compare fil-vari pery, vari, 'the small tax (and) the large tax,' in Dr. Hultzsch's South-Indian Inscriptions, Vol. I. p. 87, text line 6.]
Page #303
--------------------------------------------------------------------------
________________ OCTOBER, 1892.] TAMIL HISTORICAL TEXTS. (35) Vilina kadalkalum talai virittalamara Kudatichai Tannalukantu tanum tanaiyum (40) Cheyapperuntiruvum vala onkan Madantaiyar iddamum milatu kodutta Venkari niraiyum Konkumandalamum Sinkalam ennum parani irandum Iruvichai kaikondu inaiviya pukalodu (45) Pandimandalan kola tiravalattadaittu Vempari talaikalum poru kari kulankalum Tantira variyum udaittay vantu Vada kadal ten kadal padarvatu pola Tan perunchenaiyai evi Line 42. Line 57. (50) Panchavar aivarum poruta porkkalattu Anchi veruvi nelittodi Aranena pukka kadarattadaittu Marravar tammai vanachararakki Orraivechuram errikorra (55) Vichaiyat tampam tichai torum nirutti Muttin Chilapamum muttamil Potiyilum Matta veikari padum maiyya Chaiyyamum Kanniyum kaikkond arulittennad Ellaikaddi kudamalai naddularachar (60) Ellam tani vichum pera Kurukalar kulaiya Kottar ulpada Neritorum nilaikaliddaruli naripunal Kalingamandslamum kaippaduttarulis (65) Tiral kolaramum tiruppayattalankalum pola Viramum tiyakamum vilankappartola Chivanidattumaiyena Tiyakavalli Avani mulatudaiyaludan iruppa, avaludan Kankai virrirantena mankaiyar tilatam (70) Elichaivallapi elulakam udaiyal Valirum ponninitiruppa Alichulavani mulutudaiyalodum I give below the different readings in the preambles of the four inscriptions of Kalottanga-Choladeva which I have examined. A stands for the inscription at Kanchipuram, B for that at Kilpaluvar, C for Tiruvidaimarudur and D for Tirukkalukkupram. Line 2. A has nadatti for nadappa. Line 5. A has vankaliru for matavarai. B and C have matuvarai for matavarai. Line 12. A has ponnaniadaiyum for ponniadaiyum. Line 13. A and D have tavirtu for tavira vantu. Line 16. A has ponni for munnai. Line 20. Line 23. 285 B has tirunilal venkudat for tirunilal. A has kalancher kaliru for kuncharam. B has kalancherriraju for kuncharam. C has kalanchori kaliru for kuncharam. B & C. have kanka for konku. B has teyva for chayya. Line 59. B has eval for ellai. Lines 63 & 64. D has appulattalankalum konkumandalamum for maripunal kalinka mandalamum.
Page #304
--------------------------------------------------------------------------
________________ 286 THE INDIAN ANTIQUARY. [OCTOBER, 1892. Virachimmachanattu viriruntaruliya Chakkaravarttikal bri-Kulottunka-Choladevarkku yandu 4 vatu Jayankondacholamandalattu Amorkoddattu Kumilinaddu VanaVanmahadevichaturvedamankalattu makachepaiyom nilavilai Avanakkaiyeluttu. KalatturKumilinaddu Ulakalanta Cholapuramana Chembian-Tirukkalukkunrattu udaiyar tirakkalukkunpamudaiya Mahidevar kovil Chantia Chandesvaradevarkku naukal mada puramaka vittukkudutta nilamivatu: enkasur melmidani Kiraippakkam kaduket veddi kaddai pasittu tiruttikkolvataka kudutta nilattakka kilpaskellai Uromattellai apavum, tenparkellai Talaiveddellai usavam, melparkkellai Vikambattellai usavam, vadaparkkellai Tanduraiellai uravum, innankellaikkudpadda nirnilamum punchai nilamum menakkina maramum kil nokkinakinaram ivvur maduivilakattirukkum Naminanti Adikal Madattukkum madappuram ka nankal irai ilichchi vittukkuduttu vilaiyaka naokal kaikkonda achai nepkichu pattum kaivilai ara vittu porulasakkaikkondu vilai Avanam cheyta kaduttom. Maha sapai om innilattukku vanta chilavu vari peru varam epperppaddatum naokal irukkakkadavomikavum. Irai ilichchi vittukkuduttom. Chapaikku chamainta tarumavar Eddu vamavan Adittan Panapalapaddanum,Mappiraraka Kumarachovamikkieamalittanom, Usuppuddutta!Alappaddanum, Padmapurattu Sri Ranganatapaddanum, Appaddur Chankaranarayanapaddanum, Kavicharikkillai Tantikimavittanam, Kiranchikon Takkiramarittanam, ivvanaivarom chantratitta varaikkum chillekai pannikoduttom.Mahasabbaidm. Ippadikku ivai Vanavanmahadevi-udaiyan Chelvan Kumaran eluttu Amarkoddattu. TRANSLATION. Health and Wealth! In the 42nd year of the emperor br1-Kulottunga-Chbladera, who, in his youth, first embraced the goddess of victory by bis heroic deeds at Chakkarakottam, so that his empire on this earth, which is girt by the glorious ocean, may extend op to the golden mountain (Meru); wbo, by bis prowess, captured & multitude of rutting elephants, and routed the forces of the kings of Kuntala at the point of his lance; who leading his troops of horse and unsheathing his sword, displayed the power of his arm and established his fame by his victories in the northern countries, and, coming southwards, esponsed the goddess of the honeyed lotus flower (Laksbmi), and Ponni (Kaviri), and the good lady Earth, who was without a consort, and by right of inheritance assumed the sacred and illustrious diadem (of the Ch'as) ; whose pair of feet served as a broad crown to the ancient kings of this earth; who wielded his sceptre with such justice in all directions (in his dominions) that the rules of the ancient Manu prevailed and the river Kali (evil) was dried up; whose white umbrella shone like the moon over all the wide world; whose tiger (banner) played in the breeze) on Mern, without a rival; the elephants given in tribute to whom, by the kings of remote islands in the deep ocean, stood in many a row ; outside whose golden town, the black head of the Tennavan (Southern or Pandya king) lay pecked by engles; . . who drove from Nangili of rocky roads Vikkilan, that never bent his bow except on a foe who had failed in paying him due respect, and forced him to enter the Tungabhadra at Manalar, abandoning his elephants which lay wounded on all sides, and bringing disgrace on his fair fame and boasted valour; who, with his army, commencing bis march towards the west, on an auspicious day, caused the mountains to bend their backs, the rivers to forsake their beds, and the Vilina seas to be stirred and agitated . and seized the great goddess of victory, bevies of bright-eyed women, and whole columns of fierce elephants, which the enemy were unable to save, and the Kongumandalam; whose fame was angmented by two campaigns in Singhalam; who, desirous of conquering the Pandirandalam, directed his vast armies, which, with hosts of generals, squadrons of fleet horses and battleelephants, resembled the northern sea rushing to join the southern ocean, and when the five Pandyas fled in terror from the battle-field and songht refuge in the jungles, cleared those jangles and converted them into villages and made them (the Pandyas) lead the life of woodmen in a dreary wilderness, and planted pillars of victory on every side; who took possession of the [Read mel-piadgai.]
Page #305
--------------------------------------------------------------------------
________________ OCTOBER, 1892.) ALOMPRA DYNASTY OF BURMA. 287 pearl fisheries, and Podiyam, where flourished the three kinds of Tamil (literature), and the mid Sahya hills (Western Ghats), where huge wild elephants are captured, and Kappi (Cape Comorin), and fixed the limits of the Southern (Pandya) land; who sent to the upper world all the kings of the western hilly country . * and, scattering his enemies, erected on all the pablic paths boundary-marks (of his territories) including Kottaru; who conquered the Kalingamandalam of embanked floods; whose valour and munificence shone like the gorgeous necklace and the garland of flowers on his shapely shoulders; who, worshipped by the wbole world, deigned to sit on the throne of heroes with Tyagavalli, the mistress of the whole world, like Siva with Uma, and with Blisaivallabhi, the mistress of the seven worlds, the most beauteous amongst women, like Ganga with Uma, and with the goddess Earth, - the deed in writing of a sale of land by the great assembly of Vanavanmahadevi. chaturvedimangalam in Kumilinadu in Amarkottam in Jayankondacholaman. dalam. The land that we have sold and given, to be used as a garden for a Matha, to Chantillzo Chande varadeva of the temple of our lord Mahadeva of Tirukkaluk kunram in Sembiyan-Tirukkalukkupram, otherwise known as Ulagalanda-Cholapuram, in Kalattar-Kumilinadu, is as follows: Of the land which we have given in Kraippakkam [P] [a western hamlet) of our village, to be improved by cutting down the jungle and by removing the stumps of trees, the eastern boundary is Oromatta [P], the southern boundary is Talaivetta [P], the western boundary is Vigambam [P], the northern boundary is Taydurai [P]. Within these four limits, the wet land and dry land, the trees overground and the wells underground, we have sold to be used as a garden land for the Naminandi-Adigal-Maths in the madai-vilagan of this town, exempt from taxes, and we have received as the price achai nelli kasu ten. We have sold (the land and all our rights thereto) completely, and, having received the whole of the price, we have executed this deed of sale. We, the great assembly are bound to pay the peruvaram, the silavuvari, and all other taxes that may be imposed on this land. Exempt from all taxes we have given it. The representatives of this assembly are:13 ........... We all have had this deed of sale engraved, so that it may last as long as the sun and moon exist. We, the great assembly. This is the writing of Vanavanmahadevi. udaiyan Selvan Kumarap of Amarkottam. THE ORDER OF SUCCESSION IN THE ALOMPRA DYNASTY OF BURMA. BY MAJOR'B. C. TEMPLE. In Vol. XX. pp. 422-423, ante, reference was made to a statement that the rule of Succession in the Manipur State was, that all the brothers of the reigning king succeeded by seniority before his sons ; failing brothers the king's sons succeeded in turn. The line of succession would therefore run thus: - The living brothers in order of seniority, then the sons of the last brother in order of seniority. The tree of succession might in fact be as follows: A (1) Reigning king B (2) Eldest son d (3) Second son D (4) Third son Fourth son (died young) Fifth son. (died young) G (5) (6) * Read I diddaa ?.] 11 [Should the two preceding words be a misreading of katu 10 P.) 13 [The names of these people are omitted in the translation, as their spelling is very uncertain. Each of them has either the attribute bhafta or kramavid.)
Page #306
--------------------------------------------------------------------------
________________ 288 THE INDIAN ANTIQUARY. [OCTOBER, 1892. Eldest son Second son Third son (died young) K (7) Second son Eldest son (died young) L (8) M (9) Eldest son Second son The points to note in the succession are: - (1) the father must, if possible, actually have been king ; (2) brothers must succeed before sons. The next heir by analogy, failing brothers and sons, would be the oldest surviving son of the king before the deceased. E.g., in the above tree, if king M had no sons or brothers, then the sons of king L would succeed in turn, This custom is evidently widely spread over India and Barma, for (loc. cit. and ante, Vol. XV. p. 273) it has been already shown in this Journal that a part of the Valabhi succession ran thus: - Bhatarka (1) Dharaaona I (2) Dronasimha (3) Dhruvasena I (4) Dharupatta (5) Guhagena (6) The Genealogies of the Eastern and Western Chalukya Dynastios (ante, Vol. XX. p. 283, also p. 422, and Fleet's Dynasties of the Kanarese Districts, pp. 18-19) give the succession of brothers before sons in several instances; notably in the years between 633 and 663 A.D., and between 696 and 709 A.D. and between Saka 930 and 964. The Genealogy of the Maldr-KODA State (ante, Vol. XVIII. pp. 328-330) gives parts of the succession thus: - Sher Muhammad (1) Ghulam Hussain (2) Jamal (3) Bhfkan (6) Bahadur (5) Umr (6) Asadullah (7) Atau'llah (8) Wazir (9) Properly speaking Atan'llah's son should beve succeeded, and when Wazir's line failed a successor was found in Ibrahim 'Ali, (the present ruler), the great-grandson of 'Atau'llah. Throughout the Shan States ante, pp. 119-120) the rule of succession is brothers before sons in order of seniority. There are three disturbing elements in the rule, however, which must always be taken into consideration in its application :-(1) where the ruler has a multiplicity of wives, there must always be a dimoulty in determining seniority ; (2) in most Oriental States might is right and that heir suoooods, who is for any reason, the most powerful; and (3) the temptation, seldom witastood, to the de facto ruler to oust his brothers in favour of his sons. As a rule, it may be said that every brother and every son looks upon himself as the possible heir, and the actual succession frequently falls to him, who finally succeeds in the struggle for the throne on the king's death. I give below the Genealogy of the Alompra (Alaungp'aya) Dynasty of Burma, as illustrating the persistenoy of this peculiar law of succession and also the vicissitudes to which it is liable in practical application.
Page #307
--------------------------------------------------------------------------
________________ OCTOBER, 1892.1 ALOMPRA DYNASTY OF BURMA. 289 THE ALOMPRA DYNASTY OF BURMA (1753--1885 A. D.) (1) Alaungpaya (1753-1760). Amyin Minbl. (0) Boddp'aya (1781-1919). Pak anji Minba. Myinzaing Minba: The Enshemin. (8) Naungddji (8) s'inbyayin A son, died (1760-1763). (1763-1776). young, no title granted. (5) Maung (4) Singasa Maungo (1776-1781). (7 days in 1781). (7) Bajiddi (1819-1897). (8) Darawadt! (1837-1846). (9) Pagan (1846--1852). (10) Mindon (1852--1878). The Enshemin. Donze Mekk'aya Myingun Myingondaing Nyaungjan (11) Dibd Kolin Minba. Pyinmana Minba. Minba. Minba. Minba. Minba. (1878-1885). Minba. (Enshemin Elect). With reference to the above table the following remarks are applicable in the present connection. It is commonly said in Burmese Yazaroins (Rdjavanlias), or Histories, that the reason why Alaungp'ay's sons succeeded bim in tarn is, that he expressed a dying wish to that effect. I believe, however, that, whether he did so or not, the dynasty really followed what was felt to be the ancient and appropriate rule, and that the succession was accepted by the Court and people as the customary one. Alsungpaya left seven sons, one of whom died as a child before the time came to give him a title, but all the rest grew to manhood and to be political forces in the country. He was succeeded by his eldest son, Naungdoji, in the regalar course, and then by his second son, S'inbyuyin. The disturbing elements in the role of succession then began to work. S'inbyuyin nominated Singuse, one of his sons, as his successor, and the succession was secured to him by a palace intrigue. This caused a rebellion on the part of the next heir by right of succession, viz., the Amyin Minba, who was killed in the course of it, and so put out of the way. Maung Maung, the son of Naungddji, afterwards raised a sudden palace revolt and deposed Singusa. This did not fall The word Minba means 'king's son,' i.e. prinse.' Reading between the lines of Rangermano, pp. 50f1 of the 1886 reprint, it would seem that the Minha of the earlier Alompra kinga held much the position of the AEtheling of the early English : 1.6., he was looal chief of the blood royal. The PaungisA of Sangermano, see pp. 63ff of the 1886 reprint. * Sangermano, p. 50 (1885 reprint) repeat the story. * Much after our own fashion, Burmese Queens, Princes and Princesses were given titles, generally after estates that were handed over to them for sustenance, practice which, however, sed with the accession of King Mindon in 1852, who inaugurated the system of paying salaries to the members of his family, his ministers and officials. The rank of the title-bolder was indicated by word sufixed to the name of the place. Sometimes several titles were held by the same person, so wita us. The titles of royal children were conferred generally on their reaching an age to be of political importance. Thus, mibayd=queen, minbd-prince, minbam prinonna, and the titles ran thug : Limban Mibaya, Amyin MinDA, Sanpfang Minbamt. Titles were occasionally not connected with places, as S'inby Ameyin, the Lady of the White Elephant. Kings on sccession retained their princely title in the same way, generally from places, as barwad, Pagan, Mindon and bfbo. Sometimes, however, their titles were desoriptive, S'inbydyin, the Lord of the White Elephant. Kings had generally several titlon, 6. 9., bardwadi is equally well-known m Kongbaung and Shwabo, both place names, which is confusing. Confusion is further made worse confounded by the private names of these royal personages having come down to history : .. 9. Mindon is still also known as Maung Lwin. Maung Maung, the fifth king of the Dynasty, had apparently no title (unless we krant Sangermano's name of Paunga w a title), and was killed before he could give himself one to go down to history. The private name of the Myinsing MinDL drowned by order of Boddp'ayl in 1147 B. E. ( 1785 A. D.), Was Maung P'o Sbin.
Page #308
--------------------------------------------------------------------------
________________ 290 THE INDIAN ANTIQUARY. [OCTOBER, 1892. in with the Court and general views at all, and, after a seven days' reign, he was put to death by the Court in favour of the rightfal heir, Bodop'aya, who, to settle himself on the throne, pat an end to Singusa. Bodop'aya, like his brother S'inbyuyin, was a powerful ruler, and acted precisely in the same manner. That is, he nominated his son Eoshomin (Yuvaraja), against the rights of his two surviving brothers, the Pakanji Minba, and the Myinzaing Minba. The former wisely acquiesced in the arrangement and died a peaceful death. But the latter rebelled and was killed, Bodop'aya reigned for a long while and his son died before him, and the succession went to his elder grandson, Bajidd, who, in course of time, was deposed by his brother Darkwadi (otherwise equally well-known as Kongbaong and Shwebo Min). Darawadi became insane and the country was governed by a regent, the Pagan Minbi, who was the king's rightful heir, being his eldest son by his chief wife. Two years later the regent became King Pagan. After a while that strong and powerful prince, his brother Mindon, deposed him, and proved to be the best ruler that Burma had had for many a decade. The acknowledged heir to Mindon was his remaining brother, the Eoshemin, who was killed by his nephews, the Myingan and Myingondaing Princes, in order to keep the succession to themselves, a very serious attempt being made on Mindon's life at the same time. The succession to Mindon consequently devolved upon one of his sons, as the Eishemin's family was by rule and custom ousted from it. Another of the disturbing elements in the application of the rule of succession now became apparent. Who was to be considered Mindon's eldest son and rightfal heir ? He had a great number of wives and concubines, the wives were of superior and inferior rank, and be had sons of all ages likely to survive him. As a matter of fact every son looked upon himself as the possible heir, only the Myingun and Myingondaing Princes being out of the way, as outlaws after the murder of their uncle and their attempt to seize their father's throne. Also, it being practically impossible to decide rival claims as to seniority, Mindon settled on that prince as Enshemin, who had done him the best service; viz., the Mekkaya Prince who had accompanied him on his expedition to dethrone Pagan. However, on Mindon's death, Dibo, a junior and inferior son, was placed on the throne, owing to the intrigues of a princess, sap'ayalat7 and her inother, the B'inbyumayin, one of * This Enshemin was generally known to Europeans as the "War Prince"; and though the dignity of "Heir Apparent (= Enshemin)" was ostensibly conforred on him by his brother in recognition of his distinguished services in the rebellion which raised the latter to the throne, it is to be observed that in doing so Mindon followed the rule of succession. * This king's name is that known as Thibaw, Thebaw A l'heebew, corrupted to Theobald by the Britieh soldiers at the time of the annexation of Upper Burma in 1856-8. "Theobald and Sophia" were the King and Queen of Burma according to the British Soldier, (see next note). Thibaw, (bibu) is one of the principal Shan States tributary to the Burmese King, its ruler, the bibo Subwa, being quite as well known to the English in Burma as the king himself. It is curious to note that his predecessor, Mindon, took his title from a valley in the bayetmyo District in British Territory. This was due to the fact that when Mindon was a prince, the country that afterwards became the British Province of Pegu and consists now of the Irrawaddy and Pegu Divisions of Lower Burma, was still under the role of the Burmese King. 7 Both Sup'ayAlat (corrupted by the way into Sophia by the British soldier in Mandalay, like the Persian Sophy of the XVIIth and XVIIIth Centuries out of Safavi) and S'inbyAmayin are titles, 8'inbyumdyin, as already ex. plained, means the Lady of the White Elephant.' Sap'aya means a 'princess of the line': a woman whose father was a de fucto king and whose mother was herself a sup'ayd, i.e., not a woman whose descent was otherwise than directly royal on both sides. Lat means the middle of three.' So the title indicates that the bearer had an elder and a younger sister. She was in fact the daughter of Mindon by a royal half-sister, and she married Dibu, he half-brother. Sup'ayflat ard her elder sister, Sup'ayaji, were insta Hed as co-queens on Dibd's coronation, but the younger sister was strong enough to oust the elder from her conjugal righto. Subsequently Sup'ayagale, the youngest sister, became junior queen to Sup'ayflat. It is a general belief among Europeans in Burnu that Dibo's mother was not royal' in any sense. This is a mistake. Her title was Laungahe Mibay A, and she was of high royal desount, though not a sp'aya, as above described. Her mother was daughter of the Enehemin of Boddp'ayl (see ante, p. 289) by the daughter of the then bibd Bobw. Hence she was first cousin to her husband Minden. Hence also no doubt the choice of title for her son.
Page #309
--------------------------------------------------------------------------
________________ OCTOBER, 1892.] ALOMPRA DYNASTY OF BURMA. 291 Mindon's superior queens. The efforts of these ladies, the younger of whom became subsequently famous as the chief queen of Dibo, were successful in consequence of the aid of two Ministers, the Kanpat Minji and the Kinwun Minji, given for political reasons, which need not be here recounted, because of the recent date of the events following on the death of Mindon in 1878. The superior claimants to the throne, viz., the Donze, Mekk'aya and Nyaungjan Princes, together with many others, were put to death, bat the Myingun and Miyngondaing Princes escaped slaughter, as they were in exile. At the time of his deposition, in 1885, Dibo's heirs were his half-brothers, the Myingun Prince in exile, (tbe Myingondaing Prince having died in exile in 1884), and the Kolin and Pyinmana Princes. The lives of the two last had been spared on account of their youth and political insignificance. To the present day the Myingun Prince, still exiled from the country, considers himself the heir to the Burmese throne by established right of succession. As an ancient authority for the rule may be cited, the following passage from Fausboll's Jataka (Vol. I. pages 127-133). " Atste Kasiratche Bara nasiyat Brahmadatto raja ahosi. Tada Bodhisatto tassa aggamahesiya kuchchhismim patisandhim gauhi, tassa namagahanadivase Mahimsasakumaro ti naman akamsu. Tassa adbavitva paridbavitvi vicharanakale raino aino pi putto jato, tassa Chandakumard ti damam akamsu. Tassa pana Adhavitva parid bAvitva vicharanakalo Bodhisattamata kalam akasi. Raja anna aggamabesitthane thapesi. Sa ranno piya ahoi manapa. SA piyasamvasam anyaya eka puttan vijayi, Suriyakumaro ti tassa pamam akansu. Raja pattam disva tutthachitto, bhadde pattassa te varam dammsti' Aha. Devi varam ichchhitakale gabetabban katva tha pesi. Sa putte vayappatte rajanam Aha: 'devens mayham puttassa jatekalo varo dinno; puttases me rajjam dahiti.' RAJA, 'mayham dve patta aggikkhanda viys jalamana vicharanti, na sakka tava puttassa rajjar dAtun' ti patik. khipitva, tam punappuna yachamanam eva disva : ayam maybam pattanam papakam pi chinteyya 'ti, putte pakkosapotva Aha: tata, ahan Suriyakamarassa jatakale varam adasin, idani '8s8 mate rajjam yachati, aba tassa na datukamo, matagamo nama papo, tumhakam papakam pi chinteyya, tumhe arannam pavisitva mam' achchayena kulasantake nagare rajjam kareyyatha' ti, kanditva roditva sise chumbitva uyyojesi, . . . . . So tam Yakkham dametva tena sasvihita rakkhd tatth' dva vasanto ekadivasai pakkhattam 018ketva pitu kalakatabhavam natva Yakkham Adaya Baranasim gantva rajjam gahetva Chandakumarassa Oparajjan Sariyakumarassa senapatitthanan datva." "In times past Brahm adatta was king of Barinasi in the country of Kasi. At that time the Bodhisatta was incarnated in the womb of his chief queen, and on the naming-day was named Mahimsasakumara. When the young prince could walk and run about, another son was born to the king, and was named Chandakumara. When the second child could walk and run about, the Bodhisatta's mother died. The king installed another wife as chief queen. She became his darling and delight. Owing to the bond of love subsisting between the king and the queen, a son was born and was named Suriyakumara. On the birth of this son the king was delighted and said: 'My dear, I shall grant a boon to thy son. The queen accepted the boon and bided her time to announce its nature. When her son had come of age, she said thus to the king: 'A boon was granted by my Lord to my son at the time of his birth; bestow the crown upon him.' The king replied :-My two sons are as brilliant as two massos of fire ; it is impossible for me to accede to thy prayer.' Though thus refused the queen renewed her request over and over again, and the king thinking. This queen migas, perhaps, harbour evil designs against my sons.' sent for them and addressed them thus: My dear sons, when Suriyakumara was born, I granted him a boon. Now his mother asks for the kingdom; but I do not wish to give it to him. Womankind is wicked, and the queen might I am indebted to Mr. Taw Sein Ko for pointing out this page. This story is the sixth in Rhy Davids' Budhist Birth-Stories, Vol. I. pp 180-184, and is entitled Djuadhamma Jataka.
Page #310
--------------------------------------------------------------------------
________________ THE INDIAN ANTIQUARY. [Ostovkv, 1892. and on my death return Weeping and crying, the He (Mahimsa harbour evil designs against you. Retreat therefore to the forest, and assume the reins of government in the city of your fathers.' king kissed his sons on the forehead and sent them away. kumara) converted the Yakkha, and lived under his protection. One day, looking up at the stars, the prince became aware of the death of his father, and taking the Yakkha with him, went to Baranasi and assumed possession of the kingdom. He bestowed the dignity of Uparaja on Chandakumara and that of Senapati on Suriyakumara." 292 No doubt a large number of interesting instances exist in the history of India and the surrounding countries, both of the rule quoted in this article and its application, the collection of which would prove of great use to the proper understanding of Oriental dynastic succession, anl in determining approximately, where dates are wanting, the probable duration in years of a line consisting of a given number of Oriental rulers. For it must be borne in mind that, when a rule of such a description as that alluded to in this paper may be presumed to have existed, the number of the kings belonging to a certain family that actually ruled by no means coincides with the number of generations in that family. In connection with the subject of this paper I wish to draw attention to the genealogies of the early English and Scottish Kings, as possibly showing a feeling, if not a custom, similar to that pointed out above. The similarity in the order of succession is at least remarkable, even if it turn out to be due to a different set of causes. As I understand the matter, these kings were elected by the people out of the grown men, capable of leading, who belonged to the royal family. But what we are now concerned with is the actual succession, to which this custom gave rise. Let us take first the successors of Ecgberht, the first general king or overlord of the English tribes. (3) AEthelbald 858-860. (8) Ethelstan 924-940. (11) Eadwig 955-959. (1) Ecgberht 802-839. T (2) Ethelwulf 839-858. (4) Ethelberht 860-866. (13) Eadward the Martyr 975-979. (5) AEthelred 866-871. (7) Eadmund 940-946. (12) Badgar 959-975. 1 (15) Eadmund Ironside 1016. (6) Elfred 871-901. 1 (7) Eadward the Elder 901-924. (10) Eadred 946-955. (14) Ethelred the Unready 979-1016. I (16) Eadward the Confessor 1042-1066. Cnut and his some having intervened from 1016 to 1048.
Page #311
--------------------------------------------------------------------------
________________ OCTOBER, 1892.] SACRED LITERATURE OF THE JAINS. 293 Now between Eadmund Ironside and Eadward the Confersor there intervened Cnut the Dane and his successors. Cnut had married Emma, the widow of AEthelred and mother of Eadward, and by her and a former wife had two sons, who succeeded in turn according to seniority, thus : (1) Cnnt 1016-1035. (2) Harold (3) Harthacnut 1035-1039. 1039-1042. Turning to the Scottish kings, we find the genealogy to run thus : (1) Duncan I. ob. 1057. (2) Malcolm III. Canmore 1057-1093, (3) Donald Bane 1073-1098.10 (4) Eadgar 1098-1207. (5) Alexander I. 1107-1124. (6) David I. 1124-1153 (7) Malcolm IV. (8) William the Lion 1153-1165. 1165-1214. The practical result then of the English custom of popular election was the succession of brothers before sons, and it will be observed that the succession was carried out in every case cited, for generation after generation, almost exactly in the manner in which it would naturally fall under a rnle, such as that enunciated at the commencement of this paper. The interest of these phenomena is in the question :-Were these elections governed by a feeling that the appropriate order of succession is that the brothers of the reigning king should suoceed before his sons P WEBER'S SACRED LITERATURE OF THE JAINS. TRANSLATED BY DR. HERBERT WEIR SMYTH. (Continued from p. 215.) (Vol. XVII. p. 1]. In Buhler's list there follow : 8. Nandisatram and F. AnuyogadvAras@tram. without any name to connect them. In Rajendra Lala Mitra, Notices of Sek. MSS. 3. (Calc. 1874) and in the Ratnasagara, p. 508 (Calc. 1880) both texts are mentioned in conjunction, but at the close of the Siddbinta after the malarutras. In the Ratnas, the Angygady. precedes. On the other band we have already seen (p. 427 fg.) that, at the time of the three samdyarie, and indeed at that of the Vicharamsitasangraha, both texts were placed in . much earlier place of the Siddh., at the head of the painna group; though in the Vidhiprapd at least, their connection with this group is represented as uncertain (see 4297). In bearing the stamp of individuality and having a systematic arrangement, both texts have a claim to a free and independent position. This shews that their author attempted to give an ondyclopedic, but systematic review of everything that appeared necessary to him as a means * Dancan II. connected by birth, warped for year, 1004-1006.
Page #312
--------------------------------------------------------------------------
________________ 294 THE INDIAN ANTIQUARY. [OCTOBER, 1892. of information in reference to the sources and forms of a correct knowledge and understanding of the sacred texts. In this way [2] he could present his readers with a hermeneutical introduction. These two works are admirably adapted to the use of any one who, having completed collection or redaction of them, then seeks for light concerning the nature of sacred knowledge itself. The statement of the scholiast on the Nandi has no little internal probability in asserting that Devavichaka, i. e. Devarddhigaai himself, was their author. Furthermore, the list of teachers in the commencement of the Nandi and also in the commencement of mulas. 2, as we shall soon see, breaks off with Dasagani, whom the scholiast states to be the teacher of Deravachaka, author of the Nandi. There is, however, no external support for this conclusion which is not borne out by any information to be derived from the contents. In fact, the contrary view seems to result from these sources of our knowledge; see p. 17 ff. The Anuyogadv. contains all manner of statements, which would syncbronize with the date of Devarddhigani, 980 Vira, i. e. fifth, or sixth century A. D. But I possess no information which would lead me to connect the composition of the Anuyagadv. especially with him; and the difference in the terminology militates against the probability of both texts being the production of one and the same author; see pp. 9, 11, 21. That the Nandi is anterior to the Anugogadv. is made probable by some passages of the latter work, which appear to have been extracted from the Nandt. But the fact that the Anayogadv. is mentioned in the anangapavitha list in the Nandi (see p. 12), makes for the opposite conclusion. We find references to the Nandi in the remarks of the redactor scattered here and there in the augas and upangas; and especial attention is directed to the statement of the contents of the 12 angas found ia the N. This statement is found in greater detail in part 2 of anga 4. Hence the fact that in these references of the redactor, the Nandi and not a nga 4 is cited. We do not read jaha samavdye, but jaha Nandie ; see 281, 352 (accord, to Leumann, also Bhag. 25, Rajapr. p. 243): - which must be regarded as a proof that the Nandi was the authority on which these references were based. The treatment of the subject in anga 4 is, then, merely an appropriation to itself and extension of the contents of this part of the Nandt. Other arguments, notably that many of the readings in the Nandi are older in special cases (see 349, 363) incline us to the same conclusion, If now the nominal redactor of the entire Siddhanta or at least of the angas and upangas, Devarddhigaai, was also author of the Nandi, it becomes at once apparent why he referred to his own work in reference to so special a subject as the statement of the contents of the 12 angas; and the account in anga 4 is to be regarded as an insertion made after D.'s time. See p. 19. I find in the Siddhanta no remarks of a redactor in reference to the Anuyogadvaras, though Leumann thinks to have discovered one (Bhag. 5, ). In the text of Avasy. 10, 1 the Anuyogadvaras. is mentioned together with, or rather after, the Nandi as a preliminary stage of advancement for the study of the sutta. (Both texts are in fact thought to introduce the study of each sutta that has been treated by a Niryukti. L.] Both gutras are composed in prose, though occasionally [4) gathas are inserted ; that is to say if we except the 50 verses in the commencement of the Nandi. These gathis, in which the Nom. Sgl. Masc. 1 Doel. always ends in o and not in e, are manifestly the genuine productions of their authors. In the prose part, the preservation of the nom. in e shews that there is an attempt to reproduce tho language and form of the sacred texts. The Nandi embraces only 719 granthas, the Anuyogadv. about twice as many. XLI. The Nandi, Nandi, or the Nandigatram. The three si miyari texts understand by nandi, or nandikaddhavania (Avi.), nandirayanavihi (Vi.), an introductory ceremony, in long or 1 "A glossary of the above-named strm and description of Ave Juan" in the somewhat pooulian donoription of the contents of the Nandisdira by Kishinath (p. 227). See also BhAD Dajl in the Journal Bombay Branch R. 40. 8. 9, 101. See Jacobi, Kalpas. p. 15, note
Page #313
--------------------------------------------------------------------------
________________ SACRED LITERATURE OF THE JAINS. 295 short form as the case may be, for the BAvayakachchani (sravakakrityani), especially for the didactic exposition or the recitation of the angas, etc. It is almost probable that by this the recitation of our text is referred to. We read in Avi. : tad guru namokkaratigapuvvan nadim kaddhai, sa che 'yam : nanam pamchaviham.., and then follows the real commencement of the Nandi. See below. This is, however, soon interrupted, and the citation passes to that variant textual form which is found in Anayogady. Another change then occurs, and finally that enumeration of the sacred texts is reached which is found later on in the Nandi. We have, therefore, here no immediate citation from the text of the Nandi but a relation based essentially on the same foundation but in its form independent, a relation whose designation by the same word is based upon the appellative siguification of this expression. We may compare the [5] similar use of the word nindi in Skt. for those introductory strophies of a drama which are designed to bring good fortune. Cf. also nindika as the name of a door-post, and nandipata, a cover of a spring (P. W.). Haribhadra on A vasy. 9, 1 has the following: --adimamgalartham namdi vyakhyata, and in the commencement of his commentary, ibid.: - no-agamato bbavamamgalam namdi, tatra damdanam namdi, namdamty anaye 'ty va bhavyah pranina iti namdi. The signification of the title of our text is really : an introduction designed to bring good fortune. This title can refer either to the entire contents of the work such as I have above sketched, or, and this seems preferable, to the 50 verses which form the beginning. In vv. 1-19 Vira is praised, in vv. 20, 21 there is an enumeration of the 24 Jinas, in vv. 22, 23 & Jint of his immediate scholars, the 11 so-called ganadbaras, and finally, from v. 24 on, a thera valt beginning with Suhamma (1) and Jambu (2), and embracing in all thirty members; it closes in the third generation after Nagajjuna (35) with Dusagani (30), who, according to the anonymous scholiast (on v. 27) was the teacher of Devavachaka, the author, As we have already seen on page 471, this therivali varies, from the ninth member on, from the statements in the list contained in the Kalpasutra. [6] The reason for this is apparent from a consideration of the remarks of the scholiast (avachuri) on v. 27: Subastinah sishyavalikayah srikalpe uktatvat na ta(8)ya iba 'dhikarah, tasyam Namdikrid-Devavachakagarvanutpatteh. From this it is clear that the author of the avachuri considers Devavachaka to be the author of the Nandi, and that this account does not emanate, like that of the srikalpa, from Suhastin (10). The evidence proves that it is rather to be referred to his immediate predecessor, or brother, Mahagiri (s), whose intellectual descent it makes known. In refereace to each of its members there exists great uncertainty, according to the statements of the scholiast, who says of verses 31, 32: kshepakatvad vrittau no 'ktam, and remarks on vv. 33, 34: etad gathadvayartha avasyakadipikato likhito 'sti, avachurnav api na 'sti, vv. 41, 42 is: vrittav avyakhyatatvat prakshiptam, and of Govindacharya he says, on v. 43: sishyakramabhivad vrittau no 'ktah, avasyakatikato likhitah. These recur, as has already been mentioned in the commencement of the Avaay. nijj. in identically the same form. 3 Cf. the name of the nandimukhab pitaras or of the nandtarAddham. In the case of the latter was there any recitation of a list of ancestors ? P gurubhritarau in Klatt, Indian Antiqu. 11, 3514, or ubhav api bhratarau in Dharmaghosha's Gurvavali itself, Suhastin is characterized as the laghugurubhratar of Mahigiri, also in the pattavalt of the Kharataragacha, Klatt, 946b. Klatt in accordance with other traditions (cf. Kalpasatra) refers both to difforent gotras: and Mahagiri to Elapatyagotra (80 here v. 27, Eldvachasagotta), Sahastin to Vasitha. Have they different mothers 1 On this cf. Jacobi in Journ. Germ. Or. Soc. 34, 352, 3, especially in reference to verses 27, 25, 36, 37, and Leunaun's remarks, ibid. 37, 407 fg. In v. 27 we muet read in Jacobi : Bahulassa sarivvayam (vvayam for vayasan) vande instead of bahulans Sirivayam vande (see Klatt, 1. c. 2510 ); in the schrolinat we read iha Mahlgirer dvau sishyau abhatam: Vahuld Valissahas (cf. Kalpas. Therav. $ 6) cha; tato Mah&girer anamtaram Vahulasya yamalabhrtritvAt sadribavayasati, pravichanikatvena pradhanatvat, Valissaham do'ty arthab. * Aryapandila (21) v. 39 becomes then Arya-Mangu(16)bishya v. 30. But even vorse 38, in which Aryanashdila is mentioned, is doubtful: see above.
Page #314
--------------------------------------------------------------------------
________________ 296 THE INDIAN ANTIQUARY. FOCTOBER, 1892. [7] The list reads : 1. Suhamma, - 2. Jamba, - 3. Pabhava, - 4. Sijjambhava, 5. Jasabhadda, - 6. Sambhua, - 7. Bhaddavahu, - 8. Thulabhadda, -9. Mabagiri (and Suhatthi, - 10. (Valissaha) the twin brother of Vahala (see note 7 on p. 6), -11. Sai, - 12. Samajja, 'Syamarya, 11 - 13. Samdilla, - 14. Ajja13 Jiadhara, Jita', - 15. Samudda, - 16. Mamgu13 v. 30, - 17. Dhamma v. 31, - 18. Bhaddagutta v. 31, - 19. Vaara, 14 Vajra v. 31, - 2. Rakkhia v. 32, -21. Ajjanamdila, i. e. perhaps Ajja Anamdila (Ajja No Schol.) v. 33,- 22. Nagahatthi v. 34, -23. Revainakkhatta v. 35,- 24. Khamdila vv. 36, 37,1525. Himavarta vv. 38, 39, -26. Nagajjona16 vv. 39, 40, 45,- 27. Govinda v. 41, - 28. Bhuadinna vv. 42-45, scholar of Nagajjupa, -29. Lohichcha v. 46,- 30. Dusagani vv. 47-49. That this list actually reaches as far as the author or his teacher is rendered the more probable by the fact that in the last verse of the list (v. 50) the nanassa paruvapam is stated to be the purpose of the account which is to follow -- and this purpose reproduces correctly the contents of N. Next follow two secondary insertions, first a gatba, [8] which cites 14 examples or titles of stories in reference to capable and incapable scholars (the avachuri contains a more detailed account) and secondly a short polemical notice of the three kinds of paris.i. parshad, viz. :-jania, ajania and duvviaddhia - each of which is illustrated by a gatha. At this point the investigation of the jnanam begins, in which a principal part is played by the enumeration of the different categories and sub-categories of both the principal classes into which the jnanam is divided17 - the pachchakkhananam and the parokkhananam. The latter contains much that is interesting. It in turn is twofold, Abhinivohiyao (bodhika) and suao (sruta). In the account of one of the two groups into which the Abhinivohiyaparokkhanknam is divided, are inserted eight gathas, which contain the titles of stories which belong in this connection, and which are intended to serve as examples. The avachuri goes into detail on this point The spananaparokkham is divided into 14 groups among which Nog. 5, 6, 13, 14 are of special importance : -The sammasaam 5, samyaksrutam, is explained as jam iman aribamtehin bhagavantehim uppannanknadamsanadhare him... paniyam davalanamgam ganipidagam, tam jaha : ayaro.... ditthivao.18 ichch-eyam duogan ga gam choddasapuvvissa sammasuam abhinnals dasal 9]pavvissa sammastan. The posteriority of its composition to Vajra at least is clearly brought out in this passage. In michchhasuam & we find that enumeration of some 20 works, or classes of works, of Brahminical literature which I cited from the Annyogadvarasutra 20 and discussed on Bhagav. 2, 248. This list is here more detailed and offers several variants :- Bharaham Ramayanam Bhimi. . See Merutunga's Therdvali in Bhau Daji, Journ. Bombay Br. R. As. 8. 9, 151 (1867). Nos. 17-20 are not found therein (see p. 6), No. 21 is called Mandilla ( dila), No. 23 Revaisinha, and the list gives one name more in mentioning Devar(d)dhi himself after Deagani. 10 Valigsahasishyam Haritagotran Syatim. 11 Nominally anthor of ap. 4, see p. 192. 12 This epithet explained by Aryagotra is found also in Nos. 15-17, 19-22. 18 ko'pi Mangor Aryadharme 'ti namsmtaram Abuh, No. 17 then falls out. 14 According to the scholiast the dasapurvinah (see Hem. v. 34) Aryarakshitas tashhishyo Durvalik&pushpal cha navaparvinau, reach from Mah&giri to Vajra. See page 848. 16 Bambhadivagasthe, Vrahmadvipikasakh palakshitan Simhan Simhfohlrykn. 16 Cf. the Nagarjuniy as in the Scholiast on aga 2, 2, 2, and see p. 266. 27 ninam patchaviha: Abhinivohiyankna sua ohio manapajjavao kevala. Or duviham: pachchakkham and parokkham, and the latter is then : Abhinizohiyaparokkhan path cha saanana parokkham cha; the Abhio is stanissian oha 4uanissiyan oha; both are fourfold, and the latter is divided into : uppattiya, vrata, kammi, parinAmil buddht (see p. 14n). 18 In the scholiast samayikAdt vindaskraparyantam, soo pages 244, 245, 343. 10 tato 'dhomukhaparihanyA y Avat sampurnadadapdrvadharasys; 400 p. 16n. * Where it is characterized as n0-Agama) bhAvasuyam and as appAnthir michhAditththim sacboh hamdabaddhamarvigappiyah ;-of. the 29 vihar parandam Avaly. Ind. Stad. 16, pp. 115, 116. I denote the four M88., to which I have had abouse as A BOR. The citations from Ned. are by Leumann.
Page #315
--------------------------------------------------------------------------
________________ OCTOBER, 1892.) SACRED LITERATURE OF THE JAINS. 297 surukkham Kodillayam 33 sagabhaddiy #823 kappasiyan24 nagasuhumam kanagasattari25 vaisesiyam 26 Vuddhavayayama vesiyam99 Logayatam satthitamtam Madharam30 paranam vigaranam Bhagavayam31 Paanjali Pussadevayam leham (helam MS.) ganiam saunaruyama nadaya 1,33 abava (10) bavattari kalo chattari ya veya samgovamga. The commentary offers nothing in explanation : 34 te cha lokaprasiddhah, tato lokata eva teshum svarupam avagaitavyam. Under anangapavittham (No. 14 is, however, treated of before No. 13) are enumerated the titles of all the texts belonging to the Siddhanta at the time of the composition of the Nandi, but not included in the angas. This enumeration is extremely interesting. It must have been retained as a stereotyped list for a long period after the composition of the Nandi, since it is to be found verbatim et litteratim not only in the Pakshikasutra (P),36 but also in the 3 samacharis (see pp. 369, 370) in a form that is but slightly different.36 The great interest which attaches to this list is caused by the fact that the largest portion of the texts similar to these and now belonging to the Siddhanta is mentioned here, and that a different arrangement is observed. They are not enumerated in the special groups into which they are now divided. The names of these groups are partly wanting, e.g., uvamga, paznna chheasutta, malasuttn are not mentioned at all, and paznna occurs, but in a different meaning. A large number of titles or texts are mentioned which at present are either not found in the (11) Siddhanta, or, if found at all, are merely titles of subdivisions and not of independent texts; and in some cases these titles appear to have arisen from their connection with the subject matter itself. The anamgapavittham is divided into two groups: avassayam and Avasgayavairittam. The avassayam is called chhavviham and six names for it are enumerated : simsiyam chauvisathao etc. Cf. my remarks on page 433 and on anuyogadv. and mulasutta 2. The Avassayavairittam is double : kaliyam cha ukkaliyan cha. Then follows the enumeration of the texts counted as belonging to the ukkAliyam :37 1. dasaveyaliyam 45,38 2. lappiyakappiya,,30 3. chulla 21 Oktar A, shkar R. 12 Koda An., whero ghodamuhan (A, odayamu c, Jayasuhatin B, dayasuyath R) follows. Nxd. too has khodamuham, but after sayabhao. 28 sagadabha BCR, setambha' A. 2 kappakappiam A. 25 gattari vesiyarn BCR, viriyani omitted in A. * 80 An. Nxd. Vasesiyam the Berlin MS. of N. (=MS.) 97 'vanayath MS., Vuddhaskaanan BCR, ratha(!) vayanam A; in An. we find alao KAvilan; also in Ned. KAviliyam comes before Logao #tesiyam Ned., BC Romit. >> Already mentioned in the aoga, see Bhag. 2, 246, page 304 (of. Kalpas. pp. 35, 101) and Max Muller: India, What can it teach us? p. 362. * See Ind. Stud. 13, 337, 68, 435 and Agnimathara Vishaupar. 3, 4, 18 (pp. 44, 45 Wilson-Hall). 31 Bhagavayar to sainardvan omitted in An. >> sacparuvam MS. ; perhaps ruyam, otherwise the last of the 72 kalks; see above p. 283. In the scholiast on Ayasy. 12, 36: sunipro vi garahio hoi we find the following peculiar statement:- Sakuntiabdena chaturdass vidyasthinani parigrihyathto: angani chaturo ved mimasa nykyavistarah I pur path, dharmallstrari cha sthankny Ahus obaturdasa || tatrA 'rgani what, tad yathe : siksbA vy Akaranath kalpab ohhando niruktash jyotisham iti. The position of the anges in the front of the list is one of the remarkable things in this statement. $5 Mldhara purkna v yarana BR; nicjagadt A. * Hemachandrasuri on the Anuyogadv. has likewise anly: etach cha Bharatadika natak&di-paryantar brutam lokaprasiddhigamyam. 85 In the Pakshikasutra this is introduced by the words namo tesan khamisamapinam jehim imam vliyam arbgabahiram nkkaliyari (or kaliyar) bhagayantan, tam jahl: dasavey Aliyam... The Pukehikaaltram ir onamurated by R$j. L. M., se above p. 227, as the fourth molastram after the Siddhantadharmaalra. It sing the praises of each part of the Siddhihta (sagabAhirs and dullasasiga) and contains especially an acknowledgment of belief in the five inahavvayas. * The enumeration of the names in S. contains a different grammatical construction, i, e. the names are in the genitive, 87 The avachdri gives explanations (occasionally in detail) of at least some of the names. A large number of the names is, however, passed over in silence. [Explanations may however be found at the end of the Vyavahdra. bhashya, as the corresponding part of the sutra mentiong most of the names.-L.) # These numbers represent the arrangement which I have observed here in essential agreement with Buhler's list in the enumeration of the parts of the Siddhanta. The texta which are no longer found a separate texts in the Siddhanta, are printed in italios. On kappiyhk, (af. kappakappiam p. 97. a), chullak. and mahlk., see the scholingt'e remarks, p. 479 above.
Page #316
--------------------------------------------------------------------------
________________ 298 THE INDIAN ANTIQUARY [OCTOBEL, 1892. kappasuai 4. mahdkappasuan, 40 5. vaiyamal 13, 6. rayapaseniyan" :14, 7. jf vabhigamd 16 8. pannavana 16, 9. mahapannavana,"> 10. pam dyappamayan, [12] 11. nandi45 41, 12. devirindatthao46 31, 13. anudgadira im % 14. tamdulaveyaliyam 2, 15. chandavijjhayam 30, 16. aurapampatti4' 17, 17. porisimandalan, 18. mandalappave:0,60 19. vijjdcharanuvinichchhao61 20. gativijj452 32,21. jnanavibhatti,69 22.maranavibhatti,54 23. byavisohi,66 24. viyaruyasuan, 25. saulehanas uam,67 26. vihdrakappo, 58 27. charanaviht, 6deg 28. aura[13]pachchakkhanam * 29. mahapachchakkhinam,61 33 evam-&.63 - To the kaliyam the following texts are ascribed :30. uttarajjhayanaim 43, 31. dasld 38, 32. kapp 30, 33. vavabard 37, 34. nisihan 35. 35. mahanisiham 36, 36. isibhusiydim, 37. Jarvuddivapanpatti 18, 38. divasagarapannatties, 39. chandapannatti 19, 40. khuddiyd vimanapavibhatti87, 41. mahalliyd vinanapavibhatti, 40 Name of the first chhedastra according to Avakyaka 8, 65, see pages 446, 479. 41 So V., uvaydo P, uvAo N. Avi. Svi.; in 8 before No. 5 we find : pamayappamgyar ; pamay. here is No. 10. * So also P Avi., & form which suits rajaprasntyam better than the usual paseqaiyyam; Svi. V. bavo Pasinaiyansa but with one y ; see p. 382. * For explanation of the scholiast on Nos. 8, 9, see p. 892. ** In S before No. 5, in P after No. 15; pramAdapramidasvarupabhdaphalavipAkapratipadakam adhyayanam (cf. Uttarajjh. Cap. 4), Avach. 15 The Nandi itself! Dazndity Adi sugamam. 46 othul P; in Ned. P.S, transposed with No. 18 (dara) P). T vijjiyar P, vijjayan Ned. 18 Is onnitted here in P3 and comes after No. 87; Buryachary Aprajnapanan yaayam graurthapaddhatau s suryaprajnaptih. 49 porasan P; paurushimar alam iti, purushab bankah, purusha bariraris va, tasman nibpanndpanrushi, sarvasys 'pi vastuno yatha svapramana ohhaya jayate tada paurushi sylt, etach cha paurushipramAnam uttardyanasyd 'mte dakshindyanasya "dau cha ekar dingin sykt, tatab param angulasy& 'shtay ekashashtibhaga (a/;l) dakshinayane vardhamte, uttarayand cha hrananti, eram mandal-mandale paurashi yatra 'dhyayene Varnyate tat paurushimamdalaca, Avach. Cf. book 9 in up. 5 (and Bhag. 11, 11, L.) 50 guryachandramasor yatra dakshinesha 'ttareshu cha mathjaleshu sathcharator yatha mandalan mandale prave6 (60) vyavarnyata san(tan)mandalapraveeah, Avach.; of the first book in up. 5. 01 vijj&P S;io P S transposed with No. 20: vidyA samyag-jnanar charanam charitram, &teshazin phalavinischay pratipadako granthal, Avach. [= Bhag. 30, Leumann.] 52 See p. 443. 55 yatrA "rtadhyanadinam vibhajanan proktan tat, Avach. ; appears in the Vidhiprapa among the poinnas in the eighth place. See p. 428. 5* Omitted in Avi. pr. m., maranani prasastaprabastarupini teshan parthakyens yatra vibhajanam uktamAvach. ; see p. 429n. 56 yatra (!) "tmand jivasya "lochand-prayaechitta-pratipattiprabhritikarapena ribuddhir yatra vykrargyate tat, Avach. In Svi. V maranavisohi in addition follows here. 06 In P S after No. 25; saragavyapohena vitardgasvartpam vyavarnyate yatra tat, Avach. 67 yatra dravyabhAvasalekhandavarupar pratipidyate, Avach. ; three verses are added in attestation thereof: yathi, chattari vichittain vigoinijjhiyAi obattarinanvachchhare u dunni u gartariya cha ky Amath ||1|| nilivigitth0 atavo ohhammase parimiam cha kylmar | anne vi ya chhammad hoi vikittharn tavokamman | 2 | viise kodisahiyan SyAman katta Anupuvvlegirikandarammi gantum peuvagamanan aha karei || 8 | bh&vasam, lekhana tu krodhadipratipakshabhy Asab (!). [The three verses are taken from the Aohar-niryakti (257-289).-L.] 16 vihirah sthavirakalpadirupo yatra varnyate, Avach. $9 visohi P, 'vibhattie Svi.; charitrasya vidhih, Avach. 69 The scholiast appears to have had before him another text than the usual one. See p. 487. 61 mahat pratyakhyanain yatri 'ktan, Avach. . Instead of evamal Phas: savvehiin pi @yammi argabAhire ulckAlie bhagavatt smutte se-atthd waggathe sanijjuttie sasargahanie je guna va bhAvA va .. te bh&ve saddahAmi .. 43 MtAny adhyayanani nigamanan sarveshfim adhyayanAnAr pradhanatve 'pi radhya 'many evo 'ttaradhyay nasabdavlohyatvena prasiddhani, Avach. 64 Without any explanation. See p. 460 for No. 35. 65 In PS before No. 34; without explanation. See pages 359, 272, 280-81, 402, 429, 432, 442. " In PS No. 16 is inserted here. The order in P is strap., chandap., divasg., in S: chamdap., strap., dlvas; on divaslgarap. see pp. 268, 399, 429. 67 khuddiy and mahalliy also in 9 (i..., degyAvio), not oyA m we should expect; &valikApravishtAnAmin itarosh Arn vi viminanam prabhajanath yatro 'ktam, sa vimanapravibhaktir dvidhA, 'lpAkshararth& "dy A, dvitly muahAgrarthArth. See the karikAs above pp. 223, 224 in reference to Nos. 40-44, 45-49 as the object of study for the eleventh and twelfth years. In anga 3 Nos. 41-49 appear together forming the samkheviyadasku, or the 10 ajjhayana that belong in this connection. See pp. 273, 274.
Page #317
--------------------------------------------------------------------------
________________ 299 OCTOBER, 1892.] SACRED LITERATURE OF THE JAINS. 42. amgachulias, 43. vangachuliya, 44, vivahachuliyd70, 45. Arunovavae71, 46. Garulovava67, [14] 47. Dharanovavae73, 48. Vesamanovavae7, 49. Velandharovavde, 50. devidovavae, 51. utthanasue75, 52. samutthanasue76, 53. nagapariyavaliyao77, 54. niraya valiyao78 30, 55. kappiyao78 20, 56. kappavadimsayAo70 33, 57. pupphiyao 31, 58. pupphachuliyao, 59. Vanhidasao 24, evam-aiyaim 80 chaurasii painnagasayasahassaim bhagavao Vaddhamana-. samissa; ahava jassa jattiya sisa uppattiyae venaiyae kammiyae parinamiyae chauvvihae buddhie avaveya tassa tattiyaim painnagasahassaim, pattegabuddha vi tattiya cheva; se 'tam kaliam suam. This is the conclusion in the Berlin MS. of N. Dr. Leumann, [15] however, says that this conclusion contains a large lacuna. We find in the edition of N :92 evamaiyaim chaurasii painnagasahassaim bhagavao [Usahasamissa Aititthagarassa, taha samkhijjaim painnagasahassaim majjhamagauam Jinavaranam, chauddasa painnagasahassaim bhagavao] Vaddhamanasamissa, etc. From this we may draw the conclusion that the 59 titles, according to the opinion of the author of the Nandi, represent merely a portion of the 84,000 painnus (our MS. has 184,000 in the text!), which belonged to the first tirthakara Rishabhasvamin and to the 22 Jinavaras following him; but that at the time of Vardhamanasvamin their number was reduced to 14,000. Or according to another view, each of the 24 tirthakaras had just so many thousand amgasya "charades chalika ukt nuktarthasamgrahatmika gramthapaddhatih; see pp. 255, 274. 30 M3. P. Avi., but vagga Ned., anga 3 (see p. 274), Svi., V. and Avach.: vargo 'dhyayananam samuho yatha 'mtakriddasasv ashtau varges (see p. 320), tesham kalika (chuldeg P). To bhagavatichulika, see pp. 274, 296. 71 Arupo nam devas, tadvaktavyatayah pratipidak3 gramthah, paravartyamanas cha tadupapatahetuh sa 'rupopapatah; evain garudopapatadayo 'pi vachyah; see pp. 224, 274, 316; cf. Aruna as name of the dawn or as that of the charioteer of the sun. Up to this point the nominatives end in o, from this point on in e; so also in P. 73 Garudo P. In P after 47. 73 So also S, but Varudeg in P and scholiast on anga 3, Vara" in the text there (see p. 274). The king of the Nagas is probably referred to. 14 In N after No. 49 we find vesamana = vaisravana. 76 utthanasratam, udvasanahetukam erutam, Avach. See page 234, where mention is made of four ajjh., which begin with utth., and which are the subject of the study of the thirteenth year. In this place, however, we find only Nos. 52-55 devoted to this year; but does No. 50, too, belong in this connection? In Sy. No. 50 stands between 52 and 53. 16 samupasthapanaeratam, bhuyas tatrai 'va "vasana (P)hetukam erutane; vakaralopah prikritatvat, Avach. 17 so P, "yavaniyao M3.; "yavaliyanam Svi. V., pariaveliapam Avi.; nagakumaras, teshim parijna yatro 'kti, Avach. 78 80 MS.3 P, olio MS.1; liyanam 8; No. 54 in the existing Siddhanta is the collective name of up. 8 to 12 and at the same time the specific title of up. 8; No. 55 is there merely another name for No. 54. See p. 418; and p. 420 for the explanation of 51-59. On page 420 we must read "gochara gram. 7 damsi P, dinasi V. se Instead of evam-Aiydim... P has 60 Astvisabhavana, 61 ditthivisabhavano, 62 charapasamanabhavando, 63 mahasuvinabhavanao, 64 teaginisagga nam savvehim pi yammi amgabahire kalie bhagavate (as above, p. 13, note 3). These five names are cited in S. too with the following variations: charanabhavaninam (omitted in Avi.), mahasuminagabhav. (V., also omitted in Avi.), teyaga(teagga Avi.)nisaggAnam. These five texts are found in the same order in the karik As mentioned in p. 224 as designed for the fourteenth to the eighteenth year of study. Teyanisagga is the special name of the fifteenth book in anga 5. See p. 301n. 1 See above p. 8, note 1; autpattiki, vainayiki karmasamuttha parinamiki. 82 The Avach. agrees with the account in our MSS.:-evam adini chaturaeftisamkhyani prakirnakasahasrani Rishabhasvaminas, tavatpramAnAnam eramanasahasranam sambhavat, prakirnakanam cha tadraohitatvat; madhya-. matirthakritam api samkhyeyani prakirnakasahasrani vachyani; Vardhamanas vaminae chaturdasasahasranni. - anye punar Ahuh: idam Rishabhadinam chaturaeltisahasradikam eramanamanam pradhanesutrarachanasamadhyam (or merely chanam ?) adhikritys 'ktam, anyatha samanyaeramanah prabhutatara api tada Rishabhadikale Asfran.anye punar evam Ahub: Rishabhadinam jivatam idam chaturaeitisahasradikam framanamanam, pravahatah punar ekaikasmin tirthe bhuyamso 'py Asiran, tatra ye pradhanasutraraohanafaktisamanvitah suprasiddhatatvamdhaya (?) tatkalika api tirtham pravartamanas tatra 'dhikrita(b; etad eva dareayann aha: ahave 'ty-adi sugamam. 3 Or 60 including marana visoht (Svi. V. between 23 and 24) and 65 with the addition of the five names in PS.
Page #318
--------------------------------------------------------------------------
________________ 300 THE INDIAN ANTIQUARY. [OCTOBER, 1892. painnas, or pratyekabuddhas84 [16] as he possessed scholars endowed with the correct fourfold knowledge. Estimating these exaggerated figures at their true value, let us consider the 59 titles. Of the texts now enumerated as parts of the Siddhanta the titles of the four painnas 26, 27, 29, 34, of the sixth chhedasutra 40 and of two of the mulasutras, 41 and 46 are omitted, Of these the four paionas are to be regarded as modern productions and later than the N; the titles of the sixth chhedasutra 40 and of the fourth mulasutra 10 are not certain ; and, finally, the title of the fourth mulasutra 11, kvasyaka, has been already mentioned. See on p. 11. The remaining 27 titles of texts of the present Siddhanta not belonging to the aigas (13 fg.) are one and all contained in the above list, though in a different order of arrangement and without any statement in reference to the names of their groups. Some, however, belong together as groups -- the first four and the last five upangas (Nos. 5-8 and 55-59) and the five chhedasatras (Nog. 31-35). Besides these the list contains 3296 additional names which are not directly represented by texts in the existing Siddhanta. Among these there are five for which corresponding sections in the S. can be shown, thus: - 10 pamiyappamayam, 17 porisimandalain, 18 mandalappaveso, 38 divasagara pannatti [, 64 teyaganisagga). [17] In the Siddhanta there are references to 12 others; thus for 4, 36 and 38), 40-49; 8 others are mentioned elsewhere 9, 21, 51, [60--6-4); and finally there is a whole list of titles (12 or 13) which cannot be attested from any source whatsoever, thus 2, 3, 19, 22, 23, 24 (a. b., including maranavisohi - 27, 50, 52, 53). It is of special interest that we find statements concerning a whole series of texts held to belong to the kaliam suam in old karika verses. The source of these statements is not further attested. These texts were a special object of riper study at the time of the composition of these verses. Of Nos. 40-49, 51 (50-53 ?), 60-64 it is said that they were designed for the eleventh to the eighteenth year of study: 40--44 for the eleventh, 45-49 for the twelfth, 51 (50-53 ?) for the thirteenth, 60-64 for the fourteenth to the eighteenth year; the nineteenth year forming the conclusion with the study of the ditthivada. Cf. my remarks on pp. 225, 344, 345. This list at least opens up to us a wide perspective for the literature existing at the time of the composition of N. It is certainly very remarkable that N is itself cited in this list (as No. 11). Is this the only work of the author inserted by him in the list? Or did he avail himself of this capital opportunity to procure a resting place for other of his productions ? If in reality Devarddhigani, the nominal redactor of the Siddhanta, is to be regarded as the author of N, then the discrepancy between this list and the existing Siddh., is especially remarkable, [18] Did all these differences arise after his time? And is the division into the groups avanga, painna, etc., or the names uvamga, painna themselves, etc., to be ascribed to a period subsequent to his? In the case of the painna this is evidently very probable. Next follows the angapavittham 13, the thirteenth group of the guananaparokkham, which strictly belongs before the anavgapavittham. It is called duvalasavibam and then the 12 angas, ayard to ditthivad (anga 5 as vivahapannatti) are enumerated in order. This in turn is followed by the detailed statement of contents and extent of the 12 angas, which (see p. 284 ff.) recurs in identical form but in greater detail in anga 4. This entire statement has been given on p. 257. We have already seen (pp. 281 ff. 349, 352, 361, 363, and 3) that its appearance in anga 4 was secondary, and that here we frequently meet with the older readings. When in the insertions in the aigas made by the redactor (even in anga 4) any reference is paid to his enumeration, # pratyekaduddh& api taranta Ovn, ayuh; -atrai 'ke vyachakshate; Maikasyd 'pi tirthakritas tirthe parimanAni prakirnakini, tatkarisma aparimanatvat; kevala pratyekabuddharachitany eva prakirnakani drachten vyani tatparimanens pratybkabuddhaparimanasya pratipadankt. This explanation of eke is designed to effect perfectly comprehensible limitation, but cannot be brought in agreement with the context. The title pratyekabuddha is of great interest. It occurs also in the angas, see pp. 265, 334. Similar statements to the above are found in the scholiast on the first painna. See p. 435. In the Vichar Amritasangraha is quoted the following interesting citation from the pttha of kalpabhashya: suttaro ganahararaiyam tahevs patteyabuddharaiyam oha suyakevalina raiyar abhinna daaapuvrini raiya || * Or 60 and 65, see p. 15, note. # Or 33 and 38.
Page #319
--------------------------------------------------------------------------
________________ SACRED LITERATURE OF THE JAINS. OCTOBER, 1892.] the citation is from the Nandi and not from anga 4. The Nandi and not anga 4 is therefore indisputably the source whence these citations are drawn. But whether or no the account here is really to be regarded as the source whence came the account in anga 4, appears to me to be still in dubiis. This assumption is rendered improbable by the fact there are very great differences in these accounts, not to mention that that of anga 4 is much more detailed. If, however, we regard the account in the N. as the source, then that in anga 4 is secondary and enlarged after it had effected a lodgment in that anga. [19] But on the other hand it is a perfectly legitimate conclusion that the account in N. and in anga 4 were drawn from a common source now no longer extant. Finally, it must be stated that the entire section in N. almost gives me the impression of being a secondary insertion. The fact that it too contains the most wonderful statements, called into existence by the effort of pure fancy (cf. especially the statements concerning anga 6 and anga 12), cannot readily be reconciled with that tradition which regards the Nandi as the work of Devarddhigani, the nominal redactor of the whole Siddhanta. Devarddhigani would have expressed himself in a more sober, definite way, and would not have given rein to such monstrous figments of the imagination. We must not, however, suppress the fact that the Pakshikasutram takes no notice of this detailed statement of contents and extents of the 12 angas, but limits itself merely to the enumeration of the twelve names.88 301 Then, too, the general observations in reference to the duvalasamgam ganipidagam, which are joined on to the account of each of the twelve angas, are found here in just the same form as in anga 4; cf. pp. 368, 369. The five karikas form the conclusion. They contain statements in reference to the correct [20] attainment of the suananam; the last one reads: suttattho khalu padhamo, bo nijjntti(!)-misio bhanio I taion niravaseso, esa vihi hoi anuoe || 5 | According to Leumann, the reference in Bhag. 25, 3 cites this verse as the conclusion of this entire account (java suttattho... annoe). The nijjutti is also mentioned. Next follow some statements which are not noticed by the author of the avachuri, from which we may conclude that they were inserted at a later period, though they may in reality be of great age. They comprise a section in prose in reference to the anunna, anujna, and a renewed repetition of the titles of the 12 angas and a reference to Usabhasena, as the original source of the anunna. See p. 15. The commentary, which I have before me (avachuri), the work of an anonymous author, is very short. The Calcutta edition contains the commentary of Malayagiri, according to Leumann. We have already seen that a Nandivritti is frequently cited. -see pp. 353, 354 (Vicharamritasamgraha), 360 (Abhayade va), the citations from it being partly in Prakrit (gutha), partly in Sanskrit. In the scholium on the Ganadharasardhasata (see pp. 371, 458) Sarvarajagani ascribes a nandivritti to the old Haribhadra, who is said to have died 75 years after Devarddhigani. The author of the Vicharamritasamgraha appears to ascribe such a nandivritti to Umasvamivachaka who was about 50 years older (see pp. 371, 372). He says (fol. 3a of the Berlin MS.) tatha cha "ha bhagavan Umasvamivachakah: samyagdarsanajnanacharitrani mokshamarga iti Namdivrittau, vachakasabdas cha purvagatasrutadhare rudho, yatha: purvagatam sutram anyach cha vineyan vachayamti 'ti vachakah, Namdivrittau: [21] vadi ya.. (see p. 353a). Such statements as these in reference to commentaries of so great an age are of great importance as regards the age of the Nandi. XLII. The Anuyogadvarasutram is an encyclopedic review of everything worth knowing," composed in anuogas, questions and answers. It is composed in prose though there is I call attention here to the mention of the name Bhaddabahu on anga 13, pp. 360, 367. It is noteworthy that he appears in the same gradation (though last in order) as the names Dasara, Baladeva, Vasudeva, Harivansa, and consequently as a mythological personage. This is introduced in just the same manner as the previous one. See pp.10, 13:-namo tesim khamisamaanam jehim imam vaiyam duvalasamgam ganipidagarh, tarh jaha.., and concludes in the same way: savvehim pi eyammi duvalasamnge ganipidage bhagavamte aasutte... An account of the method of defining and explaining the Sastras, Kash.
Page #320
--------------------------------------------------------------------------
________________ 302 THE INDIAN ANTIQUARY. LUOTUD [OCTOBER, 1892. a frequent admixture of gathas. There are no subdivisions, though a systemic arrangement prevails throughout. Ag in the Nandi, the nanam is especially treated of here. The text commences forthwith with an enumeration of the same five forms of the nana, which we find also in N. Abhinibohiya, saya, Ohio, mana payyava", kevala. The second form, the suyananam, srutajnanam, is the one par excellence which is discussed further on in the Anay. The subdivisions of the suyan. are indicated by means of the same names which we find in N, though the gradations are somewhat different ; see p. 11. It is divided into amgapavittham and into amgabahiram, the latter into kaliyam and ukkaliyam; the latter of which again into Avassayam and avassayavairittam. Here in the An., the Avassayam alone is discussed. The author states that he desires to explain his work according to the following four points of view, though the real reason for this statement is not clear: kvassayam nikkhivissami, suam (sratam) ni', khandhan nio ajjhayanam ni'. After a karika inserted here the author proceeds to a discussion of the avassayam per se, [22] which is chauvviham, viz. : - nama, thavana, davva, bhava, respectively, the latter two being distinguished from the others as agamao and no-igamad. At the end the synonyms (egathiya nanaghosa nanavamjana namadhiyya) are stated as follows: - avassayam, avassa karaniyya, dhuvaniggaho, visohi ya ajjhayanachhakkavaggo nao arahana maggo II samanena savaena ya avassakayavvayam havai jamhan | amto aho-nisassa ya tamha avassayan nama o This designation as ajjhayagachhakkavagga points unequivocally to a definite text, divided into 6 adhyayanas. By the 6 adhyayanas we may understand the six kinds of Avassayam enumerated in the Nandi, above p. 11, and occurring below (see pp. 23, 24). These names as well as all the other synonyms of avassaya belong to the domain of ethical, ritualistic or disciplinary matters. Our text, however, touches upon these subjects only occasionally. Next to the enumeration of the synonyms of the a vassayam come the suyam and the khamdha, two of the four sections. To these we find that the same groups and sub-groups are ascribed as to the avassayam; and an enumeration of the synonyms of each forms the conclusion. The verse containing the synonyms of the suyam is as follows:- [23] sua-sutta-ganthasiddhamta-sisane ana vayana uvaese pannavana agame a egatha payyava sutte92 ll, that containing the synonyms of khamdha : -- ganakae a nikae khamdhe vagge taheva rasi al pamje pinde niare samghao aula samuhe | The first names for "sacred text" refer then to the contents, the second to the extent. In one subdivision of khamdha, the nd-Agamad bhavakhamdhe, the following explanation is found (se kim tam noPSdeg): - eesimo cheva samaiya-maiyanan chhanham ajjhayananam samudayasamitisamagamenam avassayasuabhavakhandbe labbhate, se tam no-agamao bhavakhandhe. By this is meant in all probability the connection of the totality of all the above cited six adhyayanas of the avasyaka, samayika, etc. The last of these four sections designed to explain the avassayam, refers ex professo to the ajjhayanam, and begins with an enumeration of these six ajjhayanas. A karika is first introduced, 24 90 There is unfortunately no enumeration of the angabahira texts in An. 91 .. Visesh. I, 871 f. I call attention to the following from the scholiast :- Amfyikadi-shadadhyayanakalapatmakatvad adhyayanashadvargah; tathi abhipretarthasiddhah samyag-upayatvan nyayo, moksharadhandhetutvad aradhana, tath A mokshapuraprapakatvad eva margah; - ahor&trasya madhye. 93 Between ana, Ajnd and vayana one MS. has atti which, however, throws the metre out of order; uktir vachanan vagyogab scholiast, instead of satte, stravishaye, we expect sue, brute, which, however, does not suit the metre. samadiamadinar (!) A; eshaun eva prastut&vabyakabhedanam samayikadinam shappam adhyayaninAm samudayah, samudayasya samiti(r) nairaitaryena, milana, .. samagamas, tens nishpanno ya dvasyakasrutaskandhah sa bhavaskaindha iti labhyate. #avassayassa pamime atthAhigara bhavanti, tan : gavajjajogavirati ukkittans gunavato a padivatti khaliassa nimdana vana-tigichchhi gupadharani cheva || Avassayassa eso pindattho vannid samasenam etto ekkekkam puns ajjhayapam kittaissimi ll tain: samaiam, chauvisa thao, vandanayam, padikkamanam, kanssaggami pachcha kkhanain; tattha padhamajjhayanam samaiam, tassa pam ime chattari anuogadard, tam : uvakkame, nikkheye, apugame, naye.
Page #321
--------------------------------------------------------------------------
________________ OCTOBER, 1892.) SACRED LITERATURE OF THE JAINS. 303 which may have found its way from here to paznna 1 [24) -(see p. 433n), - , though both places may have drawn this verse from a common source. This verse states in brief compass the contents of each of the six ajjh. Then follow again the six names as in the Nandi. Next the first one, the sa maiam, is designated expressly as the one which is treated of in the An. To it are allotted four annogadaras, sections for questions related to the subjectmatter. These sections are avakkame, nikkheve, anagame, naye, and under this division the rest of the text is divided, the avakkame taking the lion's share. In & MS. which I have before me, ms. or. fol. 762, = A, which contains 56 foll., the avak, embraces foll, 5 to 536. That which preceded was on foll. 10 to 5; nikkheva is on three leaves, to 56b, anugame is despatched in ten lines on 566 and nad in six. On p. 22 I called attention to the lack of harmony between the names of the six avasyaka groups and the actual contents of our text which purports to discuss them. This lack of harmony, which is increased by the table of contents adduced for each one in particular, is so great, that I have in vain attempted a solution of the mystery as to how our text can have the face to assert that it discusses the first of these, the samaiyam, or the sa vajjajogavirati.96 A genuine discussion is hardly touched upon, the real subject matter being special topics pertaining to [25] matters of dogma and speculation, or to general matters of cosmological, anthropological, linguistic or literary interest. Aside from this lack of harmony, another fact is in itself likely to excite the hostility of surprise : the word samaiya is used as the title of the first avasyaka, but in reference to the angas we had learned to employ it in quite a different signification, viz. : - as the title of anga 1, whose contents it is true, might be characterized as sAvajjajogavirati. The double use of one and the same word to designate two different termini technici is truly a matter to be wondered at. See 243 fg., 342 fg. The contents of the sections uvakkama, etc., is very varied and in part extremely interesting; and the form, in which it is encased so to speak, is highly remarkable. The statements are heterogeneously arranged, and the connecting thread being purely external, there is no logical consecution. Everything is divided according to the fashion prevailing in the Siddhanta, into groups, species, sub-species, etc. The uvakkama e. g. is divided into anupavvi (in A on fol. 58 to 15), namam (to 27"), pamanam (to 516), vattavvaye (to 524), atthahigara (ib.), samavayara (to 53). And the anupuvvi is in turn divided into namanupuvvi, thavana, davvao, khetta, kala, ukkittana, ganana, samthana, samayari-ao, bhavanupuvvi. Without paying any greater attention to the stereotyped expressions of the text [26] than is necessary to mark the different passages where the statement in question occurs, I give here, according to the arrangement of the text, some of the most important data contained in it and at the end, a resume of the results of interest for the history of literature. It may be prefaced that the nom. sing. masc. I decl. ends now in o, now in e, and that in the verses, the nominative and case forms in general are frequently represented by the theme. In the case of feminine nouns thematic a i d are shortened. A species of dav vavassayam (A 26) is divided into 18iyam, kuppa vayaniyam and louttariyam. The first is referred to the nsages of the proceres, who appear in the usual enumeration that we have met with in the angas: je ime raf-"sara-talavara-kodambiya08-madambiya-ibhasetthi-sene vai-satthavahapabhii8.97 The kuppavayaniyam describes in the following enumeration * In the atthAhigars section of the uvakkama in one MS. ! the contents of all the six ajjhayanas is seemingly ascribed to the samliyam alone. The actual facts of the case are different, see p. 37n. On talavara, see p. 88 fg. 813; kodambiya from kutaba, the older form of kufarba, see Ind. Streifen 1, 284. Panchadapdaobh. p. 41; yasys parvata Asannam aparam gramanagarAdikan na 'sti tat sarvataschhinnajan braya. vibeshardpath madambam uchyat tasya 'dhipatir mAdambikah. m. muhadhoyans-dartapakkhAlana-tolla-phaniha-siddhatthaya-hariyAliya-addAga-dhdva-puppba-mallagamdhatarbolavattha-m-liy kith davvkvassaykin karenti tao pachchha rayakular va devakular va sabham va pava... (Propom?) r trimm va trong va niggachhanti.
Page #322
--------------------------------------------------------------------------
________________ 804 THE INDIAN ANTIQUARY. (OCTOBER, 1892. the character of those sects which do not share the Jaina belief: - je imese charaga-chiriyachammakhandiya-bhichchhamdaga-parduramga - Goyama-govvaiya-gibidhamma-dhammachin[27]taga-aviraddha-viraddha-vuddhasa vagapabhiyao pasamdattha, and states that these : Imdasss VA Khamdassa va Ruddassa va Sivassa va Vesamanassa va devassa va nagassa va jakkhassa ve bhayassa va Mugurdassa va Ayyad va Kottakiriye vam uvalevana-sammayyasa-"varisana. dhuvapupphagamdhamallaiydim davvavassayain karerti. The logattariam finally is referred to the merely external Jaina-yogin : je ime samapaganamukka-jogi chakka yaniranukampa haya iva addama gaya iva niramkasa ghattha mastha tuppottha100 pamaurapadapauranal jinanam apanae (anajnaya) sachchhandam viharifnam abhayo-kalam avassagassa uvatthanti. 1287 In the bhAvavassayam (intellectual exercise) we read in the passage attributing a similar division to the loiyam: puvvanhe Bharabam, avaranho Ramayanam ; and as regards the kuppa vayaniyam, it is said of the same sects as above (charagachiriya) i. e. that they ijja-'jali homa-japa-umdurukka-namukkara-m-aiyain bha vavassayaim karemti. The davvasuyam is characterized as pattaya-potthayalihiyam and as amdayan, vomdayam, kidayam, valayan, vakkayam. The works of the Brahminical literature cited by me ad Bhag. 2, us are quoted in the case of the loiyam no-agamad bhavasayam (see above, p. 9), where the same list is adduced from the Nandi, though in somewhat greater detail. dhati(P)vahakal santo ye bhiksh&in chararti te charakAh; rathy&patitachiraparidhinde chirikAh; charmsparidhand6 charmakhandikah; ye bhikshim eva bhumjete na tu svaparigrihitam godugdhidikam te bhikshatAh, Sugatabasanasth ity anye; pAmdaraig bhasmoddhalitagtrAb; vichitrapadapatan disikshAkalapayukta varatakam Olikadicharchitarrishabhakup&yatah (P) kapabhikshagrahind GautamAb; cf. Kapabhuj, KanAds !); gocharyanukArino govratikah, te hi "vayam api kila tiryakshu vasima" iti bhavankri bhsvayanto gobhir nirgachhorntibhih saha nirgachharti sthitAbhis tishthanti Asinbhir apavisamti bhumjAnAbhis tathai'va trinapattrpaushpaphaladi bhumjate, tad uktan : gavihi samam niggamapavesathanabandi pakarirati bhurijanti jaha edyt tirichhayssarn vibhAvazhta ; prihasthadharma eva ereyan iti. vachah: kiharamasam) dharmo na bhQtd na bhavishyati tam palayathti ye dhirah, klivih pishandam Arita iti ilYAjnavalkyaprabhsitirishipranitadharmasanhits chimbtayanti .. dharmachintaksh; devata-kshitismatapitri-tiryagadinam avirodhena vinayakaritvad aviruddha vainayikah; punyapApaparalokadyanabhyupagamepara akriyavadino viruddhA(h), sarvap&shaundibhih saha viruddhacharitat; prathamam eve "dyatirthakarakale samutpannatvat, pruyo vriddhakale dikshapratipattes cha vriddhis tapasab; eravakah brahmanih ..; anye tu vriddhaeravaka ity ekam eva padam vrahmanavachakatvena vylohakshate (Buddha is therefore not referred to here! (see Bhag. 2,216); and ACO R read yuddha, BC alone having vuddha); pashanam vratam, tatra tishtharti 'ti pashamdasthib; - on Goyama fg. see Aupap. $ 73. See chap. 15 in Varahamihira's Brihajjataka (pravrajyAyogadhy Rya), or Laghujat. 9, 12), Ind. Stud. 2, 287, where also vriddhaerkvaks. Mukundo Baladevah, AryA prabartardpa Durga; sai 'va mahishardha tatkutanapara Kotakriya; stro 'pacharld inndradiaabdena tad-Ayatanam spy uchyate; the same arrangement of the gods, except Mukunda, ocents also in the Bhagavatt 3, 1, 68; see my treatise 2, 113. 1, 439. 100 See p. 161 on H Ala 459 Bhuv. 1 According to all appearance this speaks against the connection of the text with the Bvetarnbarns and refors it to the Digambaras (cf. Bhag. 2, 187n. 321, where I have partially misunderstood the passage). ? Seo Bhag. 2, 348n, my treatise on the Emky. p. 34; loke hi Bharata-RAmRyanayor yachana bravanan va purvaparkhnayor-eva radhan. s jyA yAgab, athava destbhAshky Am ijja 'ti (ishti B) mAtA (!), asyk namaskAravidhau.. ;udurukka tti datvachanata umdu mukhan, rakkar vrishabhAdilabdakaranam, devatAdipurato vrishabhagarjitAdikarapan.-B has also ittharjali in the text, this is manifestly caused by misunderstanding of the ligatures sht, shy and jj. See Vol. XVI. Ind. Stud. 2n; ijja, mata is to be referred either to root yaj or to dry. pat(t)rakani talatAly Adinath bamdhini, tatsainghAtanishpanna tu postakls, tata cha patrakini cha pustaks cha, teshu likhitam; athava potam vaatrain (100 I. 8. Vol. 16, p. 155) pa(t)trak&ni cha teshu likhitarh u ndayam harsagabbh&di; hamesh patargab, garbhas tu tannivartitakolik Aro.. tadutpannar sutram aradajam uchyate: Adilabdah syabhedaprakhyapanaparah; -voindayam (boo R, poo A) karplan-m-ldi, Ind. Stud. XVI. 111; vOrdan Vamantphalari tasmaj jatar vorhdajah; phalaht vamani, tasy & phalath phalahan karpaslirayakobakarpat; kitaj jAtam kitajan sutram ; is fivefold: pate pattasutram (detailed citation from the vriddhavyAkhya), Malae Malayavishayotpannam, absue, Chinamsud Chinavishaye, kimirage; - lomabhyd jatam valajan; is fivefold : unnie aurnikan, utthid auahtrikam, miyalomad, kutavo (k) umdururdmanishpannan, kittine ArnAdin yad uddhari tam - vakkayam (vhgayam A) sana-m-Adi valkajan, tatra 'taalstrar Malavak Adiprasiddham. There is no direct statement in reference to the relations of these stuffs, consisting of down, cotton, silk (from Malays and China), hair (wool, skin), planta (hemp, fax) to the brutam. Their use a paper, oto. for MSS. is doubtless here referred to as in the case of pattaya.
Page #323
--------------------------------------------------------------------------
________________ OCTOBER, 1992.) SACRED LITERATURE OF THE JAINS. 305 (29) In the enumeration of the names from ayara to ditthivda (anga 5 as vivahapannatti) the duvalasangam ganipidagam takes the place of the louttariyam, etc. In the case of the khettanupuvvi, the groups of the ah8188 (Rayanappabha to Tamatamappabha), tiriyaloe (Jambuddive to Sayambhuramane); uddhaloe (Sohamme to Isipabhara) are enamerated, and in the case of the kalana', the gradations of the divisions of time from samke to savvaddha. As we learn from a second discussion of the subject in a passage later on (see pp. 34, 37), we have to deal here with a progression by 84's and not by 10's. Cf. Bhagav. 1, 497, above, pp. 268, 411, 412. In the case of the ukkittananao we find an enumeration of the 24 Jinas. Under namam we find all manner of linguistic, grammatical and other statements. Immediate dependence upon Sanskrit literature is here very clear; thas e. g. as examples of monosyllables are cited the following four- hrib srih dhih stri (sic) in the Sanskrit form, manifestly because they (cf. Pingala's chhandas 1, 13. Ind. Stud. VIII, 217, 218) are used in Sanskrit grammar as customary (murdbAbhishikta) examples. The same fondness for Sanskrit may be observed in the metrical rules aoncerning gender, statements in reference to the finals of nouns, (,, o and am, in, an), sandhi agama, lova, pagadi i.e. praktiti, and vikara) and the five classes of words. For some of the names of these classes (e. g. namikam, naipatikam, akhyatikam aupasargikam, misram) and the examples of others, the Sanskrit is used. The sacred author makes, ludicrously enough, (30) a wilful error of a slight character. He cites, besides, other examples of sandhi; vadhu uhato vadbuhate, but Sanskpit has no nominative or rather no form vadhu. The nomin. is vadhus. In mentioning a subspecies of chhanama (shan') the twelve angas are again enumerated in detail (anga 5 again as vivahapannatti), and the navapavvadhara java choddasapuvvadhara mentioned (see Bhag. 2, 18). Under the head of all manner of aerial and heavenly phenomena the eclipses of the moon and sun are referred to. Under the head of sattaname we find a very thoroughgoing account of the seven svara's? interwoven with all sorts of gathus; ander atthaname a similar account of the eight cases (vibhatti), under navaname of the nine poetical (kavva-)rasas. Each of the latter is illustrated by a corresponding gathi. See Ind. Stud. XVI, 154-58. The following countries are enamerated under the head of a subspecies of dasaname, the khettasamjoga: - Magahae, Malavae, Soratthae Marahatthal, Kumkanal, Kosalae. If the first two of these names recall [31] the pre-eminent position occupied by Magadha and Malava at one time in India - see Ind. Streifen 1, 300, 344, - the two following names refer par excellence to Jainism. That the list is limited to these six names, whereas in anga 5 it embraced 16 and 25 in upanga 4, is a feature of significance which is probably based upon genuine knowledge of the facts. The list in anga 5 and in upanga 4 has no securer a foundation than that of a stereotyped literary tradition, In another of these subdivisions, the thavanapamane, which contains a discussion of the seven kinds of formation of names, we find an enumeration of the 28 nakkhattas, still begin * Thus sardhi. Agambpan.. padmani pay Arai, lovenamh..tatra te 'tra, pato atra path 'tra, payatta .. ugnt eau, pata imaa, kale et, malo ime, vikArenan .. daindasya Agrat dazhdAgram, sf Agata algata, dadhi idhan dadhidarn, bad thate nadhate, madhu udalam madhadakah, vadha (1) Ohato vadhhate - then, after mentioning the five classes of words, the examples to illustrate them are given in Sanskrit : abva iti namikan, khalv iti naip. dhavatt 'ty Akhy, part 'ty aup., sariyata iti mibran. * abbha ya abbharukkh$ sarjha gandhavvanagari ya ukka veya disadagh vijd gajjian nigghaye java, jakkh Alitta (yakahAdtptakani, nabhodrikyamAnAgnipibAchAh) dhamia mshid (ah Amikah mahikib) ragghAyA (rajaadghatAh, rajaavall disab) ohardovarlgA sardvardga chandaparives A sirapa padichamday& padisdraya, indadhand, udagamachhe (matay Ah, indradhanahkhandani) karihasis (kapihnaithny akasman nabhasi jvaladbhimalabdarapani) amoh (amoghah suryabinbad adhah kadAchid upalabhyamAnasakatoddhisansthitasyAmadirekhab) As ... The same enumeration is found also Bhagav. Ed. p. 224 and in siga 3, 10, according to Leumaun. 1 See my treatise on the Pratijndedtram, pp. 109, 110. * On Sorallth of. Kalpas. Therlv. 9.
Page #324
--------------------------------------------------------------------------
________________ 306 THE INDIAN ANTIQUARY. [OCTOBER, 1892 ing with krittika, though with their secondary titles (pussa, jettha, mula, savana, dhanittha, bhaddavaya). Cf. Ind. Stud. X 295, 16, 263, 415. The patronymic formation of eight different names, one for each born under a definite nakshatra, is here specially treated of and also the names in : dinna, dhamma, samma, (sarman), deva, dasa, sena, rakkhia, thus, e. g., kattia, kattidinna (kittideg), kattidhamma, kattisamma etc. Furthermore the patronymics from the names of each of their 28 divinities ; 10 thus aggie, aggidinne, aggidhamme etc. All this proves eo ipso that this kind of names was very popular at the date of the composition of the text itself, or rather at the date of its sources. This is for the latter a [32] factor of synchronistical importance (see p. 40) since these nakshatra names appear to have been exceedingly popular at the period of the grihyasutra, and even of Panini. See my treatise on the nakshatra 2,317 fg. As examples of patronymic kula-names Ikkhage (Aiksh vaka), Naye (the kulam of Mahavira) and Koravve ure cited. The following appear as pasanda in the same connection : - samane pamdaramge, bhikku kavalie, tavase and parivvayae, s. Bhag. 2, 213". The scholiast explains bhikkhu by Buddhadarsanasritah and on the other hand asserts that there is a five-fold division of samata : niggamtha-Sakka ('Sakya)-ta vasa-geruya ajiva with which Abhayadeva too is acquainted (see p. 281.). He connects the panduranga with the naiyayika. (But cf. above, p. 26.) Under the head of bhavapamana, as a species of pami nanama, the composition of words is first treated of. There are seven forms of this, the examples of the first form being given (see pp. 29, 30) in Sansksit, vix. : - 1. damda, examples : damtas cha oshtham cha damtoshthau, stanau cha udaram cha stanodaram, .. vastrapatram, .. asvamahishau, .. ahinakulam, 2. bahuvvihi, 3. kammadharaya, 4. digu, 5. tappurisa, 6. avvayibhiva, and - 7. @kasesa, the plural as a collection of several units (there is no dual). The eight-fold taddhitas follow the compounds :kammam 1 sippa 2 silo 3 samjoya 4 samivad 5 a samjuhe 6 issaria 7 'vachchena 8 ya taddhitanamam tu atthaviham || It is peculiar that among these examples there are almost as many of primary as of secondary formation and in fact [33] even compounds.11 The commentary explains this peculiarity, which is to be ascribed to actual ignorance (cf. the wilful blunder, p. 30) as follows: -- iha taddhitasabdena taddhitapraptihetubhuto 'rtho grihyate, tato yatra 'pi tunnke tamtuvie ity-adau taddhitapratyayo na drisyate tatra 'pi taddhetubhutarthasya vidyaminatvat taddhitajatvam (perhaps merely taddhitatvam) siddham bhavati. It is especially interesting that here samjaha, samyutha are explained by the scholiast as grantharachano, so that the examples cited in the text are to be regarded as titles of literary compositions :- Taramgavati, Malayavati, Sattanusathi (atta) and Bimda are such names ! dhatae is said by the text to be the third group of bhavapamina. It is explained in Sanskrit in the following most singular fashion :- bhu sattayam parasmaibhishi, ed ha vsiddhau, spardha sambarzhe, gadhoi pratishthalipsayor grantho cha, badhoi ledane, se 'ttam dhatue. This is nothing more than the beginning of Panini's dhatapatha; see Westergaard Radices, p. 344. The fourth group, niruttid, enumerates in Sanskrit a large number of very peculiar etymologies : mahyam sete mahishah, bhramati cha rauti cha bhramarah, [34] muhur mahur lasati musalam, kapir iva larvate thach (v. l. are ghatti, beti, sheti) cha karoti (patati cha is added by BC) kapittham, chid iti karoti khallam cha bhavati chikkalla, ardhvakargal ulukali, khasya mala mekbala. * The names in "bhati, of. Indo, Aggio, V&yuo, are omitted strangely enough. 10 ahi budbnya appears here as vivaddhi (!), of. vividdbi in auga 3 (p. 26), both are forms which are much more corrupted than the abhivaddhi (vuddhi) of the Suryaprajnapti, see Ind. Stud. 10. 205. 11 On 1 tanahral eto, on 2 vatthie, tunnda tamtavle etc., -on 3 samane, mAhnne, on ranno sasurae shlae, -on 5 girissa samive nagarar girinagaram, Vidisse s. n. Vediama, - on 6 Taramgavaikare (in BR invariably kAral), Malayavatti(vai BEL)kArd, satt(atta BB)atsatthikare, bindukare (of. dharmabindu lokabindu, p. 457), - on 7 tare talavard mAdambie ..-on 8 arahamtamaya, chakkavattimAy A, Baladevamaya, Vasudevamaya. 13 ardhvakarna ... omitted in B.
Page #325
--------------------------------------------------------------------------
________________ OCTOBER, 1892.] SACRED LITERATURE OF THE JAINS. 307 Under the head of pamana, that is divided into davvao, khetta, kalao and bhava", the measures of space, length of liquids, time and dry measures are treated of in extenso. There are frequent citations of lengthy passages of antique colouring, which deal in the form of a dialogue with the instruction of Goyama (by Mahavira) on this point. A very minute doctrine of atoms is also found here, see Bhagav. 2, 256-13 The enumeration of the measures of time is similiar to that in the kalinupuvvi, above page 29, the progression by 84's beginning three gradations after the quinquennial yuga. In the discussion on paliovame (palyopama) we find inserted a lengthy passage from the Pannavana (thiipaa) in reference to the duration of the continuance of creatures in their differnt gradations. This insertion is given in full in some MSS., in others the beginning and conclusion above are given, it being stated that it is a citation from the Pann. Not much farther on a question is introduced in the following fashion which does not seem original24: - tattha nam chodae (chodakah, prerakah, prichhakal) pannavayam (acharyain) evam vayasi, and then follow questions and answers in the usual way introduced by atthi nam.., and hamta ! atthi. Later on [35] comos the dialogue between Goyama (and Mahavira). clad in an old form which is probably caused by citationa. Under the head of gunappamana, the first group of the bhavappam., the nanagunap. is said to be four-fold :- pachchakkhe, anumane, avamane, and agame. The last is divided into loiye and louttarie. To the loiya is ascribed everything that is anninihin michchhaditthiebim sachchandabuddhimativigappiyam: - tam jaha: Bharaham Ramayanan java (BCR, evam A) chattari a veda samgovamga. Here we have a reference to an earlier enumeration. See above, pp. 9, 28. We find that jam imam arahamtehim bhagavamtahim savvadarisihim paniam duvalasangam ganipidagam, tam : Ayare java ditthiva a is considered to be loguttarie. There are, however, other divisions of the agama; thus, those into sutta, atthio and tadubhaya, or into attao, anamtarao and paramparao original doctrine, doctrine that has been directly received, and traditional doctrine (see p. 216). The charittagunapamand is said to be five-fold, sa maiachar., chhodovatthavaniachar.(AC, merely otthava BR) etc., and the samaia-char. two-fold :ittarie and Avakahie; 8. Aupap. pp. 33, 41, and Leumann in the Gloss. According to Leamann's communication this division goes back as far as Bhagav. 8, 2, 25, %. Is this the reason of the name of the chhedasuttas ? Uoder nayapamand three ditthamtas, examples, are discussed in detail; in these an "avisuddho negamo" is carried on from the general to the particular, or to the visuddhataro etc., and finally an advance made to the visuddho. In this section Padalipatta appears as the residence of the person who is questioned (Davadatta, Skr., not "dinna !), (36) and as situated in the dahinaddha of the Bharaha khetta.16 Under the head of parim anasam kh(y) the kaliasaaparim, i.e. manifestly the first 11 angas, 18 is contrasted with the ditthivaa. The point treated of is their mataal division into, 17 and enumeration of 13 Where addharanu is to be translated by Ardhvarenu, sanha", unaanha by Klakshnablakahaika, uchchhla. ksho: 'Bapha can be also for sakshma ; see Hem. 1, 118, where, however, we have Arshe suhumann. Of. 2,76? Hala 732. * While correcting the proof Leumann informs me of its occurrenoe in the Nandt, Ned. p. 885. It is also found in the Av. nijj. see p. 69. 16 I notice in passing that the example given on Hem. 2, 150, 1. e. Mahura va Padaliutte pAAA is in agreement with the examples in question found in the Mahabhishya. See Ind. 13, 380. Is this a one of direct borrowing? See above p. 83. Mathura does not play any great part among the Jains, but see the special statements in the beginning of the Vichar Amritanathgraha in reference to a Mathurt vAchanA (Skandilloh Aryknam abhimata). 16 Likewise in Avaby. 8, 60 (below p. 61); i.e. quite another terminology than that in N. (p. 11) and in the beginning of the An. itself (p. 21), where k Aliya is a subdivision of anangapavitha, or angabAhira. IT vedha, veshta, perhaps group of verses P nijjutti an explanatory section ? anuogadAra a paragraph tatra paryavah paryAyA dharma iti yavat, tadrupa samkhyA paryavasankhya (the meaning of paryava here as preliminary stage of akkhara is obscuro; per se it doubtless denotes the different groups of the alphabet), si cha k'Alikabrute anantapary Ayatmik drashavya, ekaikasyd 'py akaradyaksharasya tadabhidheyasya cha jivAdiva. stanah pratybkam anamtapary Ayatv At; evam anyatra 'pi bhAvan kary; navaram (1) sarokhyeylny akAradyak. sharani; dvyAdyaksharasainyogab samkhyey AhsamghatAh; suptinantani samaya(P)prasiddhAni v samkheyini padani ; gAthAdichaturthAnbarupah sarkhy@yah padah; .. Barkhy@y& veshtakah; nikshepaniryukty-upodgh&ta. niryukti-satrasparsikaniryuktilakshanA trividha niryuktir (see p. 38): vy AkhyopayabhatAni tatpadaprarpanatadiny (R) upakramadini vi samkhyly Any anuyogadvArAni. -The division into granthas, or at least this name for the division is not mentioned here. It is really identical with siloga.
Page #326
--------------------------------------------------------------------------
________________ 308 THE INDIAN ANTIQUARY. [OCTOBER, 1892. payyava, akkhara, sanghaya, pada, pada, gaha, siloga, vedha, nijjutti, anuogadars, and from here on the enumeration of the uddosaga, ajjbayana, suakkhandha, amga in the kaliasua, and of the pahuda pahudia, pahudapahulia, vatthu in the disthivaa. According to the fourth anga and Nandi (see p. 354 fg. 1), the latter method of division does not belong to the entire ditthivaa, but merely to the puvvas contained in it; [37] and the evidence of occasional citations made from the puvvas (and found in other works) prove that they were actually so divided. See ibid. vattavvaya is then divided into sasamayav. (sva), parasamayav. and sasamayaparasamayav. The scholiast cites as an example of the second a passage from aiga 2; the source of the one for the third is not stated.18 Thus the negamavavahero, but the ajjusua, explained by rijusutra (sruta !), 1. e. the orthodox believer, recognizes only the first two vatt., and of these two the first alone as entitled to authoritativeness, The attbahigara section consist le merely of the gatha: savajjajoga', which states the contents (attha) of each of the 6 ajjhayanas of the Avassaya. See p. 24. Under the head of samoyare, samavatara we find for the third time an enumeration of periods of time from avaliya to savvaddha. See pp. 29, 34. In the second dara, nikkheva, 20 the author returns to the samaiam and describes in several verses the nature of the samana [38] who possesses the samdiam.1 Two of these verses recur in the samaiyajjhay. of the A vasy. nijj. 8, 100, 110. See pp. 67, 68. The last section of the nikkheva, the suttalavayanipphanna, is not given in full by the authorfor brevity's sake," laghavatthan, since its contente is, he says, contained in the third dara, the agugama, which follows thereupon. This deals particularly with the guttanagama and the nijjutti-apag., which latter is divided into nikkhevaniji, uvagghayanijio and suttaphasianijjo (strasparsikao) - see p. 36Of the gathus cited in it one in part recurga in A vasy, nijj. 9, 65. Under the head of guttaphAsia the correct pronunciation of the suttas is treated of. Acoording to the scholiast there are 32 dosas and 8 (or 6) ganas, which he discusses ut length.24 The six different means of making oneself certain of the correct understanding of the text are also mentioned; they are: - samhita-form of the text, pada-form, sense of the words, division of the words into component parts, consideration of objections) and determination (rejection of the objections): samhiye ya payam cheva payattho payaviggaho chalase ya pasiddhi ya chhavviham viddhi lakkhanam. [39] The fourth daram, nas, consists of 6 gathas, of which the first four treat of the seven different forms of naya, i.e. method of conception, exegesis ; they are: - Degame, samgahe, 18 The lattex passage reads: AgAram AyasamtA v kranna va pavvaiya idath darisanam Avanna savvadukkha vimushohatt "tyAdi, on this the scholiast says: gyihasthAh, Arapya va t&pasidayah, pravrajita cha Sky &dayah idam asmadiyam matam Apanna Adritab arvaduhkhebhyo vimuchyarta ity evarh yada Sankhy Adayah prati. padayarti tad vam parasamayayaktayyat, yada tu Jainas tada svasamayavaktavyata, tatas cha 'BAU svasamayaperasamayayaktavgato 'chyate. 10 It rends: se kinh tan atth rdp jo jassa sijayanassa stthor In R, instead of tan we have simAiyaasa atthor, and this is doubtlens merely an example of how the verse is to be understood: siva jajoggaviral sloatth(r), akkittana ohnulaatthaassa atth eto. ; 6. 6. According to the scholiast: "arthAdhikaro 'dhyayane" Adipadad Arabhya sarvapadeshy anupartate, Is threefold, Ohanipphanne n.Amani syttAlAyayanio, bhani is fourfold: ajjhayanam, ajjhine (akshtra), Me (Syah). Jhavana (kahapan), names which are also samdyikachaturviobatistavadifrutavikeshApAth AmAnyani. 11 See Bhagay. 2, 186. n He has probably lost his breath! The following sections are treated in a very fragmentary fashion. * kirb kalyibah kassa kahit kasu kabam klohirah (kachohi") havai kAlam kai samaram #virahian bhav "garins.ph Asana niratt samAiam is to be supplied according to the soboliast. The verse recalls the quis ? quid 9 cur contra, similo, paradigmata, testes applied in German schools to the analysis of proverbs, eto. The scholiast is here very prolix, though the text is very ogmpact and brief. See on this Haribh, on Avuky. 10, 1 ato, in an avachari on the oghaniryaki we read : askhalita padochshirapan sanhita; padavibhagab padani; pedanam arthab padArthab; padevigrahastu samanbhauji padani; obAlana purvapakah Alamka; pratyavasthanam pirAlcarapena sapakahasthapapar,
Page #327
--------------------------------------------------------------------------
________________ OCTOBER, 1892.] SACRED LITERATURE OF THE JAINS. 309 vavahare, ujjasu i sadde, samabhiradhe, eyambhue. The scholiast says that they are named thus in reference to their connection with the samayikadhyayanam as the background of the entire work. Verse 5 gives a general definition of the word naya. Verse 6 makes known the fact that the sabu, sadhu, must hear all its forms with their manifold methods of representation, be purified by this means, and thus remain constant in his (correct) course of action. This concluding verse too thus refers directly to the samayikam, even if it does not mention it by name. It was quite necessary that here at the close some regard be had for the samaiam; the remain. ing part of the work refers to it but little. I have collected on Bhag. 1, 373, fg. some of the data regarding its age that can be extracted from the contests of the Anuyogadv. To the arguments that have been mentioned others may be added. In the forefront.is the direct connection of the work with the grammatical Sanskrit literature, especially the citation of the beginning of Panini's Dhatapatha. Next the information of a definite nature concerning the other literatures, Brahminical, etc., of that period. The nine kavvarasas point to a highly developed system of rhetoric, and the gahas cited therein demonstrate the existence of a rich Prakrit poetry after the fashion of the verses in Hala's saptasata kam. The names cited in the formation of taddhitas are perhaps to be regarded as titles of dramas (cf. nidagadi at the end of the loiya works) or [40] of romances. See p. 386. Bharatam (but not Mahabh.) and Ramayanam are mentioned three times in conjunction and undoubtedly were held in high esteem at that period. See my treatise on the Ram. p. 34. The contrast instituted between kalian suam and dirthivaa is of importance to Jaina literature. At the date of this work and at that of the Nandi, see above, p. 11, there existed a work, consisting of six ajjhayanas, on the six aivasyakas, the first of which is said to form the foundation of the Anuy., though no evidence can be drawn from the Anuy. itself to prove this assertion. Another fact that savours of antiquity is the special emphasis laid on the formation of the names of persons by means of the names of the nakshatras or of their divinities.28 The first nakabatra names appear in the old krittika series, though no longer in their ancient form; and the names of the divinities are very much corrupted. The significance of the names Chini, Soratjha and Marahattha, and those of the different pasandas, or of each of the divinities honoured by them, must not be overlooked. There is a commentary by Hemachandrasuri, scholar of Abhayaddvasuri.37 [41] The conclusion is formed by G. - The four.molagatras. I have as yet not been able to make out the significance of this, title,38 which has come to light only in quite modern times in connection with these texts. In the second mulasutra the expression molasutragatha (see p. 54) occurs (see scholiast on Avasy, nijj. 11, 61) thongh it is there probably used in contrast to the gathis of the nijjutti; so that mulasutra would mean nothing more than gutra (see ibid. on 11, 39), i, e. the original to which the nijjutti belongs. The three texts bearing the name mulasutra which I have before me (the fourth I do not possess) have in reality no satra form at all, but are almost entirely in metre; mulas. 1 and 3 in the ancient style (see p. 238, 239), especially in $10kas; the nijj. on 2 is in gatbas. Phey make the impression of being analogous to parisishtas rather than sutras. The mulas., which is No. 2 in Buhler's list, has not been preserved in its sutra form at all, only its * As a matter of fact suoh names are not often found in the Siddhinta. The following examples, however, belong here :- Asdha, Aggidatta, Somadatta, Pasamitta, Tisagatta, Tisabhaddas; cf. blso Revai-nakkhatta (above p. 7). It is surprising that the form in obhati is omitted, a form which is specially attested as occurring in Mah vira's time. Cf. also Passabhi, Siva'. See Mahabh, on Pan. 8, 2, 107 (Ind. Stud. 4, 381) on the common name of Agnibhati. 11 Other predecessors are Manisurndarasdri, Viradera and Jayasinhasdri; the gacha is erf Harshapurlys, the kulam that of brf PrabnavAhana. The well-known Hemachandra is, therefore, not referred to, and the above. mentioned Abhayadeva is doubtless not the navangtvsittiktit. Cf. pp. 276-7. >> Does it perhaps refer to the 5 malagunas (Avaky. 20,6-8).
Page #328
--------------------------------------------------------------------------
________________ 310 THE INDIAN ANTIQUARY. [OCTOBER, 1892. nijjutti being extant. The title of the fourth mulas, expressly declares it to be a nijj.; and since both the others have essentially the same form, it is not an improbable conjecture to regard these too as nijjuttis to a sutram of like name. On the other hand, however, special nijjuttis on each are cited by the scholiast, and these nijj. appear to be still extant. Of this kind are probably the two texts which the author of the Avasy. [42] nijj. 2, 5 declares that he composed on dasakalia and uttarajjhdeg. The prose portions found here have in places the old introductory formula: suyam me ausam..; and the concluding formula of each of the ajjh. (and uddes.) of malas. 1 and 3: tibemi gives us an impression of their antiquity. Furthermore, the titles of all the 36 chapters of the first mulas. are enumerated in the fourth auga, SS 36 hence this mulas. with essentially the same contents must have existed at the date of anga 4. It appears to be cited also in the Kalpasutra. In N. (above p. 11 fg.) we find only the three titles of the mulasutras I have before me the name of the fourth is omitted, and the title of the second plays there, as in the Anuyogadv. (above pp. 11, 22 fg.), a very prominent part. A very ancient author is quoted for the third mulasutram; and a single chapter (14) of the Av. nijj. is ascribed to a definite anthor, although the author of the Av. nijj. himself says, in the beginning of chap. 2, that he is author of a large number of nijjuttis on the most different parts of the Siddhanta, especially on several chedasutras, and, as already mentioned, on mulas. 1 and 3. The Avasy. nijj. contains, therefore, a large amount of authoritative data in reference to the date of its composition. The contents of all three texts belongs to the sphere of the vinayapitaka. The Nom. Sgl. Masc. of the 1 Decl. ends generally in o, but chiefly in e in the few prose sections; but both forms are found together occasionally, and in fact even in the same verse. [43] The extent of mulas, 1 is stated to be 2095 gr., that of 2 or its nijj. 2550, that of 3, 700 gr. The author of the commentary on 2 is said to have died Vira 1055. XLIII. First mulasutram, the uttarajjhayanam, in 36 ajjhayanas. The names of these ajjh., which are cited (see page 280) in anga 4, SS 38, are identical with those in the MSS. with but a few exceptions. By the chhattisain cha aputthavayaraniim, mentioned in the Kalpas. Jinach. SS 147, we must understand the Uttarajjh. according to the scholiast (Kalpalata). See Jacobi, p. 114. The correctness of this number (36) is corroborated by the concluding verse of the work itself. Haribhadra, on Avasy. 8, 54, explains the isibhasiaim mentioned there by uttarajjhayanidini; and ibid. 2, 5 both isibhas and uttarajjhdeg appear in conjunction in the The scholiast on Nandi explains (see p. 13 n.) the name uttardeg by the sarvesham adhyayananam pradhanatvam which belongs to this work. The author of the Avasyakanijj. states (2, 5) that he is also author of a nijj. on the Uttarajjh. text. With the exception of chap. 29 and the beginning of 2 and 16 which three chapters commence with the formula: sayam me ausam tenam bhagavaye evam akkhayam (or t. bh. Mahavirenam Kasavenam e. a.), the text is composed in metre and principally slokas, though there is an admixture of gathas, trishtubh, etc.30 The contents consist of direct ordinances in reference to a correct course of life, especially of the clergy, [44] and of recitals and parables illustrative of this life. Much of the contents makes upon us the impression of great antiquity and recalls similar Buddhistic texts and especially anga 2. - On this mulas. we have a very detailed commentary, sishyahita, by Samtisuri (Samtyacharya) in which frequent reference is paid to a nijjatti belonging to the text.31 See pp. 41, 43. 29 So also the anye in the Vidhiprapa; see pp. 429, 480. 30 The metre is often very much out of order, as in almost all metrical parts of the Siddhanta. 51 In a palm-leaf MS., dating itself 1307 (A. D. 1251) the 3 appears to me to be for an original 5; in which case the date would be 1507 (A. D. 1451). According to Jacobi, p. 9, the commentary of Devemdragani, which was ecomposed Samy. 1179 (A. D. 1123), is based upon that of Saintisuri.
Page #329
--------------------------------------------------------------------------
________________ SACRED LITERATURE OF THE JAINS. 811 OCTOBER, 1892.] 1. vinayasuyajjhayanam, 48 vv. begins: samjogavippamukkassa anagarassa bhikkhuno vinayam paukkarissami | vanupuvvim supeha me I The word buddha appears to be here and frequently elsewhere in the work, an honorific title of the teacher's (vv. 7, 8); cf. p. 263 (anga 2). 2. parisahajjh., 46 vv. with a prose beginning, which enumerates how the 22 parisahas: samanenam bhagavaya Mahavirenam Kasavenam paveiya. In the metrical portion the first person is used: parisahanam pavibhatti | Kasavenam paveiya | tam bhe udaharissami | anupuvvim sunehame || 1|| 3. chauramgam, giyyam in S,3% chau(ram)gijjam V, 20 vv.; of the manushatvadi. In the commentary on v. 9 we find particular statements in reference to the seven schisms. 4. asainkhayam, asamskritam, pamayappamayam va V, 13 vv. Of pramadapramadau (cf. No. 10 in the anangapavittha list of N., above p. 11), and of the apramada, maranakale 'pi. [45] 5. akamamaranijjam, 19 vv.; of the pamditamaranam. 6. khuddaga-niyamthijjam (cf. chap. 20), purisaviyyam S, 18 vv. Of the vidyacharanavikalpas of the virata. Its appellation in S is very different though the name there suits the present contents very well. 7. elaijjam (so also V; of edaka); ura(b)bhiyam S and urabbhi also here in C, in an enumeration of the chapters which is added to the close of this MS. only: 30 vv.; urabhradidrishtamtah, resp. rasagriddhityagah. 8. Kaviliyam, lijjam S V.; 20 vv. Of the nirlobhatvam. It closes: ii esa dhammo akkhae Kavilenam visuddhapannenam .. tti bemi 11 20 11 9. Namipavvijja, 62 vv. Of the charanam prati nihkampatvam; pattam thavijja rajje abhinikkhamai Nami raya. 10. dumapattayam, drumapattrakam, 37 vv.; apramadartham upamadvarena 'nusasanam. Instruction addressed to Goyama. It closes thus: buddhassa nisamma bhasiyam | sukahiam atthapahopasohiyam | ragam dosam cha chhimdiya | siddhigayam gae Goama tti bemi || 37 || 11. bahussuyapujjam (puvvam V), bahusrutapuja, 32 vv. In v. 1 the refrain of 1, 1. 2, 1: paukarissami, anupuvvim suncha me. 12. Harikesijjam (Hariesideg V), 47 vv. Of the tapahsamriddhi of Hariesabala. The stories belonging here and also to the following chapters are related in detail in the commentary. 13. Chittasambhuijjam, Chitrasambhutiyam, 35 vv.; nidanam tyajyam nidanadosha Kampillasambhuo Chitto. 14. Usuarijjam, Ishukariyam, 55 vv.; of the nirnidanataguna; pure purane Isngara name (i. e. not as Ind. St. 2, 843). [46] 15. sabhikkhu, ugam S, 16 vv. Of the bhikshugunas. Each verse closes with the refrain: sabhikkhu, cf. Dasavealia 3, 10. Begins: monam charissami samichcha dhammam. 16. bambhacherasamahitthanam, bambhagutti C, samahitthanam S. First an enumeration of the ten bambhacheras of the bhikkhu in prose, then 17 silogas. Of the brab mahacharyagupti. 17. pavasamanijjam, papasramaniyam, 21vv. Of the papasramanas varupam, and of the papavarjanam. Verses 3 to 19 close with the refrain: pavasamani tti vuchchai 18. Samjaijjam, Samjayiyam,33 54 vv. Of the bhogarddhityaga. Kampille nayare raya udinnabalavahane | namenam Samjao nama | migavvam (mrigavyam) uvanigjae || 19. Miyaputtiyam, Maijjam V, Miyacharitta (or Miyacharita) S, 97 vv. Of the nibpratikarmata, and of Miyaputta, son of king Balabhadda and of Miya; Suggive nayare. 32 S = Samavaya (aiga 4); V = Vidhiprapa, where the names are enumerated in detail. ss This might be per se for samyatlyam; since the papavarjanan is: samyatasyai 'va, sa cha bhogarddhityagata eva..
Page #330
--------------------------------------------------------------------------
________________ 312 THE INDIAN ANTIQUARY. [OCTOBER, 1892. FOLKLORE IN SALSETTE. BY GEO. FR. D'PENHA. No. 13. - The Cowherd and His Wife. There once lived a man with his wife and three sons, and when the sons came to be of a suitable age, the parents got them married. The wives of the two elder sons, having also attained puberty, came and lived with their husbands, but the wife of the third son, who was himself very young, being still too small, of course remained at her father's house. Several years passed and the father died. The two elder brothers took to their father's profession, cultivation, and the youngest, not being old enough to do any manual work, was told by his brothers to take the cattle out for grazing and such-like light work. Now it happened that his wife, being now twelve years old, had attained puberty, and was in the habit of going to a well to draw water, where she used to see a shepherd, and, calling out to him, would sing : "Aika na re, dik na re manjia me nd&vdla dada re, Aura ma inza, aura re nirap sung maja jasvantaa bharlard rd: Thiji na re rambh na zhdili kelu casi te, Kel sabi na wimana rasd dili re. Bayitki re, bagitli pdich dissa tu i na ra, vatra re, Nahin te na lavilu dusriasi na patu .'" Listen, O listen, brother shepherd, These words of mine; this message tell to my beloved husband :*Your wife has grown up like a plantain-tree, Like a plantain-tree, and like a lime she is full of juice. She will wait, she will wait for you for five days, Otherwise she will marry another.' For three or four days she said the same thing to the shepherd, and the shepherd used to deliver her message to her husband, whom he happened to meet on the pastore ground. Three days had passed, and on the fourth the cowherd asked his mother to let him go and fetoh his wife. It happened also that his two elder brothers had gone to another country to trade. So his mother said to him :-"Wait, my son, till your brothers come back, and then you can go with them aud fetgh your wife home." The cowherd, however, would not listen to his mother's advice, for who could tell when his brothers would return, and he knew that if he did not go soon, in one day more his wife would take to herself another husband. So on the fifth day, instead of rising and taking his cattle to graze as usual, he would not leave his bed. His mother saw him still asleep; so she Bang : Utta na rd, de manjia jasvanta go niwlid ne, Taji na ro dhorani na gurasi goffian gold bandalian nd." Rise, O rise, my beloved cowherd, Your cattle are still tied up in every stall. Then the cowherd, who was awake, thus sang to his mother: * Sordvih ge, sora aie, ani laudvirh vanata g8." Unfasten, O unfasten, and let them loose in the forest. [This quaint version of the "Taming of the Shrew" belonge to the "singing" class of tales very common in the Panjab, and there always associated, so far w I know, with the Rauld Cycle. This tale then is very important evidence of what I have long suspected, that the incidents of the Raulid Cycle are common to all Northern India. Thus we now know that a "singing" tale of a t'pe identical with those of that Cycle is current among the Salsette Christians without scription to any particular hero. -ED.] . lit., victorious. Rambhd is one that is an adept in singing. * lit., I will see, will see for five day your rond.
Page #331
--------------------------------------------------------------------------
________________ OCTOBER, 1892.] FOLKLORE IN SALSETTE; No. 13. 313 His mother unfastened the cattle from the stalls and drove them towards the forest, but she and his sisters-in-law wondered what was the matter with him. They asked each other if any one of them had said or done anything to annoy him, but all pleaded ignorance. And his mother, thinking perhaps he was sick, called out her eldest daughter-in-law, and sang : "Aika na go, aika na manja mhone nd suns ge, Lavd na ge, ldva na sune gavetana chavia ge; Kardvia ge, kdrd na sdne valchandchia xana ge, Paratavia ge, parata sune dhondie sandie ge, Paedvia g8, pard na sine tuje jdsvanta dira g6." Listen, o listen, my eldest daughter-in-law, Put, O put, daughter-in-law, keys to the drawers; Take out, O take out, daughter-in-law, ingredients for medicine, Grind, O grind them, daughter-in-law, on the stone mortar, Give to drink, O give to drink, daughter-in-law, to your beloved brother-in-law. When the cowherd heard what his mother had said to his sister-in-law, he sang in answer - Dukatli ge, ddkatli dil tumche mhotte na stinachanh potre 98." Is aching, is aching, mother, your eldest daughter-in-law's stomach ? By this he meant, of course, to tell his mother that he had no need of the medicine, which she had told her daughter-in-law to give him, but that his sister-in-law herself wanted it. His mother, however, did not understand the drift of what he said, and thinking perhaps that he did not like to take the medicine out of his eldest sister-in-law's band, she called out to her second daughter-in-law, and thus sang to her : " Aika na ge, dika na manje madalas na sune ga, Liva na ge, uva na sune gavetana chavia ge; Karavia ge, kara na sune vakhandchia xdna 96, Paratavia g&, parata sune dhondie sdndie ge, Pazavia ge, paza na sune taje jasvanta dira ge." Listen, O listen, my second daughter-in-law, Put, O put, danghter-in-law, keys to the drawers ; Take out, O take out, daughter-in-law, ingredients for medicine, Grind, O grind them, daughter-in-law, on the stone mortar, Give to drink, O give to drink, daughter-in-law, to your beloved brother-in-law. When his mother had done singing to her second danghter-in-law to give the boy medicinethe cowherd, still in bed, thus sang to his mother : "Dukatoi ga, dakatei die tumche madale sinechan potta 98." . Is aching, is aching, mother, your second daughter-in-law's stomach ? His mother now thought that he would not take any medicine even from his second sister, in-law, and so she said nothing. A little while afterwards the cowherd arobe, and dressing himself very shabbily, took a horse from the stable, and took the road to his wife's house; though he had never seen his wife, much less her house. He thought, however, that the shepherd, who used to bring her message to him, wonld guide him there, and so he went on and on. On his way he came upon his sister's house, when his sister, seeing him dressed so shabbily, asked him what was the matter with him and where he was going. He told her how for two or three days successively he had received a message from his wife, and that he was going to fetch her home. . Lit., Middle; but second is meant.
Page #332
--------------------------------------------------------------------------
________________ 314 THE INDIAN ANTIQUARY. (OCTOBER, 1892. "But," said she, "how will you find out your wife's house ? And how will you know her? You have never seen her before !" "I will go," he answered, "and wait for the shepherd, who will surely guide me." His sister then said to him :"Don't do so. Take these few stones with you. When your wife comes to the well and sings to the shepherd, you will know her ; and when she has filled her pitcher and is about to lift it up on her head, throw one of these stones at the pitcher, which will be then charmed, so that she will be unable to carry it!" The cowherd took the stones, and riding his horse went away. As he went along he came upon the well and there saw a young woman drawing water, and suspecting that it must be his wife he waited there. Soon afterwards he saw the shepherd driving his sheep to the pastureground. When the woman saw the shepherd, she sang : " Aika na re, aik na re manjia mendevala dada re, Aura manga, aura ro Trap sang mat. jaetanta Bhartara re :* Taji na re rambha na chaili kelu zasi re, Kel zasi na nimana rasa bili re. Bagitei re, bagitei panch dissu taji na re vattu re, Nahin te na lavilu dusriasin na patfa re.'" Listen, O listen, brother shepherd, These words of mine; this message tell to my beloved husband : Your wife has grown up like a plantain-tree, Like a plantain-tree, and like a lime she is full of juice. She will wait, she will wait for you for five days, Otherwise she will marry another.' The shepherd listened to her, and promising to deliver her message, went away again, as he had not seen the cowherd. The cowherd now made sure that the young woman was bis wife, and waited till she had filled her pitcher, and when she was about to carry it, he hit it with one of the stones given him by his sister. As soon as the stone struck the pitcher, his wife was unable to lift it up. She tried all her strength, but to no avail; the pitcher was as if fixed in the ground. She looked about to see if there was any one about the place, whom she might call to help her, and saw the cowherd on horse-back, and as she, too, had not seen him before, she did not recognise him as her husband. She therefore thus sang to him :-- "Ehi na re, eh na re manjia ghorevala dada re." Come, O come, my brother groom. But the cowherd answered: " Paila hatu lavin na ge titje shobalanas 98, Ani dusra hatu ldvin na ge ghdgarila ge." One hand I will place upon your breasts, And with the other I will lift up the pitcher. Upon this the wife sang to herself, addressing her mother : " Sadanchanh khanam na die, sadanchas na pinan ga, Sadanchi ghagar na dil, saddnchi na chumbalu ge, Azu mansan soru konih khalan ge ?" My nsual food, mother, and my usual drink, My usual pitcher, mother, and my usual pad, Where is my strength gone to-day? * Lit., who has eaten my strength to-day?
Page #333
--------------------------------------------------------------------------
________________ OCTOBER, 1892.] FOLKLORE IN SALSETTE; No. 13. 815 She made another attempt to lift up the pitcher, but in vain; so she again beckoned to the supposed groom to come and help her, singing: - "Ehi na ra, eh na re manjia ghorevala dadd re." Come, O come, my brother groom. But the cowherd sang as before : - "Paila hatu lavin na ge tuja shobalanain ge, Ani dusra hatu lavin na ge ghigarild ge." One hand I will place upon your breasts, And with the other I will lift up the pitcher. The poor woman had now no alternative, but to allow him to place one hand on her breasts. So he came, and having first placed one hand on her breasts, he only touched the pitcher with the other, and she was enabled to carry it as she would a feather. Taking up her pitcher she went to her house, our hero following her. His wife, however, did not like this, so she shut the door against him. And then he sang : " ugara ge, agar rambha darbajacha khila ge. Aildi na, aflai tuza jasvanta bhartaru ge." Open, O open, wife, the bolts of the door. Is come, is come, your beloved husband. But the wife thinking he was only a groom, who had followed her with evil intentions, paid po heed to what he said, and hurled at him abuse in the following strain : - " Manje na re jasvanta gounwaliacha kitara nahin sasasil." You are not worthy of being my beloved cowherd's dog. But our hero paid no attention to the abuse, and repeated his entreaties to his wife : - " @gara ge, ugar rambh& darbajacha khild ge. Aildi na, dildi tuza jasvantu bhartari ge." Open, 0 open, wife, the bolts of the door, Is come, is come, your beloved husband, The girl, however, would not open the door, and continued to abuse him, singing: - "Manje na re jasvanta gounwdliachan dukar nahin sdrasil." You are not worthy of being my beloved cowherd's pig. Still the cowherd did not mind his wife's abuse, but sang: - "ugara ge, ugar rambha darbajacha khila g8. Audi na, arlai tuza jasvanta bhartari ge." Open, 0 open, wife, the bolts of the door. Is come, is come, your beloved husband. But still the girl could not be persuaded to believe that the youth was really her husband, and therefore sang: - "Manje na re jasvanta gounwaliachi manuar nahin sangoil." You are not worthy of being my beloved cowherd's cat. For the third time the cowherd bore the abuse patiently, and for the third time he entreated her to open the door for him, singing : "Ugara ge, ugar rambha darbajachd Rhila g6. Aildi na, ailai tuza jasvanta bhartaru ge." Open, 0 open, wife, the bolts of the door. Is come, is come your beloved husband.
Page #334
--------------------------------------------------------------------------
________________ 816 THE INDIAN ANTIQUARY. [OCTOBER, 1892. Thus they kept on for some time, one begging for the opening of the door, and the other abusing him instead, till the girl's parents, who had gone out, oame in and recognising their son-in-law, took him into the house, introducing him to their daughter as her husband, and entertaining him as a son-in-law. The day passed and in the evening, as there was no spare sleeping-room for them, the wife asked her sister-in-law to spare her room for them for the night, singing: - "Diava na ge, diava kuniad tumcha kambara ge. Diava na ge kuniad tumcha kambara ge." Give, O give, sister-in-law, your room. Give, O sister-in-law, your room. Her sister-in-law willingly gave up her room to them for the night, and having taken their supper they went to bed. On the following morning, while she was still in bed, the cowherd's wife sang to her mother : "Nahin na go, ndhin ave komala mathianchash na mogarash g8 ! Nahin na ge, nahin aie pusala doliancha karola ge! Nakin na ge, nahin aie vasikharli mathiachi na vini ge !" Not faded, not faded, mother, the jessamine from my hair! ! Nor rubbed off, nor rubbed off, mother, the lamp black from my eyes! Nor disbevelled, nor dishevelled, mother, my hair! To which her mother sang in reply : - - " TS to na g8, to te dhde Aslai Idngall bhdgala ga. : TS te hai dhis lajecha na combara ge." He has come, he has come, daughter, knocked up and tired. He is, daughter, a shy cock. They then arose and another day passed, and in the evening, the cowherd's wife asked her aunt to spare her room for them for the night. She sang : " Diava na 98, diavd kalli tancha kambara ge. Diavd na g& kaki tamcha kambara ge." Give, O give, aunt, your room. Give, O aunt, your room. Her aunt also gave up her room with the greatest pleasure, and when the night had come they took their supper and went to bed. Next morning, when she awoke, the cowherd's wife sang to her mother : " Nahin na ge, nahin aid komala methiancha na magarash 98! Nahin na g8, nahin tid pusald doliascha kuxou ge! Nahin na ga, ndhin dit vankharli mathiachi na vini ge !" Not faded, not faded, mother, the jessamine from my hair! Nor rubbed off, nor rubbed off, mother, the lamp-black from my eyes ! Nor dishevelled, nor dishevelled, mother, my hair! And her mother again sang to her: - - To te na ge, to te dhus ailli ldigala bhagala ge. T8 td hai dh us ldjechd na combara ge." He has come, he has come, daughter, knocked up and tired. He is, daughter, a shy cock. When they awoke the following morning, the cowherd told his father and mother-in-law that he wished to go home, and to take his wife with him. They had, of course, no objection,
Page #335
--------------------------------------------------------------------------
________________ Ostoviv; 1892.] and the mother made her daughter dress for the journey. While she was combing the girl's hair and putting on her a new rich sari and other things, her daughter sang : MISCELLANEA. "Kala na ge, kala die saria ani gharia ge? To to hai na va tech vutsari go." Why, why, mother, these sarts and other clothes ? He is only a passer-by! But her mother, who knew better, paid no heed to her daughter's words, and when she was ready, she ordered a palanquin for her; but the girl would not sit in it, and had therefore to follow her husband on foot. Half way she complained that she was tired, upon which her husband taunted her: : "Nahin na g8, ndhin die komalam mathiancham na mogaram ge! Nahin na ge, nanin die pusald doliancha kasolu ge! Nahin na ge, nahin aie vankharli mathiachi na vini ge !" Not faded, not faded, mother, the jessamine from my hair! Nor rubbed off, nor rubbed off, mother, the lamp-black from my eyes! Nor dishevelled, nor dishevelled, mother, my hair! And again with the words: "Kala na ge, kala die saria ani gharia ge? To te hai na vattecha vatsari ge." Why, why, mother, these saris and other clothes? He is only a passer-by! When she was thus taunted she followed him quietly till they reached his sister's house. There he told her to get a large vessel with seven holes, and ordered her to fill it up with water. But how could such a vessel be filled? As fast as she poured water in it, it ran out through the holes! But she was made to bring water, till she was brought to submission and admitted him as her husband. They then went to their house, and lived happily together to a good old age. MISCELLANEA. 317 NOTES ON THE NATIONAL CUSTOMS OF THE KARENNIS. The Karennis, or the Red Karens, call themselves Kay. Their classical appellation is Kirata. They inhabit the tract of country, lying between the parallels of 18deg to 20deg North latitude and 97deg to 99deg East longitude, with an area of about 7,200 square miles. They are a strong and hardy race, fierce and desperate fighters, and take a special delight in raiding into the neighbouring territories, kidnapping men, women, and children, and driving off cattle. A raid, made on a village is either through the existence of some chwe, or on account of the favourable omens shown by a fowl's bones at the installation of a Chief. The word chwe means an affair awaiting settlement, and is, in fact, a casus belli. The nearest English word, which would express its meaning, is 'feud.' Its literal meaning in Burmese is debt.' Among the Karennis any wrong done against their persons, or property, or any insult done to their tutelary nats is a chwe, and it must be expiated either by blood or presents. A chud is not wiped off by the death of the original offender; his children and his children's children are held responsible for his wrongful acts. It is the persistence of this. custom of 'feud' that causes the Kachins, Karennis, Chins, and other wild tribes of Burma to have no union among themselves, in spite of their community of language, beliefs, and traditions, and splits them up into various clans at feud with one another. A Chief among the Karennis attains his position not by hereditary right, but on account of certain sacred characteristics. He must abstain from rice and liquor. His mother. while enceinte, must have eschewed these things and lived solely on yams and potatoes. She must not have eaten any meat, nor drunk the water out of the common wells; and in order to be duly
Page #336
--------------------------------------------------------------------------
________________ 318 THE INDIAN ANTIQUARY. (OCTOBER, 1892. qualified for a Chiefship her son must continue these habits. Such a child is taken good care of, and in due time installed as a Chief in the following manner. A ho, - a low, rambling rectangular bamboo structure is built and the candidate for the Chiefship is placed in it. Each villager brings one bunch of plantains, one mat, and at least a quarter of a tical weight of silver as offerings. The amount of the silver offering, however, varies from a quarter of a tical to a full tical, according to the resources of the village. The villagers also bring fowls, whose bones are to be used in reading omens. They then proceed to pass a merry time the whole night long, drinking kaung, their national beverage, and dancing round the ho. The fowls are killed and the leg bones are carefully scraped clean, and certain small holes in them are examined with a piece of straw or bamboo. If the holes on the right leg. bone are situated higher up than the correspond ing ones on the left, the omen is considered to be auspicions. By this method of divination, which is quite a science among the Red Karens, the future of the candidate for a Chiefship is settled. The questions usually solved are whether the newly installed Chief will be one of might and power, whether the villages will prosper under his rule, and whether the people now assembled will be able to undertake forays successfully and with a minimum of loss to their side. Every man is judge in his own case in Karenni, and the exaction of an indemnity in consequence of a chwe, which is an affair of honour, rests with himself. It is only in im portant differences and disputes that the Chief exercises his prerogative by stepping in as an arbitrator or peacemaker. Divination by means of the bones of a fowl plays an important part in Karenni politics. All organized raids are determined in this way, and sometimes the subjects of a Chief disobey his orders, when the bones consulted predict unfavourable events. The Karennis pay no regular revenue to their Chiefs. All that they are called on to pay is a silver offering, as described above, on certain days, as the anniversary day of the Chief's installation, or some festival day. Such silver pieces are hoarded in the hollow of the central post in the ho. The Karennis, like all other wild tribes, are noted for their fidelity to their oaths. There are different forms of oath-taking: -(1) killing buffaloes, eating their flesh, and preserving their horns, one being kept as a memento by each party participating in the ceremony ;' (2) drinking water, in which a drop of human blood from a puncture in the arm has been infused; (3) eating a jack-fruit; and (4) exchanging spears. The first three forms are used when an interchange of fraternity takes place. The fourth signifies that a reciprocal guarantee is given that no harm shall be done to the recipients. Sometimes, after deciding a knotty case between parties, who have a chwe against each other, a Karenni Chief gives his spear to one of the litigants in order to shield him from private vengeance. T. S. K. NOTES AND QUERIES. MISCELLANEOUS SUPERSTITIONS AS TO If a horse neighs, or an ass brays, or a clock ANIMALS IN MADRAS. chimes, or a bell is rung, or a dog twitches his If one happens to see a jackal on first rising ears, or a gun is fired, just when one is contemfrom bed, there will be success in every enterprise plating the performance of anything, there will undertaken during that day. It is a common certainly be success in the enterprise or attaincustom among the Hindus of Madras, when a man ment of the object. meets with exceptional success, to ask him, "Did K. SRIKANTALIYAR. you see the jackal's face early this morning P" Ootacamund. BOOK-NOTICES. ARCHEOLOGICAL SURVEY OF INDIA, THE MONUMENTAL Leipzig.--Otto Harrassowitz. Imperial Quarto. ANTIQUITIES AND INSCRIPTIONS IN THE NORTH 1891. WASTERN PROVINCES AND OUDH, described and Tbe new series of Archaeological Survey Reports arranged by A. FUHRER, Ph.D., Archeological well begun by Messrs. Fuhrer and E. Smith's Surrey, N.-W. P. and Oudh. Allahabad-Printed and Published by the Supdt., Govt. Press, N.-W.P. handsome volume on the Sharqi Architecture and Oudh; Calcutta.-Thacker, Spink & Co.; of Jaunpur is worthily continued by the work London.-Trubner & Co. and W. H. Allen & Co.; which is the subject of this notice. 1 [o=am, in awful'-ED.) (Chetpojt), Chief of Western Karennt, and Mr. O'Riley, ? Such a ceremony was performed by Kyetpogyi | Deputy Commissioner, Toungoo, in 1857.
Page #337
--------------------------------------------------------------------------
________________ OCTOBER, 1892.) BOOK NOTICE 319 The book is printed in large quarto size on good trabild, or "canopied stone," as stated by Sir paper, and the binding and typography are much A. Cunningham." superior to the work ordinarily turned out by Page 23.-An old fort, in Tahsil Sahaswan, 20 official presses in India. miles north-west from Badkon, has the remarkSome misprints and slips of the pen have able name of Kot salbahan (Salivahana). escaped correction; for example, the name of Page 35.-In Pargana Bilart of the Mura. the well-known Bhar tribe is perversely printed dabad District "there is considerable opporBhar, with the long vowel, throughout the book. I am familiar with the Bhar country, and am tunity for antiquarian researches, as nearly | every second village has an old mound, or dih, quite certain that the vowel is invariably short. to the west of it." In the spelling of Indian words Dr. Fuhrer has allowed himself to fall into the sin of Page 36.-To the south-west of the village of pedantry :-jungle' is now as good English as Azampur, in Tahsil Hasanpur of the same dis. verandah,' or 'mango,' and it is absurd to print trict, "is a kherd, which is the site of ancient the word as 'jangal.' buildings. It is reported that there was here the I do not understand on what principle the word school of FAisi Fayazi, brother of Abal Fazl, Baiyid or Sayyid (AA), is spelt Sa'id, a form the great historian of Akbar's time. The ruins which is incorrect, both for transliteration and of an arched doorway are still standing. The earth of this mound is carried off by people, pronunciation. who come from long distances, in order to So much for small slipe and defecte. They I give it to students to eat, as it is supposed to do not seriously in pair the value of the book, have very beneficial influence on the brain and and need not be further dwelt on. While com- memory!" menting on the external features of Dr. Fuhrer's Page 42. -The ruins at Mati (Matripura) in book, I must not forget to mention that it is fur. Tahsil Pewayan of the Shahjahenpur District nished with admirable indices. Careful readers are extensive and apparently would repay exami. should not, overlook the important "Addenda et nation. Corrigenda" at pp. 331-334. The Classified Lists of the Monumental Pages 53-68.-These pages contain a good Antiquities and Inscriptions in the North- summary account of the buildings at Agra. Western Provinces and Oudh contained in this Dr. Fuhrer thinks that the Palace of Jahangir volume have been prepared in compliance with in the Fort was probably built by Akbar, late in ordere issued by the Government of India in 1885. his reign, to serve as & residence for the heir. The system of classification adopted is designed apparent and his family. He does not accept as a guide to assist Government in deciding ques. A. Cunningham's suggestion that the building tions concerning the conservation and repair of was erected by Ibrahim Lodf. ancient monuments. "The object of this Pages 105-107.-It is to be hoped that a full volumo," observes the compiler, "is not only and connected account of the discoveries at to produce complete lists, so far as known, of the Mathurd will some day be published. Pend. antiquities and epigraphs in each district for the ing such publication the notes here given are of use of the Archaeological Survey, but to furnish interest: " The Kankall Tile lies at the side of general information for the guidance of the many the Agra and Delhi road, much nearer the city residents in these Provinces, with the view of than the Jamalpur mound. On the summit enabling them, if their tastes so incline, to stands the fragment of a carved pillar venerated interest themselves in the character and history at the present day, the suppored image of the of the remains in their vicinity." goddess Kankali." The work may be regarded as an abstract of In the hill itself were found buried two culosSir A. Cunningham's Reporta, topographically ! sal statues of Buddha, each 7 feet high. Here arranged, and brought up to date. also was found the large figure of an eleI now proceed to notice some passages of phant standing on the capital of a pillar with special interest. an inscription of the Indo-Scythian king Page 8.-The local name of the rock at Huvishka. KAlst in the Dehra Dan District is Chitrabild, During the extensive ercavations, carried on "inscribed or pictured stone," and not Chhat- (by Dr. Burgess in January 1888, and by Dr. [It would be quite different word, and would ordinarily represent a .-ED.) - [It should be noted that, in correcting General Cunningham's version of the name, Dr. Fuhrer twice confounda fild, stone, with flla, virtue.')
Page #338
--------------------------------------------------------------------------
________________ 320 THE INDIAN ANTIQUARY. [OCTOBER, 1892. Fuhrer in January 1889, a large number of very invalid, but Bhinli Dih occupies approximately interesting Jaina relics have been unearthed, the position indicated by the Chinese travellers, namely:--a four-faced lion-capital of the Indo- and I do not see why it should not yet be proved Scythian period; a massive door-jamb, the to be Kapilavastu. But it must be admitted that three faces of which are divided into panels of satisfactory proof has not yet been given. equal size, containing scenes of domestic lifo Page 229.-By an odd blunder Kumaragupta represented under temple facades of the Nasik Mahendra is described as the son of Skandagupta. cave pattern; several beautifully wrought panels, bearing inscriptions in the Maurya alphabet; Page 271.-" It is interesting to note that in twelve large statues of Digambara Tirthan 1876 several rectangular Chinese silver coins karas, bearing inscriptions dated in the regnal were found close to the river Ganges in a dih at years of the Indo-Scythian kings Kanishka 'Alau'ddinpur, about six miles west of BanHuvishka, and Vasudeva; and two colossal statues garmad," in the Unao District of Oudh. of Padmaprabhanatha, dated Samvat 1036, or Page 274.--The ancient village of Sanchankot A. D. 978. and Sarhvat 1134, or A.D. 1088, being or Sujankot, on the right bank of the river donative gifts of the Svetambara community of Saf in the Unko District, is identified by Dr. Mathura. Fuhrer with the Sha-chi of Fa-Hian. Sir A. Probably, on this mound stood the Upagupta Cunningham held that both the Sha-chi of Famonastery mentioned by Hiuen Tsiang, which Hian and the Visakhi of Hiuen Tsiang are reGeneral Cunningham identifies with the Yasa presented by the existing town of Ayudhya, or Vihara inside the Katra. The railway from Ajodhya, and that both are identical with Mathura to Brind&ban has been cut through the Sa ketam. Dr. Fuhrer holds that Ayudhya = lower terrace of the Katre in January 1889, and Saketam = Visakha, but that Sanchankot = during the excavations several Buddhist sculp- Sha-chi. tures have been discovered, as well as a mutilated Pages 306-313.-The account given in these inscription of the Maukhari king Mahaditya, pages of Sahet-Mahet in the Gonda District, and a beautifully written slab, dated Samvat the site of the famous city of Bravasti, is the 1207, but partly damaged in the middle. best yet published. But, remarks Dr. Fuhrer, These inscriptions have been edited by Dr. "notwithstanding the excavations made by Buhler for the Epigraphia Indica. General Cunningham in 1862 and 1876, and by Dr. Hoey, C.S., in 1885, as yet very little is Page 138.-Concerning Jhdai, in the Allahabad known of the ruins covered with dense jungle District, the ancient Pratishthanapura, the inside the old city, which must contain relics residence of PurQravas, the first prince of the lunar which would do much to elucidate some of the dynasty, the compiler remarks: "The only re most interesting periods of Indian history. There mains now existing are the ruined forts of can be no doult whatever that a thorough and Samudragupta and Hamsagupta. Fifteen properly conducted excavation would be of great years ago twenty-four gold coins of Kum&ragupta were unearthed here." Does this mean that the success, and yield many Buddhist and Jain relics; names of Samudragupta and Hamsagupta are but it ought to be gone about in a scientific method." still remembered by the people P If so, the fact is curious. Who was Hamsagupta Page 321.-Dr. Fuhrer shows good reasons for Page 222.-Dr. Fahrer here recapitulates the believing that the well-known fort at Dalman arguments already published in his Jaunpur on the Ganges, the most picturesque object in Oudh, was not originally a fort at all, but volume, which convince him that Bhinla Dih in the Basti District cannot be Kapilavastu, consists really of two Buddhist stupas." the birth-place of Buddha, as Mr. Carlleyle and Page 323.-The O'-yu-t'o of Hiuen Tsiang Sir A. Cunningham confidently believed it to has been identified with so many old sites in be. Dr. Fuhrer successfully attacks some of | Oudh, that I hope Dr. Fuhrer 18 correct in Mr. Carlleyle's fancies, but I do not think that asserting that on topographical grounds and from his criticisms justify the conclusion that it is a calculation of distances it may sately "evident that Bhinli Dih ig not the ancient site identified with Jagatpur in the Rai Baroli of Kapilavastu," Some of Mr. Carlleyle's reasons District. for supposing it to be that site are undoubtedly 19th April 1892. V. A. SMITH. 3 There seems to be some mistake here : 1036-97856, and 1134-1088 = 45. The paragon in the text are quoted as amended by the list of Corrigenda. * The author writes "jangal,' but in this I decline to follow him. Nor can I consent to call my familiar friend, the coolie, by the outlandish name of 'qull.'
Page #339
--------------------------------------------------------------------------
________________ SYSTEM OF TRANSLITERATION. The system of transliteration followed in this Journal for Sanskrit and Kanarese, (and, for the sake of uniformity, submitted for adoption, as far as possible, in the case of other languages),- except in respect of modern Hindu personal namos, in which absolute purisun is undesirable, and in respect cf a few Anglicised corruptions of names of places, sanctioned by long usage, is this: Sanskrit. Kanarese. Transliteration. Sanskrit. Kanarose. Transliteration. bha ja # 44 44 24 tha 4 250 & 23.63 B3 dla na au ra Visarga pha 21 al &OSL&act Huada al 3 al det ba Visarga Jikvdmillya, or old Visarga before a and Upadhminiya, or old Visarga be fore and Anusrdra Anutuisika bha Anusodra Iba K1 & 3 13 gla is ha cha chha A single hyphon is used to separate words in composition, as far as it is desirable to divide them. It will readily be seen where the single hyphen is only used in the ordinary way, at the end of a line, as divided in the original Text, to indicate that the word runs on into the next line; intermediate divisions, rendered unavoidable here and there by printing necessities, are made only where absolutely necessary for neatness in the arrangement of the Texts. A double hyphen is used to separate words in a sentence, which in the original are written as one word, being joined together by the euphonic rules of sandhi. Where this double hyphen is used, it is to be understood that a final consonant, and the following initial vowel or consonant-and-vowel, are in the original expressed by one complex sign. Where it is not used, it is to be understood of the orthography of the original, that, according to the stage of the alphabet, the final consonant either has the modified broken form, which, in the oldest stages of the alphabet, was used to indicate a consonant with no vowel attached to it, or has the distinct sign of the virama attached to it; and that the following initial vowel or consonant has its full initial form. In the transcription of ordinary texts, the double hyphen is probably unnecessary; except where there is the sandhi of final and initial vowels. But, in the transcription of epigraphical records, the use of this sign is unavoidable, for the purpose of indicating exactly the pulaeographical standard of the original texts. The avagraha, or sign which indicates the elision of an initiala, is but rarely to be met with in inscriptions. Where it does occur, it is most conveniently represented by its own Devanagari sign. So also practice has shewn that it is more convenient to use the ordinary Devanagari marks of punctuation than to substitute the English signs for them. Ordinary brackets are used for corrections and doubtful points; and square brackets, for letters which are much damaged and nearly illegible in the original, or which, being wholly illegible, can be supplied with certainty. An asterisk attached to letters or marks of punctuation in square brackets, indicates that those letters or marks of punctuation were omitted altogether in the original. As a rule, it is more convenient to use the brackets than to have recourse to footnotes; as the points to which attention is to be drawn attract notice far more readily. But notes are given instead, when there would be so many btackets, close together, as to encumber the text and render it inconvenient to read. When any letters in the original are wholly illegible and cannot be supplied, they are representea, in metrical passages, by the sign for a long or a short syllable, as the case may be ; and in prose passages, by points, at the rate, usually, of two for each-akshara or syllable.
Page #340
--------------------------------------------------------------------------
Page #341
--------------------------------------------------------------------------
________________ NOVEMBER, 1892.) SOUTH INDIAN COPPER COINS. 321 SOUTH-INDIAN COPPER COINS. BY E. HULTZSCH, PH.D.; BANGALORE. A s far as I can ascertain, the majority of the coins which form the subject of this paper, A a re now published for the first time. Others (Nos. 6, 7, 9, 11, 12, 14, 24, 27, 30) were included, because the previously published readings of their legends were more or less capable of improvement. Most of the coins form part of those which were selected from the collection of the late Mr. T. M. Scott, of Madura, for the Government Central Museum, Madras, by me and Mr. C. Rajagopala Chari. The abbreviations are the same as ante, Vol. XX, p. 301, with the following additions : Atkins = The Coins anil Tokens of the Possessions and Colonies of the British Empire, by James Atkins; London, 1889. Thurston = History of the Coinage of the Territories of the East India Company in the Indian Peninsula, and Catalogue of the Coins in the Madras Museum, by Edgar Thurston ; Madras, 1890. Traoy = Pandyan Coins, by the Rev. James E. Tracy, M. A.; Madras Journal of Literature and Science for the Session 1887-88. Tufnell = Hints to Coin Collectors in Southern India, by Captain R. H. C. Tufnell, M. S.C.; Madras, 1889. Mr. B. Santappah, Carator of the Mysore Government Museum at Bangalore, has again obliged me by preparing the plaster chats, from which the accompanying Plates were copied. I. VIJAYANAGARA COINS. No. 1. Harihars. M. Obv. A bull, facing the right; in front of it, & sword. On a specimen belonging to Mr. Tracy, a four-pointed star is visible over the back of the ball. Pratapa-Ha rihara. The legend is surmounted by symbols of the moon and the sun. This coin is a variety of the coin No. 3, ante, Vol. XX. p. 302. Ray TV Rev.rAhara No. 2. Mallikarjunaraya. MH. Obv. An elephant, facing the left; above it, the Kanarese syllable Ni. 300 MaliRev. Tomussa kajunard1 huru yarn.s No. 3. Ditto. M. Same type as No. 2, but the elephant on the obverse faces the right. This and the preceding coin closely resemble Sir W. Elliot's No. 92, on which see ante, Vol. XX. p. 304. Mallikarjana was a son and move or of Devariya II., whose latest date is Saka-Savat 1371 expired, the ayolie year Sukla. An inscription of Mallikarjanadeva, the Bon of Davariya, on the loft of the entrance into the first prailedra of the Aralala-Perumal temple at Little Kinchi is dated in Sake-Sanvat 1387 expired, the oyolie year Parthiva. Ho appears to have been succeeded by his brother Virpikshadeva, whose inscription on the South 1 Read. Harihara. * Read Malukarjunariyary. Bowl Indian Inscription, Vol. I. No. 81.
Page #342
--------------------------------------------------------------------------
________________ 322 THE INDIAN ANTIQUARY. [NOVEMBER, 1892. wall of the Abhisheka-mandapa in the same temple is dated in 'Saka-Samvat 1392 expired, the cyclic year Vikriti. The two Tamil dates are as follows: A. Inscription of Mallikarjuna. Sri-Virapratapa-Devaraya-maharayar kumarar Mallika[r]jjunadova-maha[ra]yar pridivirajya[m]-ppanni aralaninra Sakabdam 1387n mel sellaninra P[ard]dhiva-sanvatsarattu Vrischika-nayarra purvva-pakshattu purnnaiyum [N]ayarru-kkilamaiyum perra Kattigai. [B]L "While Mallikarjunadeva-maharaya, the son of the glorious Virapratapa-Dovaraya. maharaya, was pleased to rule the earth, on the day of (the nakshatra) Krittika, which corresponded to Sunday, the full-moon tithi of the first fortnight of the month of Vrischika in the Parthiva year, which was current after the 'Saka year 1387." B. Inscription of Virupaksha. Sri-Devariya-maharayar ku[ma]rar art-Virupikahadeva-mahiriyar p[ri]divi-rjyam paqni arulaninra Sakabdam 1392n mel sellaninra Vikriti-sauvarsarattu Magara-nayarru a[parapakshattu amavasyai[yum] Aditya-varamum perra Tirav[onat]tu nal A[r]tta-udaiyapunya-kalattile. "While the glorious Virupakshadeva-maharaya, the son of the glorious Devarayamaharaya, was pleased to rule the earth,-at the auspicious time of Ardhodaya on the day of (the nakshatra) Sravana, which corresponded to Sunday, the new-moon tithi of the second. fortnight of the month of Makara in the Vikriti year, which was current after the 'Saka year 1392." No. 4. Sadasivaraya. MH. Obv. God and goddess, seated. zrIsadA Rev. Fu yaru [Sri-Sadi]. sivarayaru. This copper coin corresponds to the pagoda figured by Sir W. Elliot, No, 100; see ante, Vol. XX. p. 306, No. 32. No. 5. Ditto. M. Obv. A kneeling figure of Garuda, which faces the left. Rev. Same as No. 4. The obverse of this coin is an imitation of the copper issues of Krishnaraya, ante, Vol. XX. p. 306, No. 28. No. 6. Tirumalaraya, H. Obv. A boar, facing the right; above it, a sword and the sun. Rev. hr@ ruml D200 [Sri-Ti]. rumala Taya. This coin is figured by Sir W. Elliot in the Madras Journal, New Series, Vol. IV. Plate i. No. 11. The execution of the Kanarese legend is so barbarous, that the reading would remain doubtful, unless a similar Nagari legend did occur on the coins figured ibid. Nos. 12 to 17, which have nearly the same obverse as the coin under notice. A correct transcript of the legend on the reverse of these coins was given ante, Vol. XX. p. 307. See also Mr. Sewell's Lists of Antiquities, Vol. II. p. 245. Read Virupaksha.
Page #343
--------------------------------------------------------------------------
________________ NOVEMBER, 1892.] SOUTH-INDIAN COPPER COINS. II. CHOLA COIN. No. 7. M. (Elliot, No. 152). The obverse and reverse are identical. In the centre is a scated tiger,-the emblem of the Chola king,-facing the right, with two fishes,-symbols of the Pandya king,-in front, and a how, the emblem of the Chera king,- behind. The whole group is flanked by two lamps and surmounted by a parasol and two chauris. Underneath is the legend : Obv. and Rev. { gaMgaikoNDa sites: GamgaikondaChola[b]. Rev. (Tamil.) This coin is republished, because Mr. Thomas has misread it (Elliot, p. 132, note 1). The name or surname Gangaikonda-Chola, "the Chola (king) who conquered the Ganga." survives to the present day in Gangaikonda-Solapuram, the name of a ruined city in the Udaiyarpalaiyam taluka of the Trichinopoly district. The earliest reference to this city is in a Tanjavur inscription of the 19th year of the reign of Parakesarivarman, alias RajendraCholadova. As this king claims to have conquered the Ganga, it is not unreasonable to suppose that he bore the surname Gangaikonda-Chola (I.), and that both the foundation of the city and the issue of the coin are due to him. A proof for the correctness of this supposition may perhaps be derived from the unpublished inscriptions on the walls of the ruined Brihadisvara temple at Gangaikonda-'Solapuram. This temple is called Gangaikonda. Cholesvara in four Pandya inscriptions, while a mutilated inscription of Kulottunga-Choladeva I. refers to a temple named Rajendra-Sola-Isvara. If, what is very probable, this temple has to be taken as identical with the first, it would follow that the founder of the Isvara (Siva) temple at Gangaikonda-'Solapuram bore the two names Gangaikonda-Chola and Rajendra-Chola. Further, the surname Gangaikonda-Chola is applied to the maternal grandfather of Kulottunga I. in the Kalingattu-Parani (x. 5). Though the same poem (x. 3) gives the real name of Kulottunga's grandfather as Rajaraja, there is no doubt that, as Dr. Fleet (ante, Vol. XX. p. 279 f.) points out, this is a mistake or an inaccurate expression for RajendraChola, who, as we know from the Chellur grant, was the father of Ammangadevi, the mother of Kulottunga I. A coin which resembles the one under notice, but bears the Nagari legend Sri-Rajendrah (Elliot, No. 153), may be attributed to Parakesarivarman, alias Rajendradeva. An unpublished inscription of this king at Manimangalam in the Chingleput district mentions a Gangaikonda-Chola (II.) who was the uncle of, and received the title Irumadi-Chola from, the reigning king. Subsequent to the time of Rejendra-Chola, the next mention of GangaikondaSolapuram is in an unpublished inscription of Rajakesarivarman, alias Vira-Rajendradeva, at Karuvar in the Coimbatore district. This inscription also refers to a son of the king, whose name was Gangaikonda-Chola (III.), and on whom the title Chola-Pandya and the Bovereignty over the Pandya country were conferred by his father. According to the Kalingattu-Parani,10 Gangapuri, i.e. Gangaikonda-Solapuram, continued to be the royal residence in the time of Kulottunga-Choladeva I. (A.D. 1063 to 1112). In Bilbana's Vikramankadevacharita (iv. 21, and vi. 21) the city is mentioned under the name Ganga. kundapura, which the Western Chalukya king Vikramaditya VI. is said to have taken twice. III. MADURA COINS. No. 8. MH. Obv. Two fishes. 323 - Sri-Avanipasegaran golaga. South-Indian Inscriptions, Vol. II. p. 105. ibid. p. 109, and Vol. I. p. 99. A third coin of similar type (No. 154) has Uttama-Cholah in Nagarf, and a fourth (No. 151) Uttama- Cholan in Grantha characters. * Not Sundara-Pandya-Chola, as stated in Dr. Burnell's South-Indian Paleography, 2nd edition, p. 45, note 1. 10 ante, Vol. XIX. p. 389.
Page #344
--------------------------------------------------------------------------
________________ 324 THE INDIAN ANTIQUARY. (NOVEMBER, 1994 "The round coin (P) of the glorious Avanipabokhara (i. e. the ornament of princes)." No. 9. MH. (Elliot, No. 189). Obv. A standing figure, facing the right. Rev. SanA. Rev. du ko(Tamil.) Ladan. "He who conquered the Chola country."l1 The correct reading and explanation of this legend is due to my First Assistant, Mr. Venkayya, No. 10. MH. Obv. Same as No. 9. Rev. Two fishes; between them, the Tamil legend : El nta laiye No. 11. M. (Elliot, Nos. 137 and 160). Obr. Same as Nos. 9 and 10. Rev. Two fishes, surrounded by the Tamil legend Ellantalaiya. No. 12. MA. (Elliot, No. 136). Obv. Same as Nos. 9 to 11, with the addition of the Tamil syllable Su on the right side, Rev. A fish between two lamps, surrounded by the same legend as on No. 11. No. 18. MH. Obv. Same as Nus. 9 to 11. ElRev. lan (Tamil.) talai. ya. The legends of Nos. 11 to 13 appear to be abbreviations of the longer legend of No. 10. which on some specimens is further shortened into Ellantalai. Mr. Tracy, p. 2 f. pointed out that Sir W. Elliot's reading Samarakalahala is impossible, and muggested Elidnagaraiydlan instead. But the syllable which he reads rai, is clearly lai on all the coins. The preceding syllable might be ka, ga or ta, da; the sense requires the second alternative. The last syllable is distinctly nan on No. 10. Ellan-talaiy-apan means "he who is the chief of the world" and appears to be the Tamil original of the Sanskrit epithets visvattarakshmdbhrit, sarodttara. kshmabhrit, and sarvottirnamahibhrit, "the king who is the chief of the world," which occur in verses 7, 8 and 15 of an unpublished inscription of Sandara Pandya on the East wall of the Second prakara of the Ranganaths temple at Srirangam. I would accordingly attribute the issue of the coins Nos. 10 to 18 to Sundara-Pandya, who ascended the throne in Saks-Sachvat 11 SonAdu is a contraction of landu, a Malda of MalainAdu; see below, p. 94, and South Indian Inscriptions, Vol. II. p. 167, note 5, and p. 229, note 2.
Page #345
--------------------------------------------------------------------------
________________ 10 13 SOUTH-INDIAN COPPER COINS. 8 14 FULL-SIZE. 3 6 12 15 Plate i. From Casts made by Mr. B. SANTAPPAH, Curator, Bangalore Museum.
Page #346
--------------------------------------------------------------------------
Page #347
--------------------------------------------------------------------------
________________ NOVEMBER, 1892.] SOUTH INDIAN COPPER COINS. 325 1:73 (ante, p. 122). This supposition is further strengthened by the fact that, on the obverse of some copies of the coins Nos. 10 to 13 (e. g. on No. 12 of Plate i), we find the Tamil syllable Su, which appears to be an abbreviation of Sundara-Pandiyan. Compare De for Devaraya ; ante, Vol. XX. p. 303, No. 12. No. 14. Visvanatha. M. (Tracy, No. 9). Obv. Same as No. 13. Rev. A sceptre between two fishes, surmounted by a crescent and surrounded by the Tamil-Grantha legend : [1.] Vi- [5.] n. [2.] eva- [4.] da [3.] naMr. Tracy, p. 6, took the final Tamil for a Grantha s, and the Grantha group sva for a Tamil va. No. 15. Ditto. M. Obv. A sceptre between two fishes. Rev. A crescent; below it, the Tamil-Grantha legend : Visvanada No. 16. Ditto. M. Obv. A sceptre between two fishes; above them, the Tamil legend : Pan. diyan. Rev. The same legend as on No. 15. Nos. 14 to 16 belong to Visvanatha, the first Nayaka of Madura (A.D. 1559 to 1563). No. 16 shows that he wanted to be considered as the rightful successor of the Pandya dynasty. No. 17. MH. Oby. A standing figure. S 308 VerkaRev. w tapa. This is a variety of No. 37, ante, Vol. XX. p. 308. . No. 18. H Oby. Three standing figures. VerkaRev. 30 [ta]pana( yk (yaka). No. 19. MA. Obv. A kneeling figure, which faces the right (ViRev. rabha(Grantha.) dra. ( veNk
Page #348
--------------------------------------------------------------------------
________________ 326 THE INDIAN ANTIQUARY. [NOVEMBER, 1892 Rey. S des No. 20. MH. Obv. A kneeling figure of Garnda, which faces the right. Bri-a. tev. 303 namta, It is not known to which of the rulers of Madura the names Virabhadra and Ananta on the reverse of Nos, 19 and 20 refer. But the style of the kneeling figure on the obverse connects the Grantha coin No. 19 with the Tamil coins of Bhuvanaikavira (Elliot's No. 138) and Samarakolahala, and the Kadarese coin No. 20 with the Nagarl coins of Krishnaraya and Sadasivaraya (No. 5, above). No. 21. H. Oby. A lion, facing the right. Rev. Mina (Tamil.) ltchi, Minakshi is the name of the goddess of Madara. According to Mr. Sewell's Lists of Antiquities, Vol. II. p. 203, queen Miqakshi of the Nayaka dynasty ruled from A. D. 1731 to 1736. The reverse of the coin may refer to the goddess, or to the queen, or to both at the same time. No. 22. MH. Obv. Same as No. 21. Rev. Madu. (Tamil.) rai. No. 23. MH. Obv. Dopo Madhara. Rev. Same as No. 22. The obverse of No. 22 connects this coin with No. 21. The bilingual coin No, 23 agrees with No. 22 in the reverse, which bears the Tamil name of the city of Madura, while its Telugu equivalent occupies the obverse. IV. BRITISH BAST INDIA COMPANY COINS, No. 24. MH. (Tufnell, No. 49; Thurston, Plate zu, No. 1). Oby. De Sri. Rev. Kum(Tamil.) I pini. No. 25. MH. Obv. An eight-pointed star. Rev. Same as No. 24. The reverse of Nos. 24 and 25 is an early attempt to transliterate the word "Company in the vernacular character. The auspicions monosyllable Sr (Fortune) appears to be inserted on the obverse of No. 24 from similar motives as the word Sriranga on Nos. 26 to 29. No. 26. H. Obv. An orb, surmounted by a cross, Soe Srt grNg ramga. 1 On some specimens of this and the next soins, the second line of the legend reade od instead of dox through s mistake of the engravor of the die. See Nos. 96 b and 28 of Plato ii.
Page #349
--------------------------------------------------------------------------
________________ SOUTH-INDIAN COPPER COINS. Plate ii. 17a 22 23 26a 28 FULL-SIZE. From Casts made by Mr. B. SANT.APPAH, Curator, Bangalore Museum.
Page #350
--------------------------------------------------------------------------
Page #351
--------------------------------------------------------------------------
________________ NOVEMBER, 1892.] SACRED LITERATURE OF THE JAINS. No. 27. H.-A.D. 1678 (?). (Atkins, p. 140, No. 34). Obv. Same as No. 26, but the figure 78 inscribed in the lower portion of the orb. Rev. Same as No. 26, with the addition of a double line between the two lines of the legend. Mr. Atkins attributes this coin to the Bombay Presidency; but the Southern characters on the reverse prove it to be a Madras issue. No. 28. H.-A.D. 1698. in a circle. Obv. 18 98 Rev. Same as No. 27. No. 29. H.-A.D. 1705. (Thurston, Plate xii. No. 3 ?). Obv. Same as No. 26, but the figures 17 and 05 inscribed in the upper and lower half of the orb. Rev. Same as Nos. 27 and 28. The word Sriranga, which appears on the reverse of Nos. 26 to 29, is, as a neuter, the name of a celebrated shrine of Vishnu near Trichinopoly, but is also used in the masculine gender as an epithet of the god Vishnu himself. This reverse was probably selected by the Company with the view of making their coin popular with the native public, and of matching the image of Vishnu, which was engraved on all the Madras pagodas. V.-FRENCH COIN OF KARIKAL, No. 30. H. (Tufnell, No. 48). Pudachche Obv. (Tamil) 327 Rev. (Tamil) ri. Karaik kal.13 Puduchcheri and Karaikkal are the original Tami! forms of the names of the Frenc settlements Pondicherry and Karikal. WEBER'S SACRED LITERATURE OF THE JAINS. TRANSLATED BY DR. HERBERT WEIR SMYTH. (Continued from page 311.) of 20. mahaniyamthijjam (cf. chap. 6), mahanirgramthiyam; anahapavvayya S; 60 vv. the anathatvam; Senio Magahahivo v. 2. The title found in S agrees with the contents (as was the case with 6 and 7). 21. samuddapalijjam (deglejjam V), samudrapaliyam, 24 vv. Champae Palie nama I savae asi vanie| Mahavirassa bhagavao Of the viviktacharya. Begins: siso so u mahappano 11 13 No. 80 a of Plate ii shows the first and second lines of the obverse, and the second and third lines of the reverse; No. 30 b exhibits the second and third lines of the obverse, and the first and second lines of the reverse.
Page #352
--------------------------------------------------------------------------
________________ 328 THE INDIAN ANTIQUARY. (NOVEMBER, 1892. = 22. rahanomijjam, 49 vv. Of the anorathanemivach charanam; utpannavisrotasikena 'pi dhgitih karya. Begins : [47] Soriyapurammi nayare | asi raya mahiddhie | Vasudeva 'tti name. nam | rayalakkhanasamjue 11 1 || tassa bhajja duve asi | Rohini Devai taha | tasim dunha pi do putta ittha Rama-Kesava 11 211 v. lab Samuddavijae naman | v. 14 11 311 tassa bhajja Siva nama i tise putte mahiyase 1 bhagavam Aritthanomitti loganahe damisare 11 411 ... 23. Kesi-Goyamijjan, Kebi-Gautamiya; Gotamakesiyyar S; 89 vv.; chitta viplatih paresham api Kesi-Gautamavad apaneya. Begins : jine Pasi tti numenam araba logaphie.. 111 Il tassa 18ga paivassa | Asi sise mabayase | Kesi Kumarasamane | vijjacharanaparage 11 21. See p. 897 on upanga 2. 24. samisu, samitio s, pavayanamayaro (!) C; 27 vv. Of the pravachanamatsisvarupan, i.e. the 5 samiti and 3 gupti, which are together also called attha bamiso: iriya-bhase-'sana dane uchchare samil iya | manogatti vayagatti kayagatti ya-atthama 11 2 11. These are regarded as the mothers as regards the duvalasangam Jinakkhayam pavayanam. See Ind. Streifen, 1, 133, 200, 2, 047, in reference to the ethical three-fold division into mano, vaya, kaya. 25. jannaijjau, yajniyan, 45 vv. Jayaghoshacharitavarnanad varena brahmaguna iho 'chyamte. Begins: mahanakulasambh & Iasi vippo mahajaso 1 janyaf-ja majannammi (yamayajne) I Jayagbosu tti namo II II 26. simayari, dasasadeg C, 53 vv. Only he who is in possession of the brahmagunas (chap. 25) is a yati, tona cha 'vasyam samachari vidheya. This is ten-fold:34 [48] kvassiya, nisihiya, 36 Apuchhana, padipuchhan, chhamdana, ichhakaro, michhakero, tahakkaro, abbhutthanam, u vasarpaya. The similar enumeration in Avaay, nijj. 7, 19, where there is, however, a different arrangement (the same as in anga 3, 10, and Bhag. 25, 7 according to L.):- ich hakarb, michha, tahakkaro (6-8), avao .. chhamdana (1-5), nimamtana (instead of 9), uvasampaya (10). - Haribhadra on Avasy, nijj. 6, 88, say 30 that there are three kinds of samhchari, 1. the OghasAmachari, represented by the Oghaniryukti, on the 20th prabhritam (oghapra) of the 8. vastu (acharkbhidhana) purva 9, 2. the dasavidhasamachari, for which our chapter and Av. nijj. 7 is authoritative, and 3. the padavibhagas&machari, which too is represented by chhedasatralakshanan navamat purvad eva nirvyudha, or by kalparyavaharau.37 - Begins : samayarim pavakkhami savvadukkhavimukkhanin jar charittana niggatha Itinna samsarasagaram || !! 27. Khalunkijjam, khuluo V, 15 vv. Of the sathata; the asathata is the antecedent condition for the samachari. It begins : there ganahare Gagje (Gargyah) munt Asi visarae ainne gasibhavammi samahir padisamdhae 11 | The name comes from v. 3: khalumke jo u joei, khalumkan galivsisabban (s. Hem. 1263) yo yojayati. 28. mukkhamaggagai, sivamaggadeg C, 36 vy. Of the mokshamarga. Begins : makkhamag. gagain tachcham suneha jinabhasiyam .. 29. sammattaparakkamam, samyaktva"; appamad S. In proso; anataram (in chap. 29) jua nadini muktimargatveno 'ktani, tani cha samvegadimulani akarmatavasanani; (49) yadva mokshamargagater aprama da eva (on this then is based the title in S) pradhanan. Enumeration of the 73 samvagadini, means of deliverance (cf. Leumann, Gloss. Aup. p. 155, 8. v. samvejana): sarnvege nivvee 2, dhammasaddha 3 gurasahammiyasususannya , Aloaniya nindanaye 6, garihanaya , si miie and the remaining 5 Avassaya , - 18 etc. to akammaya 73 (cf. the 48 samvegadini, Bhagav. 16, 3, and 27 samv. in auga 4, , Leum.). As in the beginning (see p. 43) so in the end there is a direct reference to Mahavira: esa khala sammattaparakkamassa ajjhayanassa atthd samanenar bhagavaya Mahavirenam agghavie pannavid paru vid dansio nidamsie nvadamsie tti bemi. * The word silmayari recalls especially the imayacharikasutra of the Brahmins, with which the significance and contents of these texta is in agroomont. From this I am led to conclude that simfly Art is an intentional deformation of smaylchari ; see pp. 223, 288, 243 fg. 35 naishedhikt, see pp. 452, 257. 6 See pp. 357, 449. The three sam Ayarl texts which I have before me - see pp. 223, 369 fg. - contain another division than that stated above. Their contents is, however, connected, and they agree in the main with each other.
Page #353
--------------------------------------------------------------------------
________________ NOVEMBER, 1892.) SACRED LITERATURE OF THE JAINS. 329 30. tavamaggijjam, oggo s, maijjam V, 37 vv., tapomurgagati. Begins: jaha u pavaga kamma ragadosasamajjiya khavei tavasa bhikkhu tam egagamano suna 11 ill 31. charanavibi, 21 vv.; charanavidhi. 32. Pamayatthanan, 111 vv.; pramidasthanani. Begins : achchamtakalassa samulayassa savvassa dukkbassa u jo pamakkho tam bhasad me padipannachitta suneha egamtahiyan -hiyattham. 33. kammapayadi, karmaprakritib, 25 vv. Begins : astha kammkin (cf. Bhag. 2, 196) vuchhami anupavvim jahakkamam | jehim baddhe ayam jive | samsure parivattae 11 1 || nanassa "varanijjam | damsanavaranam tabe veyanijjam tahu moham | Aukamman taheva ya 11 11 namakayyam cha goyam cha | amtaruyam taheva ya. Closes : eesim samvare cheva | khavane ya jae (yateta) buhe tti bemill 11 The nanam e. g. is (see N. Anuy. Avasy. Aupap. p. 41) five-fold: suyam, Abhinibohiyam, ohinanan, mudananam, kevalam. 34. lesajjhayanam, lesya, 62 vv.; anamtare (in 33) praksitaya uktas, tatsthitie cha losyavasatah ; apra[ 40 ]sastalekyatyagatah prasnste eva t adbishthatatavyAh. Begins : lesajjbayanam pavakkhami i anapuvvim jahakkamar chha ham pi kammaldsknam | anubhe ve suneha me ll ll Closes : appasatthau vajjitta I pasatthau ahittha8 (adhitishthet) muni tti bemi 11 621 Bhag. 1, 160, Leum. Aup. p. 149. 35. anagaramaggam, ogge s, ggo V; 21 vv.; himsaparivarjanA daye bhikkhugunah. Begins : suneha me egaman magjam Savvannudesiyam 1 jam kyaram to bhikkha i dokkbana 'mtakaro bhave il 1 11. Closes : nimmamo nirahankard viyarago anasa vo sampatto kevalam nanam BAsayam parinivvuda tti bemi Il 31 11 36. jirajivavibhatti, 268 vv. Begins: jivAjivavibhattim sune ha me egamana id 1 jam janiuna bhikkhu samma jayas samjame Il 1 11. Closes : ii pau kare buddhe | nayae parinivvue chattisan uttarajjhko bhavasiddhia sammai (samvude A) tti bemi ll 265 11 At the end in some MSS. of the text and in the scholiast there are added some variant verses of the niryuktikara in praise of the work : je kira bhavasiddhia I parittasamsaria a je bhavva I te kira padhanti ed i chhattisa uttarajjhae il 111 ... XLIY Second malasutram, Avagyakasatram. By Avasya ka, as we have often seen in the case of painna 1, Nandi and Anuyogadv., are meant six observances which are obligatory upon the Jain, be he layman or clerical. That the regulations in reference to these observations had an established text as early as the date of N and An., is clear from the fact that they appear in the Nandt as the first group of the anamgapavittha texts (see above p. 11); and in the Anayogadv. the word ajjhayanachhakkavagga is expressly given as its synonym. See p. 22. We have also seen (51] that the Anuyogadvarasu tram claims to contain a discussion of the first of these 6 iyaeyakas (the samaiyam), but that this claim is antagonistic to that limitation of the samaiam to the gavajjajogaviratiin which frequently secures the Anay. By this limitation an ethical character is ascribed to the work, the contents of which is, furthermore, at variance with the claim mode by the Anay. The avasya kasatram is a work which deals with all the six avasyakas in the order38 which is followed in the Naadi and Anuyogadvara, and discusses the samaiam actually, not merely nominally as the Anuyog. does. Unfortunately we possess, not the text of the Avasy., but merely the commentary, called sishyahita, of an Haribhadra 39 which is as detailed as that on mulas. * See p. 434 on this arrangement. * At the close he is called a pupil of Jinadatta from the Vidyadharakula, or an adherent of Sit&nbarlchirya Jinabbata: sam&pta che 'yan fishyshita nama "vabyakatika, kritib Sitambar Acharya JinabhatanigadAnuskrino VidyAdharakulatilakacharya Jinadattalikshyasya dharmato joini (Akint!)-mahattaramnanaralpaminar&(P)charya Haribhadrasya. The Ganadharmadrdhabata is here referred to (of. v. 52 fg.) and the great Haribhadra (+ Vira 1055); see pp. 371, 372, 456 fg. In Peterson's Detailed Report (1883) we find oited (pp. 6-9) under No. 12 & vritti of & 4rt-Tilakachkry, scholar of Sivaprabha, composed sahwat 1296.
Page #354
--------------------------------------------------------------------------
________________ THE INDIAN ANTIQUARY. 1. Of this commentary there is but cne MS., which, though written regularly enough, is very incorrect and fails in every way to afford the reader any means of taking a survey of its contents by the computation of the verses, etc. It labours under the defect of such manuscript commentaries in citing the text with the pratikas only and not in full, with the exception of foll. 73 to 15341 and some other special passages. The text is divided according to the commentary into [52] the six ajjhayanas, with which we are already acquainted: 1. the samaiam, the savajjojogavirai, which extends to fol. 196b, a. the chauvisaithava or praise of the 24 Jinas, extending to 204b, s. vamdanayam or honor paid to the teachers, reaching to 221a, 4. padikkamanam, confession and renunciation (to 298b), 6. kaussaga, expiation to (315), and 6. pachchakkhanamn, acceptation of the twelve vratas (to 342a). 330 [NOVEMBER, 1892. By samaiam much more than the savajjajogavirati is meant It is etymologically explained by samanam jnanadarsanacharitranam ayal (35b). It treats not merely of the doctrine of Mahavira on this point, but also of the history of the doctrine itself, i. e. of the predecessors of Mahav., of himself, of his eleven ganaharas and of his opponents, the different schisms (ninhagas, nihnavas) which gradually gained a foothold in his teachings. The latter are chronologically fixed. Haribhadra quotes very detailed legends (kathanakas) in Prakrit prose (sometimes in metre) in this connection and also in connection with the ditthamta and udaharana which are frequently mentioned in the text. These legends have doubtless been borrowed from one of his predecessors whose commentary was composed in Prakrit. The remarks of this predecessor, cited elsewhere either directly as those of the Bhashyakara (see on Nijj. 10, 47), or without further comment or mention of his name, he has incorporated into his own commentary. This too was here and there composed in Prakrit. Occasional reference is made to a mulatika (see on Nijj. 19, 122), which in turn appears to have been the foundation of the Bhashyakara. [53] Even if we do not possess the text of the shadavasyakasutram with its six ajjhayanas which was commented upon by Haribhadra, our loss is to a great degree compensated by a metrical Nijjutti. This is even called avasyakasutram at the close in the MSS., and is probably the only Avasy. text which is extant. At least Haribhadra regarded it as an integral portion of his text. He has incorporated it, with but a few omissions, into his commentary, and commented upon it verse for verse. He cites its author not merely as Niryaktikrit, kara, (e. g. on chap. 16, 17) as Samgrahanikara, as Mulabhashyakrit (e. g. 2, 138), or even merely as Bhashyakara (e. g. on 2, 70, 143, i. e. just as the author of the above mentioned commentary in Prakrit prose) but also occasionally as gramthakara, "krit (see for example Nijj. 8, 44, 10, 6), and even as sutrakara, krit (e. g. Nijj. 1, 76, 16, 50). The verses of the Nijj. are occasionally called 43 sutras by him! From a consideration of these facts we are led to the conclusion that the sole difference between the text commented on by Har. and the Nijj. lies in the different division the text being divided into 6, the Nijj. into 20 ajjhayanas. See below. The fact that Har. does not cite at all some sections of the Nijjutti (for example the Theravali at the very start) may, however, be held to militate against the above conclusion. His text too contains besides the Nijj. several other parts, chiefly in prose, [54] which he calls sutras or words of the sutrakara (see Nijj. 13, 63), e. g. especially a pratikramanasutram given in extenso. He furthermore occasionally contrasts the sutragatha or mulasutragatha with the gathas of the Niryuktikara. See on Niry. 11, 30, 81.44 --- With this the following fact is in agreement: several times in the MSS. of the Nijj. there are inserted in the text short remarks in Sanskrit which refer to the proper sutram. This sutram has, however, not been admitted into the text, e. g. Nijj. 10, 2, 12, 176. In one case, chap. 20, this sutra portion (in prose) has actually been incorporated into the Nijj. 40 342 foll. Each page has 17 lines of 58-68 aksh. each. 41 Nijj. 8, 315-9, 3. 42 Cf., however, the Avagyakaerutaskandha in Kielhorn's Report, 1881, p. 92, and the shadivasyakasutram in Buhler's paper in the Journal of the Vienna Acad. 1881, p. 574. 43 e. g. tatha che ho 'paddsikam g&thas@tram cha Niryuktikdrah: samudra (2, 18). * In other passages, however, he says that the verses even of the Nijj. are sutras! See p. 58, note 2.
Page #355
--------------------------------------------------------------------------
________________ NOVEMBER, 1892.) SACRED LITERATURE OF THE JAINS. 331 It is, furthermore, noteworthy that in the Nijjutti, too, Haribhadra distinguishes different constituent parts and different authors (see p. 53). He refers its verses at one time to the niryakti(kara), mulabhashyakara, 45 and at another to the samgrahanikara, or even sutraksit (!). He thus brings these verses into direct contrast with each other46 and subjects them to different treatment, by citing some, perbaps those of more recent date, in full, [55] either word for word or without commentary; while the remainder he cites as a rule merely by their pratikas and then explains, first by a gamanika, or aksharagam., i. e. a translation of each word, and finally by expository remarks called out by the nature of the subject.67 Haribhadra too appears to have found a special defect existing in his sutra text. Between chapters 8 and 9 of the Nijj. we ought to find the sutrasparsini nijjatti according to his statement; but : no 'chyate, yasmad asati sutre (!) kasya 'say iti. Haribhadra devotes a long discussion to sutras in general, which recurs Nijj. 10, 10, 11, (satra and niryukti), 12, 17, 13, Using due cantion in reference to an explanation of the matual relation which exists in our text between Sutta and Nijjutti, and in reference to the form of the text of the Avaeyakam which existed in the time of Haribhadra, I subjoin a review of the 20 ajjhayanas of the existing Nijj. The two MSS. which I possess (the second I call B) show many divergences from one another, some of which are explainable on the score of inexact computation of the verses. Other MSS. contain much greater variations. The passages cited in Jacobi, Kalpas. p. 100 (104) as 2, 97, and p. 101 as 2, 332, are e. g. here 3, 281 (291), 382 (342). Very great divergences come to light in the two MSS. in Peterson's [56] Detailed Report (1883), pp. 124 and 127. These MSS. are numbered Nos. 273 (= P) and 306 = r, with a break in the beginning; and chapters 1, 2 and 6 are lost). The text is composed exclusively in gathas. One of its special peculiarities is formed by the frequent daragahas, i. e. verses which state briefly the contents of what follows, principally by the enumeration of the catch-words or titles of paragraphs. Unfortunately the use or denotation of these verses is not regular; from which fact the benefit to be derived from this otherwise excellent method of division is materially reduced. The Nom. Sgl. Masc. 1. Decl. ends, with but very few exceptions, in 8. It must be prefaced that Haribhadra treats chap. 1-10 under ajjhayana 1, 11-12 under ajjh. 2 and 3 respectively, 13-18 under ajjh. 4, and the last two chapters under ajjh. 5 and 6 respectively. This is done, however, without specially marking off the conclusions of the chapters of the Nijj. Only the conclusions of the six ajjhayanas are distinguished from the others. 1. pedhis, pithika, 131 vv. (in P the thiravalt has nominally 125 and pedhiya 81 gao!) It begins with the same Theravali (50 vv.) that occurs in the beginning of the Nandi, and treats, from v. 51 on, of the different kinds of nana (cf. Nandi and Anuyogadv.). Haribhadra does not explain the Theravali at all and begins his commentary (fol. 3) at v. 51: Abhinibohiananam suaninam cheva hinanam cha taha manapajjavapanam kevalananam cha pamchamayam 11 51 || - e. g. 4, 3, iyara niryuktig&tha, et As tu mulabh Aahyakdragath&: bhimattbao (4, -6). 46 The atraktit appears here as later than the samgrahanikra, fol. 260 a : - tAn abhidhitaur kha sangrahanikarab: ambe (Niij. 16, 48) gAhA, mei (10) gatha ; idath gathAdvayan atrakrin-niryuktigkthAbhir dva praka Arthabhir vyAkhyayate (strakrita . . vyAkhyayate or strakrin niryuo .. vykkhyllti would bo better); dh&danti padhadam in full but without commentary. Here it is to be noticed that one of the MSS. of the Niij. in my possession omits these 15 verses from the text. Soo p. 59 in regard to the assumption that the Nijj. is the work of several authors. 47 An occasional reference to other methods of treating the subject is found, e. g. 2, 61, iti samis&rthab, Vy As Arthas tu vibeshavivaranAd avagarhtavyah. Or on 10, 19, iti g&th Akshararthah, bhAv Arthas tu bhabyagathAbhyo 'Taa yah, tas oh& 'mAh (in Prikrit, but not from the Niu.) 45 Chapter 8 forms an exception, though at the end at least it says: samfpta che 'yam upodghataniryuktir iti, but in such a way that it is not mentioned as the "eighth chapter"; nor is the statement made that it is concluded.
Page #356
--------------------------------------------------------------------------
________________ 332 THE INDIAN ANTIQUARY. [NOVEMBER, 1892. (57) 2. padhama varacharia, 173 (178 P, 179 B) vv., treats, from v. 69 on, of the circumstances of the lives, etc., of the 24 Jinas, especially of Usabha, the first of their number. In the introduction it is of extreme interest to notioe the statements of the author in reference to his own literary activity. It is as follows: titthayare bhagavamte | asattaraparakkame amianani | tinne sugaigaigae | siddhipahapaoske vande 11111 vaidami mahabhagathi mahimunim mahayasan Mahaviran amaranararkyamahiam titthayaram imassa titthassa il 211 ikkarasa vi ganahare I pavayae pavayanassa vamdami 1 savvam ganaharavamsam | vayagavamsam pavayanam cha || 3 11 te vamdiuna sirasa | atthapohuttassas tebim kahiassa spananassa bhagavao 1 niyyuttim50 kittaissami || 4 || Avassagassa dasaka- liassa taha attarajjha-m-ayara61 snagade niyyattimbuchchhami taha dasanam cha (1 5 11 kappass8 ya niyyattim | vavaharasse 'va paramanionassa | suriapannattie 1 bachchham isibhasianam" cha 11 6 11 desin niyyuttim buchchhami aham jinovaesena | Aharanaheukarana- 1 payanivaham inam samasenau. 11711 samaianiyyuttim buchchham uvaasiam gurujanenam ayariaparamparena agayan anupuvvie 11 8 11 niyyatta to .atthajam baddha tesa hoi niyyatti 1 taha vi ai chchbayei | vibhasium guttaparivati 11 9 11 There is no doubt that we have here the beginning of a work, [58] and that chapter 1 (which is itself called pithika, support, complement) did not yet precede these verses at the period of their origin,63 From vv, 5 and 8 we learn that the author does not intend to write an introduction merely for this second chapter, but that his work is designed for all the Avakyaka matter and especially the samaiam, The separate statements of his account show that he intended to carry his investigations into the first two angas too, the fifth upangam, three chhedas atras, two more mulasutras, 54 and, if Haribhadra's explanation of isibhasilli is correct, 65 to painna 7 fgg. If we compare these statements with those in the commentary of Rishimandalasutra in Jacobi, Kalpas, p. 12, in reference to the ten niryaktis composed by Bhadrababu, it is manifest that they are identical (instead of kalakasya in the passage in Jacobi we must read kalpakasya), and that Bhadrabahu must be regarded as the one who in our passage speaks in the first person, This conclusion, however, is not supported by the Theravali in chap. 1, which, as we have seen, p. 7, is much later than Bhadrababu. Nevertheless, we have just above formed the opinion that this contradiction is immaterial, since this pithika is to be regarded as not extant at the time of the composition of chap. 2. [59] The greater is, however, the contradiction which is disclosed by other parts of the text, notably the first verse of the Oghaniryukti cited as 6, s, and chapter 8, etc. The statements made there refer to a period much later than that of Bhadrabahu, the old bearer of this name, and who is assumed to be the last chauddasapuvvi (+ Vira 170). All these statements must either be regarded as alien to the original text, or the 41 arthaprithutvan. 4 str Arthayob parasparam niry janar niryuktib; - kim abeshaaya Srutajfsnaaya P no, kirin tarhip brutaviseshAnim dvakyakadtnam ity ata ev "ha: Krasso; -niryukti is perhaps an intentional variation of nirukti. a samudayababdanam avayave vyittidarsanda, yath& Bhimasena Sena iti, uttaradhya ity uttaradhyayanam amalyam. deverdraetavadinim. # They are placed thus in a palmleaf MS., No. 23, in Peterson's Det. Report (1883) (only 1, 61 Abhinibohis .., see p. 56, precedes) at the beginning of a text entitled "niryaktayah," which contains at least several, if not all, of the above 10 niry. dasaveAliam is undoubtedly referred to under dasak Alian. See the same denotation in v. 1 of the four githas added there at the close. For the abbreviation see note 8 on p. 57 in reference to uttarajha. * This is, however, extremely doubtful as regards the existing painnam called deverdrastama. See pp. 442, 869, 279, 280, 281, 402, 499, 481, 48.
Page #357
--------------------------------------------------------------------------
________________ NOVEMBER, 1892.) SACRED LITERATURE OF THE JAINS. 333 person in question may be one of the later bearers of the name of Bhadrabaha, to whom these ten Niryuktis might be referred. The further course of the account would then determine to what and to how late a period this Bhadr, belonged. All this is, however, on the supposition that we should have to assume that all the other chapters of the Nijjatti were the work of but one hand! In this connection the distinction is of significance which Haribhadra - see above pp. 54, 55 - draws in reference to the separate constituent parts of the Niji. The fourteenth chapter is expressly stated by him to have been composed by another author, viz. Jinabhadda. See my remarks on pp. 61, 62 in reference to the incorporation of the Ohanijjutti. The result is that chap. 14 and several other chapters (9, 11, 12, 20) exist in a detached form in the MSS., without any connection with av, nijj. At any rate the statements made in the text remain of extreme interest since they show the interconnection of the ten niryuktis mentioned in the text, and their relation to one author. A good part of these niry. appears to be still extant. [60] As regards the MS. of the niryaktayah, mentioned above p. 58., we must confess that Peterson's account does not make it clear in which of the above ten texts it is contained. On the acharaniryukti see p. 258, Peterson, Palm-leaf 62, Kielhorn's Report (1881) p. 10; on a suyagadanijj. see Pet. Palm-leaf, 59, a dasa vealianijj. ib. 167. We have also citations from the nijj. in ap. 5 and mulas. 1. What follows is very interesting : attham bhisai arahu i suttam gamthanti ganahara niuna sasanassa (nasa !)hi atthae tad suttam pavattai 11 13 11 BAmaia-m-diam suaninam java bimdusara8 tassa vi sard charana gar charanassa nivvanam 11 14 11 Here the contents of the doctrine is referred back to Arahan, but the composition of its textual form is ascribed to the ganaharas. See pp. 216, 345, above p. 35 and p. 80. The word samaiam, which we have found in v. 8 used as the title of the first avasyaka, is now used in its other signification, i.e. as the title of anga 1; for bimdusara is the title of the first purva book in the ditthivaa, anga 12. See above pp. 243, 244. 3. bia varacharia, 349 (algo P#, 359 B) vv., of like contents. It begins Viran Aritthanemim Pasam Mallim cha Vasupujjam cha de mattuna Jine avasesa asi rayano II ... Despite its seeming exactness, its statements give the impression of being apocryphal. Verses 287 (297) fg. treat of Siddhattha and Tisala, 67 the fourteen dreams of Tis., etc. [61] 4. uvasagg4, 69 (70 P.) vv., treats especially of Vira.s. The statements made here in chapter 4 take almost no notice at all of the facts in reference to the life of Vira that are found here and there in the angas; nor does the Kalpastram (see p. 474) devote a greater amount of attention to this subject. 5. samavasaranam, 69 (64 P) vv., as above. 6. ganaharavad, 88 (33 P, 90 B) vv. (is wanting in -); the history of the 11 pupils of Vira: Imdabhui 1, Aggibhoi 2, Vanbhui 3, Viatta 4, Suhamma 5, Mandia 6, Moriaputta 7, Akampia 8, Ayalabhaya 9, Meajja 10, Pabhasa 11 (see Hemach. vv..31, 32); tittham cha Suhammao, niravachcha ganahara sesa (v. 5). The contents is as above, and almost no reference is paid to the account in the angas. It concludes with the statement (above p. 48): sa mayari tiviha: ohe dasaha padavibhage 11 88 11; in B there follows, as if belonging to this chapter, as v. 89 the beginning verse of the Oghaniryukti, and thereupon the statement ittha 'mtare ohanijjutti bhaniyavva. In A v. 89 appears as v. 1 at the beginning of chap. 7 and then follows in partial Sanskrit: atthan 60 'ghaniryuktir vaktavya; after this verse 1 of chap. 7 according to the new computation. There is probably an interpolation here. Since chap. 7 treats # Jina 6 is called Palm Abha (v. 28), Jina 8 Sasippaha (v. 24), Jina 19 Malli appears as a maso. (Mallissa v. 30). 7 On DevAnanda see v. 279 (289), but Usabhadatta is not mentioned. We road SomilAbhidhino in the scholiast. # Gogla v. 15 fg. attha instead of atra.
Page #358
--------------------------------------------------------------------------
________________ 334 THE INDIAN ANTIQUARY. (NOVEMBER, 1892. 1 of the second of the three samacharis enumerated in 6, ss, and the first receives no mention, it was necessary to remedy this defect. The third samachariis, according to the statements of the scholiast here and elsewhere, pp. 357, 449, represented by the two chhedasutrag: kalpa and vyavahars. It is very probable that the interpolation is not merely one of secondary origin, but an interpolation inserted by the author himself. [62] If this is so, he deemed the ohanijjutti which he had before him (perhaps his own production) to be the best expression of the first form of the 3 sa macharis, and consequently, not taking the trouble to compose a new one, incorporatedo brevi manu this Ohanijj. (cf. above p. 59), or rather referred to it merely by the citation of its introductory verse. A complete incorporation brought with it no little difficulty, because of the extent of the text in question. The economy of the whole work would have lost considerably if the entire text had been inserted. The text which we pussess under this name and of which the first verse alone is cited here, consists of 1160 Prakrit gathas.2 I shall refer to it later on, and call attention for the present to what I have said on p. 3572 3: - that the first verse cited here from it, in that it mentions the dasapavvi, excludes any possibility of that Bhadrabahusvamin, whom tradition calls the author of the oghaniryukti, having been the first bearer of this name, who is stated to have been the last chauddasapuvvi. The same, of course, holds good a fortiori of the author of our text, in whicb this verse is quoted. 7. dass vihas&mAyam, 64 (P., 65 B) vv.; cf. attarajjh. 26; the enumeration here in chapter 7 is as follows (see above p. 48): ichchha, michchha, tahakkaro, avassia nisihia apuchchhana ya [63] padipuchchha chhamdana ya ninamtana ll ll uvasampaya ya kale samayari bhavo dassviha u besim tu payanan pattea pardvanam buchchhau 11 II 8. avagghayanijjutti, 211 (214 B, 216 P, 210 ) vv. In vv. 40-50 glorification of AjjaVayara (plur. maj.), "Vaira, Vajrasvamin, who extracted the agasagama vijja from the mahapainna (see p. 251) and made ample use of the latter. In his time there still existed (p. 247) apuhatta kalianunssa, aprithaktvam kalikanuyogasya, but after him (tena "rena, tata aratah, Haribh.), i. e. perhaps through him there came into existence puhattam kaliasua ditthivie 2,64 prithaktvam kalikasrute drishtivade cha (v. 40). Tumbavana, Ujjeni, Dasapura, Dayaran Kusumaname (Pataliputra) appear in regular order as exercising an important inflnence upon his life. In vv. 50-53 glorification of his successor Rakkhiajja (plur. maj.), Rakkhiakbamana, i. e. of Arya Rakshitasvamin, son of Somadeya and Raddasoma, (elder) brother of Phaggurak. khia and papil of Tosaliputta. These two names : Vajrasvamin and Aryarakshita (cf. Hemachandra's parisishtap. chaps. 12, 13), especially as they are regarded here as persons deserving of great honor, bring us to a period much later than the old Bhadrabahusvamin. According to the statements of the modern Theravali (see Klatt, I. c. pp. 246, 247, 252, his death is placed Vira 170, but that of Vajra, 400 years later, Vira 584.65 We will find below that [64] there is mentioned here another date later by several years. Hem. v. 34 too says that Vajra is the last "dasapurvin," one who still has knowledge of 10 of the 14 purvas, and in general that he is regarded as deserving great honour as regards the transmission of the sacred texts. See the account of Dharmaghosha on the Kupakshakausik., Kup. p. 21 (811). The two-fold division into kaliasua and ditthivaa (also in the Anayogadv. above, pp. 36, 40), dating back as far as Vajra according to v. 40, is in contrast to a no less peculiar division into four parts, referred back in v. 54 fg. to Arya Rakshita : kaliasuam cha. isibhariyaim taio a surapan 4In the Vidhiprapa (in v. 7 doe jogavih Apa) the Ohanijutti is said to be "Oinna," avatirna into the evanayam, 61 Haribh, says: Barnpratam Oghaniryuktir vlohy, sa cha prapazhohitatvat (perhaps on account of its fulness) na vivriyate; and likewise at the end : idanim padavibhAgasamacharyah prastavah, s cha kalpavyavahfrarapa bahuvistar svasthanad avasby; ity uktab samachary pakramakalab. 62 The oghaniryukti, which in P is actually incorporated with the text, has but 58 (or 79 ) verses. See below, p. 82. 68 But according to the Ganadharasardhasata, V. 29, it was taken from the sumah painnapuvylu! see p. 479. " In v. 36 there was mention of 700 (!) or 500 nayas, eehim (v. 37) ditthiva paravan suttaatthakabapa ya; each of the 7 etc. nayas - see p. 850 ff. and p. 89 - Batavidhah. See also Kupakshak. p. 21 (811).
Page #359
--------------------------------------------------------------------------
________________ NOVEMBER, 1892.) SACRED LITERATURE OF THE JAINS. 335 netti ( savvo a ditthivuo chautthao hoi anuogo || 54 || jsm cha mahakappasuam japi a sesini chheasuttani charanakarananuoga tti kaliatthe uvagayani ll 66 11 Here then the isibhasiyim (which Har. explains here by uttaradhyayanadini ! see above pp. 43, 58) and upanga 5 are enumerated as members holding equal rank66 with the kaliaguam, i.e. angas 1-11, and the ditthivaa, i.e. unga 12. Although the "mahakappasuan" and "the other chhedasutras" (kalpadini, scholiasts) are said to have been borrowed from anga 12, they are akin (or sishibbashita) to the kaliasua, i. e. angas 1 to 11. Such is apparently Haribh.'s conception of the passage.67 [65] In this text we notice that the different sections are frequently joined together without any break; and such is the case here. In vv.56 to 96 we find very detailed statements in reference to the seven ninhagas, nihnavas, schisms. After an enumeration (v. 56) of the names there follows a list of their founders, the place of their origin (v. 59), the date of their foundation (vv. 60, 61), and then a more exact list of all in regular order, though in a most brief and hence obscure fashion, the catch-words alone being cited. The kathanakas etc. adduced in the scholiast, help us but little to clear up this obscurity. The first two schisms occurred during the life of Vira, the first (vv. 62, 63), the Bahuraya, bahurata, under Jamali in Savatthi in the fourteenth year after he obtained knowledge (Sinina uppadiassa nanassa), - the second (vv. 64, 65), the Jivapaesiya, ander Tisagutta (chaudasapu vvi) in Usabhapura in the sixteenth year thereafter. The third schism (vv. 66, 67), the Avvattaga, avyaktaka, under Asadha in Saabia ('Svetavika), in the 214th year after the end of Vira's death (siddhim gayassa Virassa). They were" brought back to the right faith" (Jacobi, Kalpas. p. 9) by the Muria (Maurya) Balabhadda in Rayagiha. The fourth schism (vv. 68, 69), the Samuchchhea or ochchheia under A samitta (Asva) in Mihilapura (Mithild) is placed in the year 220 after Vira.60 The fifth (vv. 70, 71), [66] the Dokiriya, under Ganga in Ullamatira (? A, Ullaga B, Ulluga scholiast, Ulluka in Skr.) in the year 228. The sixth, the Terasis, trairasika, under Chhaluga in Amtaramjia, in the year 544, is treated of at greater length (vv. 72-87), though in a very obscure fashion. We have already seen (p. 351) that anga 12, according to the account of anga 4 and Nandi, devoted considerable attention to these schisms. Finally, the theravalf of the Kalpasutra ($ 6) contains several statements in reference to the Teresiya saha and its founder Chhalud Rdhagutte Kosiyagotte. The latter it calls the scholar of Mahagiri, who, as in the therivali of the Nandi, is called the ninth successor of Vira. But this is not in harmony with the abovementioned date (544 after Vira), since it is equivalent to an allotment of 60 years to each patriarchate. There is then here, as in the case of the name of the founder of the fourth schism see 351, 381 - & considerable discrepancy in the accounts. The seventh schism, the Abaddhis (vv. 88-91), under Gotthamahila in Dasapura is referred to the year 584 and brought into connection with Ayya Rakkhia, Pusamitta and with the ninth puvva (p. 356). The first of these statements harmonizes with the other information concerning Rakkhia which we possess. See p. 63, Klatt p. 247). The name Pasamitta is frequently met with. According to Merutanga's Vicharasreni (see Buhler, ante, 2, 562, and Jacobi, Kalpas. p. 7), there reigned a Pasamitta, successor of the Maurya (the Pashyamitra of the Mahabhashya, etc.!), in the years 323-353 after Vira. Neither can he be the one referred to here, nor the Posamitta who was 66 The terminology in the Nandi - 800 abovo p. 11 - is quite different. There the kaliath suaia, together with the ukkaliam, as a subdivision of the anangapavittha texte, is opposed to the duvalasamga ganip. ; the isibhasidim, together with the surap. are regarded as parts of the kaliyam. In reference to the use of the word in Anny. see above, p. 36 n 2. 67 apalakshanat kAlikabrutat charanakarananuyogah, rishibh Ashitani dharmakathanuyoga iti gamyate; sarvak cha drishtivadas chaturtho bhavaty anayogah, dravy Anuyoga iti; tatra richibhAshitani dharmakath&nuyoga ity uktari, tata cha mahbkalpabrutadini pishibh ehitat tvA (taty At P), drishtivadad uddhitya teshAuh pratip&ditatvat. dharmakathAnuyogavva (P tvach cha P) praaamga ity atas tadapohadyarachiktrabaya "ha: jan cha.. (v. 55). See p. 258. See above, pp. 275, 381 on nga 3 and upanga 1. Further information is found in the second chhedaetra (nee p. 468) and in the scholiast on uttarajjh. 8, 9. # Abhayadeva on up. 1 mentione Pashyamitra instead of Asamitta. See p. 381. Is this merely a Inpeus calami?
Page #360
--------------------------------------------------------------------------
________________ 336 THE INDIAN ANTIQUARY. (NOVEMBER, 1892. the founder of the Pusamittijjam kula of Charanagana in $7 of the therivali of the Kalpas., which emanated from Sirigutta, the pupil of the tenth [67] patriarch Suhatthi. The name Pusamitta occars here too in chap. 17 (16), 190 (see p. 74n), as that of a contemporary of king Mudimbaga and of Ayya Passabhdi. Abhayadeva on up. I mentions him as the founder of the fourth schism. See p. 654. In addition to these seven schisms there was an eighth(vv. 92-95), that of the Bodis, Pautika, according to Haribh., under Sivabhui in Rahavirapura (Rathao) in the year 609. According to the account in Dharmaghosha's scholiast on his Kupakshakaus., the Digambaras are referred to ; see Kup. p.6 (796) where I have attempted to sbew that the name Bodia has the same meaning (naked) as digambara. The animosity against the Botikas is as keen as can possibly he imagined. In the 22nd chapter of the Vicharamtitasamgraha, the remaining 7 nihnavas are said, according to Malayagiri's commentary on the Avasy., to be desavisam vading dravyalimgena 'bhedino, but the Botika : sarvavisamvadino dravyalimgato 'pi bhinnas. Similarly Haribh. on v. 92 (desavio and prabhatavio); see also Jacobi, Kalpas. p. 134. In the kalasattari, v. 40, they appear as khamana pasamdiya; also in Kup. 1, 37, 71, 2, 3; ibid. 1, B, or as khavanaya, 3. e. kshapanaka. See below, p. 75. In contradistinction to these heterodox opinions (michhaditthi) we have the praises of the samaiam sung in v. 102 fg. We find it called70 (v. 108) an "ajjhayanam" as opposed to the "remaining (five) ajjhayanas;" and the two verses closing with the refrain ii kevalibhasian [68] are cited in reference to it. These verses recur in the Anuyogadvarasatra (see above, pp. 37, 38) as I have shewn on Bhagav. 2, 186. After the conclusion of the upodghataniryukti we find in the scholiast (see above p. 55) the following statement: atra sutrasparsikaniryukty (see p. 38)-avasarah, sa cha prapta vasara 'pi no 'chyate, yasmad asati satre kasya 'sav iti; to which is joined an elaborate deduction in reference to sutta and niryukti. 9. namukkaranijjutti, 139 (P+, 144 B) vy. Towards the end we find the verse es6 pamchao (132), glorifying the pamchanamukkara, a verse we have already met with in upanga 4 ; see p. 393. In the last pada we have here the reading havai mamgalam; see Kap. p. 21 (811) fg, where this form of the verse is referred directly back to sr-Vajrasvamin. See p. 380.3 on v. 6. A detached copy is found in Peterson, Palm-leaf No. 776. 10. Amaianijjutti, 100 (, 111 P, 112 B) vv. Begins : nardi-anuogadaram vihivad uvagghaiam cha kaQnam | kauna pamchamangala-m arambho hoi suttassa | 1 | The knowledge of the namdi and of the anuogad.71 is here regarded as a preliminary condition for the understanding of the sutra. This citation is both per se of interest (see p. 3), and also because from it we can prove that the avasyaka texts quoted in these two works are to be distinguished from our av, nijj. -though this was tolerably self-evident after the remarks on p. 53 ff. The text continues : | Bhaya (!): kayapanchanamukkaro karei samaien ti Bo bhihio I so maia ngam eve y8 jan 80 gega ad buchchham [69] 11 2 Il stram (atra 'ttard satram vichyam B). On this Har. (see between 8 and 9): atra 'mtare sutrasparsaniryuktir uchyat8, svasthanatvad, Aha cha niryuktikarah : akkhaliya (v. 3) tti, gaha. We have here then & very incomplete quotation of the text, see above p. 55. - In vv. 30-38 there are special statements in reference to the 11 karanas, the fourth of which is here called thiviloyanam. See p. 414. In v. 40 we find a division of the suam into baddham and abaddham. The former is explained by duvalasamgam and called nisiham and anisihan (see pp. 452, 553); the nisiham is explained as pachhannam, and the following added in illustration : - nisihan nama jaha 'jjhayanam (v. 41). In verse 42 we To ajjhayanan pia tivihatia eutts atthe tad-abble chera sealsu vi ajjhayanesu (chaturviubatistavadishu) boi eneva nijjutti (uddelanirdesAdika niruktiparyavaana). T1 nandis cha anuyogadvirkni cha Haribh. 13 akkhaliasarhit vakkhanachrukk darisiammi suttapphAsianijjuttivittharattho imo hoi || schol. tatra 'akhalitapadochcharana sambita, athava parah samnikarshah sathita (s fine Brahminical reminiscence !) .. padath, sambita, padartha, padavigrahs, ch Alan A, pratyavasth Anath (H00 above p. 38) are here referred to.
Page #361
--------------------------------------------------------------------------
________________ NOVEMBER, 1892.] SACRED LITERATURE OF THE JAINS. 337 find a citation from purva 2 -see above p. 354-in immediate conjunction with the foregoing. 11. chauvisatthai, 62 (61 BP) vv., second ajjhayanam in Haribh. Stands alone in Peterson's Palm-leaf 77deg. 12. vamdananijjutti, 191 (189 B, 190 P) vv., equivalent to the third ajjh. of Har. Stands alone in Peterson's Palm-leaf No. 77a. From v. 36 on there is a dialogue between guru and cho, chodaka, see above p. 34. After v. 176 we read in the text: atra sutram, and Har. quotes a text which begins with the words ichhami khamasamane vamdium. 13. padikkamananijjutti, 54 (52 PB, 51 ) vv. Chap. 13-18, which correspond to the fourth ajjh. of Haribh., presuppose a [70] pratikramanasutrani73 given by him in full in sections. These chapters form a species of running commentary to each of the sections of the pratik. Chap. 14, 15 take up one section each, chap. 17 two, chap. 13, 16 contain the explanation of several sections. The sections explained in chap. 13 read: padikkamami egavihe asamjame. ., p. dohim bamdhanehim, p. tihim damdehim, p. chauhim jjhanehim. The entire following chapter is an explanation of the latter sentence. In a dhammajjhanam of 69 vv. precedes these sections commented upon in chapter 13. 14. jhanasayam, dhyanasatakam, 106 vv. The last verse (106) which is omitted by Haribhadra, mentions only 105 vv., and states that Jinabhadda is the author of this cento: pamchuttarena, gaha-saena jjhanasayagam samuddittham Jinabhaddakhamasamanebi kammasohikaram jaino 1 106 11. It had originally, as at present (see Peterson's Palm-leaf 77a 161b), a quite independent position and was later on inserted here. This is clear from the fact that the beginning contains a special salutation, which is usual only in the case of independent texts:Viram sukkajjhanag-gidaddhakammimdhanam panamiunam I joisaram sarannam, jhanajjhayanam pavakkhami 11 11 Haribh. cites this dhyanasatakam just as he usually cites his [71] kathanaka: ayam dhyanasamasarthab, vyasarthas tu dhyanasatakad avaseyah, tach che 'dam dhyanasatakam asya maharthatvad vastunal eistramtaratvat (! this is plain; we should have expected "tvach cha) prarambha eva vighnavinayakopasamtaye mamgalurtham ishtadevatanamaskaram aha: Viram The explanation concludes (omitting verse 100) with the words: samaptam dhyanasatakam, and the commentator proceeds with his explanation of the pratikramanasutram: padik. kamami pamchahim kiriyahim, again having recourse thereby to the paritthavaniyaniyyutti. p 15. paritthavania, 151 (152 P, 153 B) vv. Begins: paritthavaniavihim I buchhami dhiraparisapannattam jam nauna suvihia pavayanasaram uvalahamti 1 This chapter, too, gives me the impression of having originally enjoyed a separate existence. Nevertheless it is closely connected with chapter 18, since they both share this form of introduction. It is also noticeable that the same verse recars with tolerable similarity in 20, 9; from which we may conclude that chapters 16, 18, 20 were composed by one author. Haribh. in this chapter omits or leaves a large number of verses unexplained; and beginning with v. 79. His commentary is partially composed in Prakrit, probably taken from the old bhashya (see p. 52). After the conclusion: paristhapanika samapta, he proceeds to cite and explain the sutram: padikkamami chhahim jivanikaehim. In there is an additional chapter lesuo, with 13 vv., inserted between the conclusion and explanation. 16. padikkamanasamghayani, pratikramanasamgrahani, 133 (80 P B) vv. The verses, which are not found in [72] B,75 are cited in full by Haribh. as a part of his commentary.78. 75 It begins ichhami padikkamium..; it is in prose and different from the fraddha- or eravaka-pratikramanasutra, whose 50 gathas, divided into 5 adhikaras, were commented in Samvat 1496 (A. D. 1440) by Ratnasekhara from the Tapagachha (No, 52 in Klatt). In Peterson's Palm-leaf MSS. there are two other similar texts, a pratikramanasutram 866, 83c (where it is called aticharaprat") and a pratikramanam 154a (see p. 125b), which is different from the first. 74 He appears in Ratnasekhara as the author of a vieeshavasyaka. See preceding note. 16 Pr also presumably do not contain the verses: A 18-30, 32-43, 50-64, 68-80. 76 On one occasion he calls these verses (vv. 50-64) niryaktigathis of the sutrakrit (1), by which the satrakrit (!), is said to explain the two preceding verses (48, 49) of the samgrahanikara! Soo above p. 54n3.
Page #362
--------------------------------------------------------------------------
________________ 838 THE INDIAN ANTIQUARY. [NOVEMBER, 1892. The verses which A B have in common, are cited by him here, not as verses of the niryaktiksit, but as a part of the samgrahanikara. In these chapters we find explanations and enumerations of the contents of sections 6-31 of the pratikramanasutram. Each group of verses is explained under its proper section. Chapters 14 and 15, however, belong to but one section. The following is treated of: 6 jivanikaa, 7 bhayatthana (v. 14), 8 mayathana (v. 141), 9 bambhacheragutti (v. 15), the 10-fold samanadhamma (v 16), 11 uvasagapadima (v. 17), 12 bhikkhu. padima (v. 31), 13 kiriyatthana (v. 44), 14 bhuyagama (v. 45), 15 parama hammia (vv. 48, 49), 18 gihasolasa (vv. 65, 66), the 17-fold samjama (v. 67), the 18-fold abambha (v. 81), 19 nayajjhayana (vv. 82, 83), 20 asamahittana (vv. 84--86), 21 sabala (sabala v. 87).77 22 parisaha (v. 100), 23 suttagadajjhayana (v. 102), 24 deva (v. 103), 25 bhavana (v. 104), 26 dask-kappavavaharann uddesapakala (v. 109), the 27-fold anagaracharitta (v. 110), the 28-fold ayarapakappa (v. 112), 29 pavasutapssanga (v. 115), 30 mohaniyyathana (v. 117) and 31 sidd baiguna (v.132). We find herein enumerations of the 23 chapters of aiiga 2 (in two groups, one of 16, the other of 7; [73] see above p. 260), of the 19 chapters of the tirst part of anga 6, of the 26 chapters of the three chhedasatras 3-5, and of the 28 chapters of anga 1. 17. jogasamgaha-asayana, Akatana; 64 vv. ; in A counted continuously in conjunction with chapter 16, i.e. as vv. 134-197. In PFB, however, it is divided into two chapters : jogasamgaha of 60, and asiyana of 5 (4) vv. It contains the vouchers for and examples (udabaranagatha) of the 32 jogasamgahas (to v. 193) and 33 asayanas, 78 a'satanas (v. 194-197), which are mentioned in the last two sections of the pratikramanasutram. The pratikramanasangrahani (propi samapti) ended here according to Haribh. But with the words sampratam satrokta eva trayastrinsad vyakhyayate... Haribh. comes back to the explanation of v. 197. These verses contain principally matters of legendary and historical parport, and consist chiefly of proper names and of some catch-words. Haribhadra cites very detailed kathanakas on them composed in Prakrit, from which the meaning of the verses is to be extracted (svabuddhya 'vaseyah); but he does not enter apon the explanation of the text of each of the verses, or even of the kathanakas cited by him. It is very interesting that Thalabhadda is here brought into connection with the ninth, Haribh.) Nanda, and with Sagadala and Vararachi (v. 144, cf. the statements in Hemach.'s paribishtaparvan 8,fg.). The same may be said of the mention of Salava vahana in Paitthana (v. 164; Vikramaditya is, however, not noticed), and of the identification, in all essentials, of all these and similar [74] Dames7e with the names of king Dummuha of Panchala, of Nami of Videha, Naggai of Gamdhara (v. 172), and with the Pandavavamsa (v. 161)! As far as the legends admit of being comprehended (which is no easy matter, if we take into consideration the enigmatical character of the text and the corrupt condition of the MS. of the commentary), they are in only partial agreement with our information in respect to these persons obtained from Brahminical sources. The information they convey, is quite independent of any other source, and is probably the result of their arbitrary desire for change. It is of interest that the gatha (v. 188), cited pp. 158, 159, which is quite in keeping with the character of the verses of Hala, is here inserted in the legend of two prostitutes (Magahasundari and Magahasiri). 18. asajjhaiyanijjutti, asvadhyayika', 111 (PM, 110 B) vv. Beging80 : asajjbaianijjuttim buchchhami dhirapurisapannattam | jam nauna suvihia pavay anasaram uvalabhamti 11 11 888jjhaiam tu duviham ayasamuttham cha parasamuttham cha 1 jam tattha parasamuttham tam pam 11 On vv. 87-96 we read here : Ssari vyakhya .., ayam cha samAsArthah, vyAs&rchas tu dakikhyad gran. thatarad avasi ya evam (dva), asammoharthari dafinnsarena sabalasvardpam abhihitam, sangrahanikaras tu evam Aha: varisan (v. 97). The fourth chhedastram (or its second book, see p. 468) is meant by the dasAkhya grantha mentioned here. 78 Explained by fyah (.) samyagdarsanadyavAptilakshanas, tasya s&tanah khandana Asatanas . . ; if the word was ayasiyana (or ky do P). 19 As for example Vijas in Bhargachha v. 189, Mudirbaga, Ajja Pussabhai, Pasamitta in Sambavaddhapa v. 190. Verse 1 is omitted by Haribh.
Page #363
--------------------------------------------------------------------------
________________ NOVEMBER, 1892.) SACRED LITERATURE OF THE JAINS. 339 chaviham tu nayavvam 11 2 II Closes : asajjhaianijjatti kahia bhe dhirapurisapannatta samjamatavardhaganam niggamthanam maharisinam || 10 | This chapter, too, appears to have originally existed by itself (see above p. 71, on chapter 15). It refers to certain faults in the study and recitation of the srutam, which are enumerated at the conclusion of the 33 asayanas; but special reference is made to the cases in which akale kad sajjhko, etc. The pratikramanasutram consequently is joined on in Haribh. as follows: nama chauviske titthayaranam UsabhaiMahavirapayyavasaninam, .. inam eva niggamthan pavayanam savvam anattaram ity-adi, . . nea uam (naiyayikam) [75] ti samsuddham ti, sallakattanam ti, siddhimaggan muttimaggam nejjamaggam nevvanamaggam ti, ichhami padikkamium goyarachariyae ity-adi. 19. kaussagganijj., 172 vv., fifth ajjh. in Har. 20. pachchakkhananijjutti corresponds to the sixth ajjah. in Haribh., and consist of three parts : - 1. A metrical section in 22 (26 B) vv., with an enumeration of the 5 mulagunas, 91 2. A prose portion treating of the 12 vratas (5 anuvr., 3 gunavr., 4 sikshapadvr.). Haribhadra calls its sections satram; this is doubtless to be regarded as a bit of the satram, which is presupposed in the other chapters, but not directly admitted into the text of the Nijj. 3. A metrical conclusion of 74 (70 B) vv., which closes with the same two verses as chapter 10. There are 194 vv. verses in all given in P, but in only 90. It stands alone in Peterson's Palm-leaf 77 (without statement as to the number of verses) and 868 (94 vv.). - The prose part (nominative in & !) is directed with great vigour against the annautthiyas (anyatirthika) and against the parapasamdapasamsas, or the parapa sam dasamthavas. According to Haribhadra, the Brahminical sect582 Bhaubika and Votika (Digambara, see above p. 67) are treated of under annau. The 363 doctrinj attacked in anga 2 are referred to under para pasamda. See p. 259.83 According to H. thue 1 Lo mention here of the seven schisms. [76] He mentions also a legend (in Praktit) of Chs ikka and Chamdagutta in Padalipatta. Cf. Hemach. paris, chap. 8 and 9). Besides the Nijjatti I possess a fragment of a second metrical treatment of the avsyaka, which is, however, confined to vamdana and pachchakkana. The former is divided into two sections, chaityavandana and guru'. The text is only partially based upon the Nijjutti. There is an avachuri (churni) to it from the commentary of a Somasundara (from the Chandragachha). This avachuri can be traced back to a Jnanasagara. [77] XLV. The third mulasatram, dasaveAliasuakkhamdha, daba vaikalika, or merely : dasaglia,84 dasa kalika. It consists of ten ajjhayanas, which are composed in slokas, with the exception of a few prose sections. There are furthermore two chapters called chuli (and hence 61 panivaha mushve adatta mehuna pariggah cheva . || 8 | skvayadhammassa vihinn buchhchami dhirapu. risapannattar jam chariuna suvihi& ginind vi suhaith pavatti || 9 || On this verse see p. 71 on chap. 15. $9 anyatirthikaparigrihitani va chaityani arbatpratimalakshapani, yathi Bhautaparigrihit&ni Virabhadra-Maha kAlAdini, Votika-parigrihitani v. # Dr. Leumann called my attention to the fact that a letter of Schiefner to me dated Dec. 1857 - see Ind. Stud. 4, 335 contains the following statement extracted from the introduction of a Th Wassiljew : "there are 363 different schisms in the religion of India." Since I found nothing of the kind in the introduction of Taranatha, which was doubtless referred to here, I had recourso to Wassiljew himself. On the 8th of October 1883, I received from him the following kind reply: "I cannot inform you definitely in which of my works 363 Indian schools are mentioned, if at all; but it is certain that this number is frequently mentioned in Thibetan works. In Djandja Vatuktu's Siddhanta, which I have at present before me, I find the following: 'In the sutras are mentioned 96 darsana papantika[?], 14 dijakrita muluni[?], 62 injurious darsana, 28 which do not pormit salvation, and 20 which are ruinous." In Bhania's work Tarkadjvala all the darsanas are enumerated in 110 species, viz...' According to my hasty count there are more than 120 names, probably boontse the same school is mentioned twice, i.e. in Sanakrit and Thibetan. And at the end, after mention of all 110-120) species, wo read in all 863 darsanas. As regards the names of these daranns, it is too difficult for me to translate them into Russian and a fortiori into German, though, should you desire it, I will attempt it as best I may be able." I did not consider it necessary to have recourse again to Wassiljow's kindness, sinoe, for the purpose in view, his communication was amply sufficient. It is clear from the above, compared with p. 259, that it will be difficult to expect completo agreement in detail nevertheless the fact that the number of 363 darsanas is common to the Jains with the Thibetan Buddhists, is of great value. 84 Thus in Av, nijj. 2, 5, and in the Vidhiprapa.
Page #364
--------------------------------------------------------------------------
________________ 340 THE INDIAN ANTIQUARY. [NOVEMBER, 1892. secondary95) of similar contents. These are in gathas. After them follow four gathas, in which Sijjambhava, according to the old therivalt (Nandi, Kalpas.) the fourth patriarch after Mahavira, is stated to be the author ; 86 but his son Ajja-Manaya and his papil Jasabhadda87 are mentioned in connection with him. This is indeed a claim of great antiquity for the author! The contents refers to the vinaya, and is clothed in a very ancient dress. That this is the case is proved by the close of a chapter: ti bemi (also in the case of the two chulas !) and by the introduction : saam me kusam in the prose sections (with the exception of that in chela l.). The dasavealiam, (see p. 11) is mentioned in the Nandi as being in the forefront of the akkaliya group of the anangapavittha texts; its position here, however, almost at the end, does not agree with the prominent place ascribed to it by N. It appears elsewhere as the last or smallest of the agama (if I understand the words correctly; the preceding leaf is wanting in the Berlin MS. - see p. 214) in Hemach. [78] in the parisishtap. 9, 4, and in the commentary on Nemichandra's pravachanasira, v. 1415, where Dabprasa ha, the last of the 2004 suris which Nemich. accepts, is designated as dasavaikalikamdtrasutradhard 'pi chaturdasapurvadhara iva sakrapujyah. The author of the Avasy, nijj. asserts (2,) that he composed a nijjutti on it. A MS. of a nijjutti which recognizes the chaliya is found in Peterson's Palm-leaf 167. Is it the work referred to ? The word vealiam is said here to mean about the same as vaikalikam," belonging to the evening" (vikala 'parahne). 88 1. damapapphia, dramapushpika, 5 vs. Comparison of the dhamma with a flowering tree. Cf, anga 2, 2, 1. uttarajjh. chap. 10. 2. samannapavva, sramanyaparvika, 11 vv. Of firmness, dhsiti. 3. khuddiayara, kshallikachara, 15 vy.; sa dhritir achare vidhaya. 4. chajjivaniyajjh., shadjivanikhadhy., i. o. doubtless 'nikayajjh.; see above, pp. 71, 72, In two chapters, the first of which, in prose, begins saam me.. and treats of the 6 grades of the four elements (earth, water, light, air), plants (vanasai) and insects (tasa); and of the 5 mahavvayas to be obgerved in reference to them. To these five a sixth, the raibhdanau ver.imanam (command against eating at night), is added. Chapter 2, in 29 vv., treats of the six forms of activity (walking, standing, sitting, lying, eating, speaking) necessary for these 6 mabavy. 5. pin dasana, in 2 addesakas, with 100 and 50 vv., bhikshabodhih, of the collection of the necessities of life and of rules for eating ; see anga 1, , 1. To this is joined, [79] according to the Vidhiprapa, the pigdanijjatti (malas. 4); ittha piotti &yarai (dinna v. 7 of the jogavihina). 6. dharmarthakimajjhayanato), also mahacharakathakhyan; in 69 vv. - This trivarga (tivaggd also in the Abhidhanappadipika) whioh plays so important a role in epic literature (MBhar., Rimay. Manu) is not known to the Veda. Among the Jains and Buddhists, by whom dharma and artha are often brought into connection, though in quite a different signification (artha sense, explanation), the trivarga does not claim any place whatsoever. It is probable that we must connect it with the three ganas : sattva, rajas and tamas. But in that case artha would respond to rajas, kama to tamas, though kama suits rajas much better. Has the Platonio trinity Kaldr, beyov, 180, which is Cicero's honestum, utile, dulce, wandered to India ? 7. vakkasuddhi, vakyasuddhi, 57 vv. 8. ayara panihi, acharapranidhi, 64 vv. 55 This is evident from the title dasakaliar itself. At the time that the four gatha were added at the end, these two chalAs had not yet been affixed, since the text in v. 1 is called, as one might expect from its title, merely dasaihayanan. 86 According to v. 37 of the kalasattart it was composed in the year 98 Vira. 67 These three names recur in the same connection in the therav. of the Kalpas. Jasabhadda is also in the Nandi the fifth successor of Virs. # In auga 2 the word moans vaidarikam; in painna 5 the meaning is not clear. $ dhammapannatti va, in the Vidhiprapa.
Page #365
--------------------------------------------------------------------------
________________ NOVEMBER, 1892.) FOLKTALES OF HINDUSTAN. 341 9. vinayasamahi, osamadhi, in 4 uddesakas, of which the first three in metre, in 17, 23 and 15 vv., treat of the correct vinaya, especially in reference to the guru. The fourth is in prose with the introduction suam me.., and establishes foar fixed categories of the correct vinaya. 10. sa bhikkhu-ajjhayanam, in 21 vv. All the verses end, as in Uttarajih. chap. 15. with the refrain sa bhikkho, and consequently enumerate the requirements made of a correct bh., who desires to live in accordance with the regulations contained in the preceding 9 chapters. 11. raivakka chala padhami, rativakya, in two sections. The first in prose, without the introdaction suam (80) me.. , enumerates 18 thanas which the bhikkhu must take and fulfil in order gradually to acquire mukkha. The second, in 18 vv., partly with the refrain : sa pachchha paritappai, emphasizes especially the obstacles to this quest and serves siduteh sthirikaranaya. 12. chula 2 without any special title (also in the Vidhiprapa merely chaliya) in 16 vv., describes the correct course of action of the man of firmness. The conclusion is formed by the 4 gathas in reference to Sijjambhava, which have already been referred to. These gathas are probably of later date. The work is called in v. 1 dasakaliam (as in Av. nijj. 2, 5, and in the Vidhiprapa) and also dasajjhayanam; so that verse 1 at least dates from a period in which the two chalas had not been added (see p. 77m2). The text is frequently doubtfal in the two Berlin MSS. The commentary calls itself an avachuri of the vrihadvsitti of Haribhadrashri." Another avachuri, in bhasha, is the work of a Rajahansopadhyaya. A laghuvsitti too is ascribed to Haribhadra. See p. 458. FOLKTALES OF HINDUSTAN. BY WILLIAM CROOKE, C.8. No. 3.-How Eve rescued the Prince. There was once a king, who dearly loved his queen, and she too loved him exceedingly. One day the king went to hunt, and met in the jungle & most beautiful woman. He fell in love with her and brought her home; soon sbe got his heart in her power, and one day she said "I will live with you only on this condition, that you get rid of your first queen." The king was grieved, but he was in her power, and he searched for a cause to discard the queen ; but she was so good that he could find no fault in her. One evening be challenged her to play chess and said, "This shall be the stake. If before the game is finished & jackal howls, I will take my new queen and leave my kingdom: but if a donkey breys, then you must go away." This was agreed on; before the game was over the jackal howled. The king said, "Lady, you have won. To-morrow I will make over my kingdom to you and depart." At this her heart was nearly broken, and, not wishing to distress her husband, she replied: "No, king, it was a donkey that brayed. I will leave early to-morrow." The king said, "No, it was a jackal that howled." On this they began to argue, and the king said, "Let us ask the sentry whether it was a jackal or a donkey." So the queen went to the sentry and said: "Was it the cry of a jackal or a donkey you heard just now?" "Mistress," he replied, "it was the howl of & jackal." The queen replied : "The king and I have sworn an oath about this. If you say it was a jackal, the king must leave his kingdom. How can I defend it against our enemies? Then all you people will be killed and your children will die of hunger. You must say it was a donkey that brayed." The sentry agreed, and the queen came back to the king and said: "The sentry says it was a donkey * Ratnagelhars (on Pratikramanaetra) cites this vritti frequently : likewise the Vich ArAmritasamgraha quotes e. g. the following verse from it (or from the nijj.P): titthaysratthepam khalu attho, suttar tu ganaharatthknarh (800 p. 60) atthena ya vatnjijjai suttah tamba ya so balavah 1 A folktale recorded by E. David, Native Christian of Mirzapur, from the lips of Mahtabo, s cook-woman, and literally translated.
Page #366
--------------------------------------------------------------------------
________________ 312 THE INDIAN ANTIQUARY. [NOVEMBER, 1892 that brayed." "You lie," said the king, "I will go and ask him myself." When the king asked the sentry he made the same answer. So the king came back and said to the queen :"You must leave this to-morrow morning." Next morning the queen went off in her litter and at last reached a jungle. Through excess of grief she had not slept a wink the whole night, and was so tired that she fell asleep in the litter. Then the bearers, seeing night coming and in dread of the wild animals, quietly put the litter on the ground and ran away. When the queen awoke, finding herself alone and hearing the roaring of the wild beasts, she trembled and closed the doors of the litter. As night advanced tigers, bears and wolves roared all round her, and she lay inside trembling with fear. When morning broke all the beasts of the forest went back to their dens, and she got up and prayed to God to appoint her some place where she could live in quiet, and get bread and water for her support. The Lord heard her prayers, and when she got out of the litter she saw a house inside a dense thicket. Going there she found that it had only a single door, which was locked. Looking about she saw the key hanging on a peg. When she opened the door, she went in and found a lot of property lying scattered about. So she locked the door thinking ** the house may belong to some demon (deo), and if he sees me he will kill me." When evening came a faqir, to whom the house belonged, arrived and found the door locked. He knocked and said: "Open the door. Who has dared to shut up my house?" The queen made no answer, and did not open the door. When he got tired of knocking, the faqir said: "Whether you are a jinn, or a pari, or a deo, or a haman being, open the door, and I won't hurt you." Then the queen told him the whole story and said: "Promise that we shall live as father and daughter; then I will open the door." So the faqir made the promise and said : "I will give you half of all I get by begging." The queep then opened the door, the faqir went in, and they lived there for some time happily. Now when the queen left home she was with child, and after some time gave birth to a son, who was very beautiful. When the boy was three or four years old, one day the queen took him to bathe on the sea shore. As she was bathing him a merchant's ship appeared, and when the merchant saw the queen, he desired to take her with him. But she refused. Then the merchant secretly showed the boy some sweetmeats and the boy ran up to him. The merchant seized him and put him into the ship, and loosed it from the shore. Seeing this the queen wept violently and implored him to give back her son. The merchant said: "I will restore him only on condition that you come with me." When the queen saw that he wonld not restore the child and was taking him off, through affection for the boy she agreed to go: but when the merchant desired to take her to wife she refused. The merchant thought that if he killed the child she would marry him, so after going some distance be stopped the ship, and with a pretence of great affection took the boy with him and pitched him into & well. When he returned to the ship the queen asked where her child was; he said: "I don't know. I took him a short way with me, but he turned back to yon, and now I can wait here no longer." The queen was sure he had killed her son, and began to weep and be wail. Now the fairies lived in the well into which the little prince had been thrown. They took him up in their arms and carried him quietly to their house. For two or three days the boy was quite happy, but then he began to cry and wanted to go back to his mother. But the fairies warned him, -"Don't go there, for the merchant will kill you." But he would not mind them. Then the fairies gave him two sticks, one white and the other black, and said: "When you smell the black stick you will become white as a leper, and when again you smell the white one you will get all right. So when you see your mother's ship, smell the black stick. If you don't, the merchant will take your life." The moment the young prince got out of the well he ran in the direction where the ship had gone. The merchant from a distance saw him through his telescope (!) and recognised him. Then he got off the ship, took a sword and cut off his head, and then went on board again.
Page #367
--------------------------------------------------------------------------
________________ NOVEMBER, 1892.] MISCELLANEA. 343 When night fell the prince was so lovely that light streamed from his face. By chance that night Father Adam and Eve (Baba Adam, Hawwa) were flying towards that jungle. Eve looked down, and when she saw the light that came from his face, she said to Adam: "What light is this ? Let us go and see." Adam replied: "This is the world, and it is sometimes light and sometimes dark; come along." Eve said: "No! I must see this light." So they both flew down, and when she saw the boy, Eve took great pity on him, and cutting her finger let & couple of drop of blood fall on his head and trunk; then the boy came to life again. Then Eve said to him: "Smell the black stick; if you don't perhaps the merchant will see you again and kill you." So the boy smelled the stick and became white as a leper and went off in search of his mother. So at last he reached the land where his mother was, and the king of that land had a great love of hearing stories. Begging his way along the boy reached the king's palace, and the people said to him : "Lad, do you know any tales? If you can tell him a story the king will be much pleased and give you a reward." The boy said, "Yes! I do know a story; if the king hears it he will be delighted." The people gave him something to eat and entertained him kindly till the evening; and when it was night the king sat in his place and beside him sat the merchant; the king's wife, and the merchant's wife, and the boy's mother and several wives of the lords sat behind seven screens, and the boy was brought forward. So he began to tell his mother's story and his own - how his mother was married, and how his father had turned her away, and how his mother bore sorrow in the jungle and how she came to the faqir, and how he was born, and how the merchant deceived his mother and threw him into the well, and how he got out of it, and how the merchant had killed him, and how he came to life, and how he changed his form by smelling the stick. And as he went on telling the story his mother's heart became the more affected, and at last she said: "Bravo! boy! you bave well said ! Raise one of the screens." And by the time the boy had finished the tale all the seven screens had been raised. At last the prince said :"I am the boy," and his mother said: "Smell the other stick." He did so and came to his own shape, and his mother fell on his neck and wept, and said: "I never hoped to see you again." Then the king rose from his place and embraced them both; for, of course, he was the prince's father; and he turned out his wicked queen, and had the merchant executed, and he and his queen and the prince lived happily ever after. MISCELLANEA. TWO FURTHER PANDYA DATES. Rama Cholakula-baila-kulisa Karnnaparija-vidra vana Kathaka(ka)-kari-katapaka[la] vividha-ripu. No. 1. durgga-marddana Vira-Kanta-Kopala-vipina-daIn continuation of a note which appeared in 2 vadahana Kachf-puravar-Adhisvara-Ganathe April part of this Journal (ante, p. 121 f.) pati-harina-karddala Nelldrapura-(vi)virachitaI subjoin another date which deserves to be vir[A]bhishka pra[na]ta-raja-pratisht&paka' calculated by an expert. For an impression of maharajadhi(ra)rija-paramesvara Tribhuvanathe record which contains the date, I am indebted chakrava[r]ttiga[l] erf-Sundara-Pandiyato the kindness of Mr. R. Sewell, I. C. S. The devarkku ya[n]du 9Avadu Ishava-nA[ya]rru original is stated to be inscribed on the second parvva-pakshattu panchamiy[u]m Se[v]vky. gopura of the Saiva temple at Tirukkalukkun kkilaram, "the sacred hill of the kites," or Pakshi 1 3 maiyum perra Panarpusattu na!. tirtha,' in the Chingleput district. "In the 9th year of the reign) of the emperor 1 Svasti Samasta-jagad-adhara Somakula of the three worlds, the glorious SundaratilkeMadhurspurt. Madhava Kerala-varba- Pandyadova, etc.,' on the day of the nak. nifrmma Jinna Lamkadvipa-luntana-dvitfya- shatra) Punarvasu, which corresponded to Tues1 On the legends connected with this village seo ante, * Read pratishthapaka. Vol. X. p. 198 f. Mr. Vonkayya hus published three in- The translation of the Sanskrit birudae is omitted, aerintions from Tirukkalukkuram in the Madras Christian they are the same as ante. p. 121. College Magazine for October 1890 and April 1892.
Page #368
--------------------------------------------------------------------------
________________ 344 THE INDIAN ANTIQUARY. [NOVEMBER, 1892. day, the fifth tithi of the first fortnight of the "In the ninth year of the reign) of the glori. month of Rishabha." ous king Maravarman, alias the emperor of the The above inscription must belong to the same three worlds, the glorious Sundara-Pandya. reign as the Jambukesvara inscription of deva, who was pleased to distribute the Chola Jatavarman, alias Sundara-Pandyadeva, be country (among Brahmanas), - on the day of cause the same birudas are applied to the king in (the nakshatra) Visakha, which corresponded to both. A third date of a king Sundara-Pandyadeva Friday, the third tithi of the second fortnight of who bore the surname Jatavarman, appears to be the month of Mesha." contained in an inscription at Vikkiramangalam The Sundara-Pandya of this inscription calls in the Madura district. But I am unable to himself Maravarman, while that of the Jambu. vouch for the correctness of the published trans- keavara inscription bore the surname Jatvarman. cript, as I have no impressions at hand. Accordingly, the two kings must be considered No. 2. as distinct from each other. To the reign of The following date occurs at the beginning of MAravarman belongs the Tirupparankunram cave-inscription, which is dated on the threean inscription on the East wall of the second prikdra of the Ranganatha temple at Srirangam hundred-and-twenty-fifth day of the seventh year (of the reign) of the glorious king Maravarman, near Trichinopoly. alias the emperor of the three worlds, the glorious 1........... Srt-ko-Marapanmar=&pa Bundara-Pandyadeva, who was pleased to disTiribuvangachchakkaravatt[i]ga! Bonadu tribute the Chola country;"e and the smaller valangi aruliya sri-Sundara-Pandiyadh Tiruppuvanam grant, which is dated in the var[k*]ku yandu opbadavadu eleventh year, and refers to the tenth year, of 2 Mesha-nayarcu apara-pakshattu tritiyai. " Sundara-Pandyadeva, who distributed the yum Velli-kkilamaiyum perra Visagattu nal.' Chola country." E. HULTZSCH. NOTES AND QUERIES. *NO' AS A WORD OF ILL-OMEN IN BENGAL. | run short is intimated by saying with signifi Mr. K. Srikantaliyar, ante, p. 93, mentions that cance 'the rice has increased' (badonta). Anna'No' is a word of 111-omen among the Komatis parna is represented by the rice in the house, and in Southern India. In certain circumstances in her hands the rice ladle should never fail it is equally go in Bengal. No one will admit to supply all guests, however numerous. In this that there is no rice in the house, for fear of way she is peculiarly the symbol of Hindu offending Annapurna, the goddess of the Corn and hospitality also of the Kitchen. The fact of the rice having Calcutta. GAURDAS BYBACK. BOOK NOTICE. COINS OF ANCIENT INDIA from the Earliest Times down, The preface and the first for The preface and the first forty-one pages of to the Seventh Century A. D., by MAJOR-GENERAL the treatise deal with metrology, the origin of SIR A. CUNNINGHAM, K.C.I.E., C.S.I., R:E., London, coinage, and the Indian alphabets. In this B. Quaritch, 15, Piccadilly. 1891. Octavo, pp. ix. part of his book the author reiterates many of the and 118, with 13 autotype plates, and a Map. opinions on matters in dispute which he has This work of Sir A. Cunningham is the first frequently expressed in his other publications. book which deals systematically with the Some of the positions maintained by him are coins of Ancient Northern India as & whole, and is thus assured of a warm welcome from all open to attack, but for the present I pass these Indian coin collectors and numismatiste. The by, and proceed to consider the seventy-seven richness of the author's cabinet and his unrivalled pages which describe the coins of ancient India. experience necessarily bestow on the book a dig. The well-known coins of the Satrape of tinctive value which could not be given to a work Surfshtra and of the Gupta dynasty are not dison the same subject by any other writer. cussed by the author, as they have recently been 4 ante, p. 121. hrs Srf-k6-Marapapmar-aga Tribhwarachchakravatti. Dr. Bargeaa' Archaeological Survey of Southern India, gal Sonidu valangiy-aruliya Srf-Sundara- PandideVol. IV. pp. 18-20. varku yandu ejdvadu 41 munader-irubatt-atljini. Mr. Natea B&strt (ibid. p. 45, text lines 48 ff.) reads : 7 Instead of berapa alankanar SundarapandiyaSri Komaraparmaran Tribhuvanachakravattiga Stra- divarku yandu 11vadu (ibid. p. 37, reverse of the Plate, 1. padu-valangi-yaruhiya Sri Sundaravarumadevarku yandu 1), the facsimile (ante, Vol. VI. p. 143) reads Sinddu valan 6fdvadu i mupporr-vrupatt-andipal, while the original' [na Sundara-Pandiyaddvarku yandu (pa]tt dva]du.
Page #369
--------------------------------------------------------------------------
________________ NOVEMBER. 1892.] fully described in the Journal of the Royal Asiatic Society by the late Pandit Bhagwanlal, Mr. E. J. Rapson, and the writer of this notice. In a second volume Sir A. Cunningham hopes to deal with the coins of Medieval India from A. D. 600 down to the Muhammadan conquest, including the coinages of (1) the Rajus of Kasmir, (2) the Shahis of Gandhara, (3) the Kalachuris of Chedi, (4) the Chandellas of Mahoba, (5) the Tomaras of Delhi, (6) the Chauhans of Ajmir, (7) the later coins of the Sisodiyas of Mewar, and (8) those of the Pundirs of Kangra. BOOK-NOTICE. This is an extensive programme, and all numismatists will anxiously expect the promised volume. The early punch-marked and cast coins. form the first group described in the volume under review, but the section expressly dealing with them is not exhaustive, many punch-marked and cast coins being dealt with in other parts of the book. It is a great pity that Sir A. Cunningham did not prepare an index; for, small though his treatise is, it is full of matter, and an attentive reader finds it very troublesome to be compelled to note for himself all the cross references which require to be made. Notes of time, marking more or less closely the date of punch-marked coins, are rare. The author records two of interest. On the authority of the late Sir E. C. Bayley he observes that a few much worn specimens of the punch-marked class were found in company with hemidrachms of Antimachus II., Philoxenus, Lysias, Antialkidas, and Menander. The second note of time is afforded by the fact that three worn silver punch-marked coins, weighing respectively 34, 35, and 42 grains were found "in the deposit at the foot of the Vajrasan, or throne of Buddha, in the temple of Mahabodhi at Buddha Gaya. As this deposit was made about A. D. 150, during the reign of the IndoScythian king Huvishka, we learn that punchmarked coins were still in circulation at that time." This inference nobody will dispute, and coins of the kind may have continued to circulate much later in some parts of the country. The issues of Gupta silver coins did not begin before A. D. 400, and it is probable that the silver punch-marked coins remained in circulation up to that date in Northern India, and possibly even later. But I cannot accept the argument by which Sir A. Cunningham tries to fix the Buddha Gaya coins to a date of about B.C. 450. His words are:-"The three coins weigh 111 grains, giving an average of only 37 grains. But, as the general average of upwards of 800 of these coins from all parts of India is upwards of 47 grains, I 345 am willing to accept a loss of 19 grains [scilicet, from 56, the assumed normal full weight] in about 600 years circulation, or, roughly, from B. C. 450 to A. D. 150, as very exceptional. These three coins show a loss of upwards of 3 grains per century, while the average loss of these punch-marked coins was not more than one grain and a half in a century. It must be remembered that they were all hardened with copper alloy." The assumption that the normal wear and tear of such pieces was a grain and a half in a century, seems to me rather arbitrary. It would be difficult to quote an example of any class of coins remaining in circulation for 600 years; and small silver coins would be completely worn away long before the expiration of six cen. turies. British rupees forty or fifty years old are often withdrawn because they have lost more than two per cent in half a century, or, say, from five to six per cent of weight in a century, and I can see no reason why the rate of loss in the case of punch-marked coins should be assumed to be less. Three grains out of fifty-six is approximately six per cent, and that might be taken as the minimum possible rate of loss for the small thin punch-marked coins, which would wear much quicker than English made rupees. Every one knows that four-anna pieces wear out very quickly, and could not be kept in circulation for a single century. It seems to me that B. C. 200 is a much more likely date than B. C. 450 for the early. I can find no reason for the belief of Sir Buddha Gaya coins, and even that may be too A. Cunningham (page 43) that some of the punchmarked coins may be as old as B. C. 1000. I agree, however, with him that there is nothing to indicate foreign influence on coins of this class, and that the evidence clearly points to their being an Indian invention. The conjecture that some of the punched symbols may have been private marks of ancient money changers, is plausible. The punch-marked copper coins (page 59), are much rarer than the silver ones, and at least one-half of those that Sir A. Cunningham has Been, are simple forgeries of the silver coins, which betray themselves by their weight (that of the fifty grain [sic] karsha), and sometimes by the silver still adhering to them." Similar forgeries or imitations exist in the Gupta series, and in many other ancient coinages. On page 60, in the account of the cast coins, two slips of the pen have escaped correction.
Page #370
--------------------------------------------------------------------------
________________ TE: IN AN ANTIQLARY. NOVEMBER, 1848. Ihr worst "Lulls" should be "balls," and the statent that "No. 28 . . . . is of six different sizes, weighing respectively 107, 76, 26, and 11 rains," requires amendment. The account of the coins of Taxila, illustrated by two entire plates, is valuable. A series of rare inscribed coins found only at that place (now Shih ki dheri in the Rawalpindi District) bears the legend negama (or, in one instance, nigama) in Indian characters of the Asoka period. On some coins the word is written nekama in Gandbarian (i.e. Arian, or Khardshtri) letters. Sir A. Cunningham wishes to interpret this word as the name of a coin, comparing it with the Greek vocopa, but this suggestion does not seein to be correct The word negama (i.e. naigamdh), occurs in the Bhattiprolu Stupa inscription lately discovered by Mr. Rea in the Kistna (Krishna) District, Madras, and is interpreted by Dr. Buhler (Academy for 28th May 1892, page 522) to mean " members of a guild." That inscription appears to belong to the age of Asoka, or a time very little later, and the word negama, (nigama, or nekama) on the coins, which seem to date from the same period, should, in the absence of good reason to the contrary, be interpreted in the same way. The word negama (including the variant spellings) on the coins is associated with an unmistakable figure of a steelyard balance, and also with the words dojaka, ralimata, and antarotaka, of which the meaning seems to be at present unknown. Sir A. Cunningham's etymological speculations concerning these legends do not command assent. The very rare coins bearing the legend Odumbara or Odumbarisa, which have been found only in the Kangra District, have already been noticed in the Archaeological Reports (Vol. V. p. 154, and XIV. p. 116.). Only two silver pieces are known, and the number of copper specimens is variously stated by the author in the same paragraph as five and seven. The silver pieces give the name of Raj& Dhara Ghosha in Pali and Khardshtri characters. One of these coins is in the Lahore Museum, and was found in company with Kuninda coins and hemidrachms of Apollodotus, who reigned about B. C. 100. The coins of Amoghabhati, king of Kuninda, have been frequently published, but only five specimens of the Siva type are known. The name Kuninda was first correctly read by Sir A. Cunningham many years ago. The late Mr. Thomas committed himself at one time to very rash speculations about the interpretation of the legend of these coins. The local coins of the ancient city Kosambi, near Allahabad, appear to comprise the issues of at least four princes, namely, Bahaaata Mitra, Asva Ghosha, Jotha Mitra, and Dhana Dera. The connection of the first named ruler with Kosambi is proved by the occurrence of an inscription of his in the neighbourhood. The coin legends do not include the name of the town, and I presume that the proof of the connection between Kosa mbi and the other three rulers named rests chiefly on unpublished evidence as to the find spots of their coins. Coins of Dhana Deva are recorded to have been found at Ayodhya (Arch. Reports, Vol. I. p. 319). His coins are stated to be very numerous. Plate vi. is devoted to the illustration of coins ascribed to the Yaudheya tribe, now represented by the Johiyas along the Satlaj River and in the Salt Range. The coins numbered 2, 3, 4, 6, 7, 8, 9, 10, and 13, of the Plate include the name Yaudhoya in their legends. I cannot perceive any reason for ascribing the single-die coin No. 1 with common Buddhist symbols to the Yaudheyas, and the same remark applies to the broken coin No. 5, but the ascription of the remaining pieces (with the doubtful exception of No. 14), is satisfactorily established. The small copper coins, in two sizes, Nos. 2, 3 and 4, have on the obverse a humped bull to right, approaching a Bodhi tree with railing, with the legend Yaudheyand (or-ni), and on the reverse an elephant walking to right, with Buddhist symbols. This class of small copper coins is believed to date from about the first century B. O. I would name it the Bull and Elephant Type. Figures 6, 7, and 8 represent large copper coins, with a mean weight of 172 grains, which form a totally distinct class, copied from the Indo-Scythian money, and apparently later in date than A. D. 300. The obverse shows an armed figure standing to front, with spear in right hand, and left hand on hip, cock in field to right. Tegend in old Nagarf characters : Yaudheya ganasya jaya. In one instance the word dvi, and, in another, the word tri follows jaya. The reverse is occupied by a standing male figure and sundry symbols. This type may be called the Javelin Type, which name has been generally accepted for the corresponding class of Gupta coins. The legend shows that these coins are those of the Yaudheya tribe or clan. Figure 9 represents a silver coin, apparently the only one known in that metal, which belonge to a third completely distinct type. The author remarks that this piece and certain related copper coins (Nos. 10, 11, 12, 13) " are, perhaps, of a
Page #371
--------------------------------------------------------------------------
________________ NOVEMBER, 1892.] BOOK-NOTICE. 847 slightly later date." They seem to me to be con- would, I think, repay detailed study and investi. siderably later in date, and not earlier than A. D. gation. 500. The Mathura coins of the Satraps HagaThey are characterized by the rude six-headed masha and Hagana (page 87) are now, I believe, male figure on the obverse, which is probably published for the first time. intended for Karttikeya, son of Siva, and god of war, and may be conveniently named the The chapters dealing with the coins of Ujain Karttikoya Type. The legend on the silver and Eran are very interesting, but the greater piece is Bhagavato Sudmina Brahmana Yaudheya, part of their contents has already been published and that on some of the copper coins is Bhd. in the Archaeological Survey Reports, and I must gavata Sumina Brahmana Devasya. refrain from discussing them. The coin from Eran figured as No. 18 in Plate ri. is, however, The obverse device of Figare 14 is simply a "pay too remarkable to be passed over. It "is a thick anake, with the legend Bhanu Varma, and the rude piece of copper, weighing 171 grains. It ascription of this piece to the Yaudheyas does bears the name of Dhama Palasini, written renot appear to be certain. versodly (scilicet, from right to left) in large The Yaudhoya coins deserve further investiga- Asoka characters of early date." This legend tion and illustration. may be older than the inscriptions of Asoka. If space permitted, Sir A. Cunningham's Sir A. Cunningham includes in his work a brief description of the Coins of Panchala (Northern account of the Andhra coins on the ground that Rohilkhand), Mathura, and Ayodhya should the Andhra kings claim in their inscriptions to have extended their sway far to the north of the receive a long discussion; but it is impossible to treat the subject adequately in a review. The Narbada River, and may thus be reckonod among coins of the Mitra dynasty, characterized by the dynasties of Northern India, with which the the incuse square obverse, generally ascribed book is concerned. Sir A. Cunningham adopts to the Sunga kings, are regarded by the author Dr. Buhler's results (ante, Vol. XIl. p. 272), as the issues of a local dynasty, inasmush "as as regards the succession and chronology of the they are very rarely found beyond the limits Andhra monarchs. of the North Panchala, which would not be the The coins, which are generally made of load, case, did they belong to the paramount dynasty of fall into two main classes, the Western, from Sungas." The princes with the cognomen of Mitra the neighbourhood of Kolhapur, and the South who issued these coins, are Dhruva Mitra, Sarya ern, from the neighbourhood of Amaravati on the Mitra, Phalguni Mitra, Bhanu Mitra, Bhumi Krishna (Kistna) River. The Western coins are Mitra, Agni Mitra, Jaya Mitra, Indra Mitra, and mostly characterized by the obverse device of Vishnu Mitra: - a very remarkable series of a bow, with arrow fixed. The Southern coins names. The names of Bhadra Ghosha and Visva have for leading obverse device a horse, elephant, PAla also occur. stapa (chaitya), lion, or two-masted ship; and The well-known Horse and Bull coins of for reverse device the cross and balls, characSatya Mitra, Surya Mitra, and Vijaya Mitra, teristic of the coinage of Ujain. Sir A. Cun. as well as the closely related coins of Sangha ningham observes that "one specimen bas an (Mitra) are classed by Sir A. Cunningham as elephant;" but I possess nine small leaden coins Ayodhyd issues. But I am by no means certain from the Krishna District, given me by Dr. that the same Sorya Mitra did not issue both the Fultzach, all of which seem to bear the elephant Incuse Square and the Horse and Bull coins. It obverse device. They are very rude coins. is certainly a mistake to say that the Incuse Three of the kings also coined in copper, using Square coins are "very rarely found beyond the limits of the North Panchala." I have myself the Bow and Arrow device, and one silver coin three coins of Indra Mitra found in Oudh, and struck by Yajna Satakarni, resembling the Satrap Mr. J. Hooper, B.O.S., has many other coins of the coinage of Surashtra, was found in the stupa of same class, obtained chiefly in the neighbourhood Sopara. of Ayodhya. Coins of this class are also found in The concluding section of the book is devoted Basti and the other districts adjoining Oudh, to a brief discussion of the coinage of Nepal where the Horse and Bull coins likewise occur. Sir A. Cunningham accepts "with perfect confi. Certain princes, with the cognomen Mitra, namelydence" the determination of the chronology by Go Mitra and Brahma Mitra issued coins which Dr. Buhler, whose results are very different from are classed by Sir A. Cunningham as Mathurs those at which Dr. Fleet arrived. Dr. Fleet issues. These various Mitra coins require, and thought that the Saryavamsi Lichchhavi dynasty
Page #372
--------------------------------------------------------------------------
________________ 348 THE INDIAN ANTIQUARY. NOVEMBER, 1892. ruled simultaneously with the Thakuri dynasty, of Buddha (page 3). On page 20 the statement whereas Dr. Buhler, interpreting differently the is repeated in the form that "Buddha's death is dates of certain inscriptions, holds that the placed in the middle of the sixth century B. C." Lichchhavi dynasty ended after A. D. 634, and The observations on the derivation of the term was succeeded about A. D. 640 by the Thakuri tanka in pages 24-26 will hardly command general dynasty, founded by Thakur Ameuvarman. acceptance. The date 84 (page 37) for the HashtThe coins, which are all copper, ranging in nagar inscription appears to be incorrect. I think weight from 95 to 250 grains, bear the names of it may safely be asserted that the date is vither Mananka, Gununka, Vaisravana, Ambuvarman, 274 or 284, as read by Dr. Buhler, and originally Jishnuyupta, and Pasupati. Three of these by Sir A. Canningham. coins had long ago been published by Prinsep On page 49 the small gold coins of Southern and Sir A. Cunningham, and several of the types India, known by the name of hun, are said to were published by Dr. Hoernle and myself for the average 52 grains, the weight being adjusted to first time in 1887 (Proc. A. S. Bengal), amended that of the kalanju seed, which is "over 50 readings being given in the saine.periodical for grains." On page 51 the huns are said to have the following year. The coins then described were been "intended for half dinars of the Roman from a find presented to me by Dr. Gimlette, and standard"; and, on the same page, the hain is are now divided between the Asiatic Society of declared to be "the original gold karsha of 57.6 Bengal, Dr. Hoernle, and myself. Colonel Warren's grains, which has now dwindled down to 52 and coins, some of which are figured and described by hich are ngured and described by 53 grains," and ten of the older huns are said Sir A. Cunningham, have been recently acquired to give an average of 55 grains. These statements, by the British Museum. The approximate date, which are not altogether consistent, appear to A. D. 640, of Amsuvarman's coins is certain, but require revision. I do not see how the weight of the dates and order of the other coins are far the han can be derived from that of the kalanju from being settled. In fact the Nepal coinage seed of "over 50 grains," a purely indigenous requires to be worked out in a separate mono measure, and also be copied from the Roman graph before it can be satisfactorily treated in dinar standard. brief. In describing the coins of Mananka and Guninka, Sir A. Cunningham transposes the The citation of the legend of the purchase of terms obverse and reverse. There can be no the Jetavana garden to prove the antiquity of doubt that the side occupied by the seated god "square Indian coins (page 53) suggests the dess is, as in the Gupta coinage, properly denomi criticism, first, that Sir A. Cunningham much nated the reverse. antedates Buddha, secondly, that the representa tions in the sculptures prove nothing as to the No one can be more grateful than I am to Sir facts in the time of Buddha, but only indicate A. Cunningham for giving to numismatic students what seemed to the sculptor a suitable way for the first intelligible guide-book to the numerous representing a payment, and, thirdly, that early croups of miscellaneous early Indian coins, or can square gold coins are not known to exist. The appreciate better the knowledge and learning legend illustrated by the sculpture refers to displayed in the small book under review. But it gold coins. is a reviewer's business to criticize, and I may be pardoned for pointing out some defects. M. I am glad to see that Sir A. Cunningham has Ed. Drouin, when criticizing my work on the ceased to use the values 1.75 grain and 140 grains Gupta coinage, complained with justice that for the rati and suvarna respectively, and now lises the much more correct values 18 and 144. the autotype figures in the plates are often un The values 1.825 and 146 which I have employed satisfactory. The same criticism applies with much greater force to the plates in this work, the in my publications, are perhaps more strictly coins figured being frequently much worn copper correct, but 1.8 and 144 are sufficiently accurate, pieces, of which the photographs are necessarily and form a very convenient basis for a table of very indistinct. In many instances the more weights. expensive and troublesome process of engraving On page 53 the words 4 eight ratis, or 140 from drawings would have given far better results. grains," should be read - eighty ratis, or 144 grains." On the same page it is stated that the This review has run to such a length that it is Jetavana story " will be found in the appendix," impossible to discuss the introductory sections of but there is no appendix. the book, but a few dubious statements may be V. A. SMITH. noted. Modern scholars do not generally accept Cheltenham, the date "from 600 to 543 B. C." for the lifetime 22 June 1892.
Page #373
--------------------------------------------------------------------------
________________ DECEMBER, 1892.] INSTALMENT OF THE BOWER MANUSCRIPT. 349 THE THIRD INSTALMENT OF THE BOWER MANUSCRIPT. BY PROFESSOR A. F. RUDOLF HOERNLE. N the present paper I publish that portion of the Bower Manuscript, which contains the ante, p. on conjuration or use magic spells. This portion consists of four leaves. In shape they are exactly like those previously published; but they are of a somewhat smaller size, measuring only 9 by 2 inches. There is also an appreciable difference in their material; it is not so brittle as in the other parts of the manuscript, but feels tough and supple. A different preparation of the bark would seem to have been used for these leaves. A specimen, being the obverse of the third leaf, is published in the lower part of Plate III., issued with the Proceedings of the Asiatic Society of Bengal for November 1891. The treatise, to which the four leaves belong, is referred to in my paper "On the Date of the Bower Manuscript" (ante, p. 29) as "the third portion C." I have there ascribed the writing of this portion, which is in a large and somewhat slovenly hand, to a scribe distinct from those that wrote the portions published in my first and second instalments. On closer examination, however, and further consideration, I do not feel now quite so sure on this point. It is just possible that the portions published in my second and in the present instalments may be the products of the same scribe, the second portion being written by him in a careful calligraphic hand, but the third in a hurried and rather slovenly manner. The test letter here is the palatal e, which, both in the second and third portions, has the form of a straight-lined square with a circular loop at the lower left-hand corner, while in the first portion it is a square with a rounded top and a minute forked tail in the place of the loop. In the third portion, in keeping with its more slovenly character, the loop is sometimes lett more or less open, and the top-line of the square more or less indented. In fact this indentation is seen in most letters that have a top-line; it is well shown, e.g., in the akshara gra of samgramam in the 5th line (fl. IIIa). On the figured page, unfortunately, the palatal e occurs only once, in yasasvinah, in the 4th line (fl. IIIa), where the shows the open loop, but a straight top. This distinction in the shape of the is quite sufficient to show that the writing of the second and third portions belongs to one and the same class, as distinguished from the writing of the first portion. That it belongs not only to the same class but to the same scribe is shown by another significant circumstance connected with the same palatal letter &. Occasionally this letter assumes, in the third portion, a very cursive form, in which the loop is connected with the top-stroke, so that the whole letter can be drawn with no more than two strokes of the pen, thus 6 (e.g., in santaye IIIbe, yasamitrasya IIIb). Now in one or two places in the second instalment a few letters are inserted between the lines of calligraphic writing, to supply blundered omissions. These inserted letters are written net calligraphically, like the rest of the writing, but in a hurried, slovenly hand, strikingly resembling the hand of the third portion. In one of these interpolations, na samsaya in fl. IIIb (ante, p. 139), the letter occurs and is there drawn in precisely the same very current form which is peculiar to the third portion. This fact seems clearly to prove, that, if not the writer, at all events the reviser, of the second portion was identical with the writer of the third portion. Bat there is no reason why the writer of the second portion should have been a different person from its reviser. It is at least equally probable that the same person, who at first wrote his manuscript in a calligraphic hand, afterwards made the corrections in a more hurried and cursive hand, viz., the same in which he wrote another manuscript (i.e., the third portion). When it is observed that both the second and third portions have this in common, that they never use the transitional or modern forms of y, but exclusively the old tripartite form, it further tends to make probable the identity of the scribes of those two portions. Add to this, 1 Also in the Journal Asiatic Society of Bengal, Vol. LX., Part I., pp. 80, 81.
Page #374
--------------------------------------------------------------------------
________________ 350 IRE INDIAN ANTIQUARY [DECEMBER, 1892. that the writing of the third portion also agrees with that of the second in the matter of the hook attached to the bottom of the main perpendicular (see ante, p. 129). The leaves are again of varying thickness. The first has three, the third has six, and the second and fourth have each four layers. This portion of the Manuscript is complete. It commences at the top of the obverse of the first leaf and concludes with the second line on the reverse of the fourth leaf, the remainder of which is left blank. The treatise which it contains relates & Buddhist tradition : how on the occasion of a novice, named Svati, being bitten by a cobra, Buddha, who was then living in Ana thapindada's garden in Jetavana near Sravasti, gave a curative spell (santi-svastyayana) against snake-bite to his disciple Ananda for the purpose of saving Svati. The introduction, which is written in prose, extends as far as the middle of the last line on the obrerse of the second leaf. It first relates the occasion on which the spell was given, and next enumerates all the dangers or diseases against which the spell may be put in practice. Then follows the great spell, which is composed partly in verse (aloka), partly in prose. The intelligible portions are in verse, while the unintelligible jargon, consisting mostly of alliterating or rhyming words, is in prose. The spell ends in the fifth line on the obverse of the fourth leaf. It is called the Mahamayari, and described as & vidyaraje, or "queen of the magic art." Mahamayuri, I notice, is said in the abridged Petersburg Dictionary to be "the proper name of one of the five talismans and of one of the five tutelary goddesses of the Buddhists." The present treatise shows it to be the name of a spell, From the fact of the mention, before the commencement of the spell (fl. 1b), of the ligatare to be placed on the bitten part, I conclude that the saying of the spell was intended to accompany the operation of tying the ligature. See further remarks on this subject in Appendix III to this paper. The spell is followed by the conclusion, which is again in prose. This consists of a series of salutations addressed to Buddha and Buddhism, under various synonyms, and of good wisbes addressed to a certain " Yasamitra" (for Yasomitra). This would seem to be the name of either the composer of the treatise, or of the person on whose behalf it was composed. Sir Monier Wiliiams' Sanskrit Dictionary, I find, gives it as "the name of a Buddhist author;" but in the abridged Petersburg Dictionary it is only noted as the name of various persons in Jain tradition. A fragment of this portion of the Manuscript, - that on the obverse of the third leaf-was published by me in the April, 1891, Proceedings of the Asiatic Society of Bengal, pp. 60, 61. It was also published, about the same time, and independently of me, by Professor Buhler in the Vienna Oriental Journal, Vol. V., pp. 106, 108, and in the Academy of the 15th August 1891, pp. 138, 139. His reading and translation were reviewed by Mr. R. Morris in the Academy of the 29th August 1891, pp. 178, 179, and by Dr. A. Stein in the Vienna Oriental Journal, Vol. V., pp. 343-345. Mr. Morris, in his review, has given valuable identifications of some of those Nagarajas, whose names occur on A. IIIa. In Appendix I to this paper I have added such further information, as I have been able to gather from the literature of the Northern Buddhists available to me, on all those whose names oceur in the second part of the spell. But perhaps Mr. Morris and other Buddhist scholars, whose acquaintance with that literature is more intimate than mine, may feel disposed to supplement this information, which, I need hardly say, will be gratefully acknowledged by me in the edition I am preparing for the Government of India. Professor Buhler, who interprets the term goa (A. IIIa*; see also 4. IIb) as the same as Godavari, the well-known river in the Dekhan, accordingly considers it probable that the snake-charm was composed in Southern India. I cannot agree with this opinion; I have given my reasons, in a note to the translation, showing that gold cannot be a proper name, bat must be a common noun, meaning district. Nothing, therefore, can be extracted from this word to indicate the locality of the composition of the spell. Dr. Stein, on the other hand, suggests that ? Soe post, Appendix III. The term corresponds to the German Heilspruch.
Page #375
--------------------------------------------------------------------------
________________ DECEMBER, 1892.) INSTALMENT OF THE BOWER MANUSCRIPT. 351 the charm was probably composed in Kasmir, because most of the names, occurring on A. IIIa, are those of well-known Nagas or Sacred Springs of that country. It will be interesting to learn, now that I have published the whole of the mantra, whether any more, and how many, of the names in the list occur in the Nilamata Purana as those of springs in Kasmir. The fact that the manuscript was undoubtedly written in Kasmir, or in an adjoining country, naturally raises a presumption that the charm contained in it may have been composed in the same locality. On the other hand, there is the circumstance that the names of the Naga kings, mentioned in the spell, are, as Mr. Morris has shown, the common property of the whole of Northern Buddhism, and probably also of the Southern. Professor Buhler suggests that the mantra is "a charm which is intended to force the Nagas or snake-deities to send rain." The portion of it contained on fol. IIIa certainly supports this interpretation; and Mr. Morris quotes a similar list of names of Nagas from a Chinese "rain-asking-sutra." I was disposed to hold the same opinion at first, but gave it up when I came to read the whole of the manuscript. The introduction shows unmistakably that the mantra is intended to be a charm against snake bite, for Ananda was to pronounce it over Svati in order to cure him of the bite of a cobra ; and this is also clearly implied in the final words " from all poisons," in the concluding sentences. Its real character of a snake-chau'ni is also clearly shown by its identity with the snake-charm in the Jataka book, of which I give an account in Appendix II. At the same time the charm would seem to be intended to be a protection against all sorts of ills and troubles. I take this to be the meaning of the long list of evils given in the introduction as well as in the conclusion. Still there is clearly a prayer for rain expressed in the two first lines of fol. IIIa. For the presence of this prayer in a snakecharm I can give no satisfactory explanation; though the prayer was, no doubt, suggested by the fact that the Nagas are also looked upon as water-deities, residing in springs or lakes, As a curiosity I may note, that the word jangamd, occurring at the end of verse 15, on A. IVa, appears to be a gloss of the scribe, added to explain the meaning of the word trasa. Trasa properly means 'fear' or 'fearful,' but it is sometimes used erroneously in the place of trasa, whicb means 'movable,' as opposed to sthavara 'immovable' or 'stationary.' The object of adding the gloss would seem to have been to prevent a misunderstanding of the meaning of trasa, which, however, was obvious enough in the context. That the word is not a genuine part of the text, but a mere gloss, is shown by its being extraneous to the metre of both verses 15 and 16. of two curious parallels which I have discovered, (one in the Jataka book, the other in old Indian medical books), I have given a full account in the Appendices II. and III. respectively. The credit of the discovery in the Jataka book, however, is really due to Professor Buhler, who first pointed out the occurrence, in the Khandhavatta Jataka, of the name Chabhyaputra, and who would, of course, have noticed the more extended agreement, if he had had the full text of our spell before him at the time when he wrote his paper. The state of the text and the character of the composition in this part of the manuscript are similar to those in the other parts which I have published. There is a considerable number of clerical blanders and omissions. To mention some of the most obvions of different kinds : we have namo ktaye for namo stu mukiaye, A. IVa(r); daharah starunah for daharah tarunah or daharasztarunah, f. Ia?, etad-avacha for etad-uvacha, f. 161; sulam for sulam, f. Ilab; vasukind for vasukind, f. IIIa'. Sometimes anusvaras are inserted where they should not be, e.g., in sangramarimanubhaswamti for sasngramam=anubhavahti, A. IIIa); in other places they are omitted where they should stand, e. 9., in raksha karohi for rakshari karohi, f. 16%. In several * See also the note on No. 33, Sakitaka, in Appendix 1. * See my remarks, in the Journal, 18. Soc. Beng., Vol. LX., Part I., p. 80, in my paper "On the date of the Bower MS." 6 See Vienna Oriental Journal, Vol. V., p. 110.
Page #376
--------------------------------------------------------------------------
________________ THE INDIAN ANTIQUARY. [DECEMBER, 1892. places the vowels e and a are written where one would expect a and e respectively; e. g., maluratrash for maharatrani, f. 1161; upasargopayabhyah for upasargopayebhyah, A. IVb Occasionally the scribe has made corrections ; thus in fl. III at he had originally written nandopando, but corrected it to nandopanandby inserting na between the lines ; again in A. IaG he seems originally to have written vahayamanan, which he partially rubbed out and over-wrote with nihayamantam. Grammatical anomalies are equally numerous. I nay instance the following : I. - In Orthography : confusion of letters : & for sh in darusu for darushu, fl. Ia ; ri for ti iu niarita for nierita, fl. II165; ri for fi in Dhritardshtreshu for Dhritarashtreshu, A. Illa, riskikeshu for fishikesh u, fl. II113, prithivi for prithivi, fl. 11165;d for l in Mahakadi for Mahakali, A. 1163; forn in varttayamanan for varttayamanan, A. la(r) ; for nin arohani for arohani, f. 1162. Final t is omitted in chaturthakd for chaturthakat, A. IIa, jvara for jvarat, fl. IIa, achare for acharet A. IVa". Insertion of connecting consonants : m in Vasukina-m-api fl. IIIa, perhaps pari-m-apanaya, fl. IIa. Insertion of a separating vowel, i in sirisha for sirsha, A. IIa. Doubling of a consonant: dh before y, in maddhya, A. IIa. Sandhi neglected in tarunah achira, A. Ia", parivartayamanah durakshid, Al. Iak, bhontu anamaya, A. IVa, etc. False sandhi: dero samaritena, A. III a? (for devah sa'), Kolako Apaldlas-cha, A. IIIb (for Kolako 'pa), Bhogavan Sramanerakah, A. IIIb (for Bhogavan Sramo), duchchhaya, A. IIa (for duschhaya). Omission of visarga : before s: fl. Ia Ananda Svatir, A. III63 Kumbhira Suchilomas; before k: A. 1161 karmmana kavkhordo; before p: A. Ia bhikshu prativasati; in pausa : A. IIIa mahardhika, etc. Some among the above given instances might have been also classed as examples of anomalong grammar. II. - In Grammar: (1) Declension : nom. sing.; . IIIa devo, Al. Iabhikshu ; instr. plur., A. III/8 firshahi, tehi; abl. sing., A. 168 grahato, f. IIa chaturthaka, f. IIa jvara; abl. plur., A. IV1 upayabhyah (possibly a clerical error); loc. sing., A. Ial ekasmi, A. 1164 golaya, selaya, Al. IIIa parivelaya. (b) Conjugation : 3. plur. pres., fl. IV a3 bhontu; 3. sing. opt., A. IV at achare; 2. sing. imp., A. 162 and 168 karohi; 2. sing. aor., A. IVa hisisi; part. pres., f. la vahayamantam. Most of these anomalies are more or less pure Prakriticisms; so is also the spelling of belaya with & (for Skr. saila), also of dretiya fi. Ila and devdsura fl. IIIa. With regard to the forms parivelaya, golaya, selaya, they may be either taken as anomalous locative forms of feminine nouns in d, and this is supported by the fact that gold certainly occurs as a feminine noun on fl. IIla(r) in the genitive singular golayah. Or they may be taken as datives of masculine nouns in a, used anomalonely in the place of locatives, and for this makes the fact that sela (Skr, saila) is usually a masculine noun. (c) In Syntax : exchange of Cases : instr. for loc., f. Ial Srdvastya (for Pravastya), f. Ia samayena: instr. and loc. used promiscuously, A. IIIa, Virapaksheshr, but Manina. False concord : nom, and acc., f. Iab Svatir-bhikshum (for Svatin bhikshum, perhaps a clerical error): ging, and plur., f. Ia sa sravanti (for sravati), A. IVas sukho bhonta (for sukha, perhaps a clerical error). (d) Composition : A. IIal kritya-karma (for kritya), A. IIa* makshi-roga (for makshi), A. Ila ara-sala (for iru), A. IVa Yasa-mitra (for Yako); f. IIIa naga-tajan (for naga-raja, but also in Sanskrit); perhaps fl. IIapari-m-apanaya (for pary-apanaya). III.-In Prosody: false quantity, f. 1161 mama, A. IHa cha, see also fl. II163, 11163, 11165, I Val. One syllable in excess, see A. IIIa, IIIa, IIIa, II169, 11166; two syllables in excess, see f. IIIa"; one syllable short, see A. III. b*; two syllables short, see A. IIIZG (probably & clerical error) * The soribe had originally written vihayamanam.
Page #377
--------------------------------------------------------------------------
________________ INSTALMENT OF THE BOWER MANUSCRIPT. DECEMBER, 1892.] IV.-In Vocabulary: new words or new meanings; avadhuta, 'injury,' 'destruction,' fl. IIa. aglana, exhausted,' fl. Ia". Ugatima, a Naga, fl. III63. Elapatra, a Naga, fl. III64 (usually Eldpatra). Okirana 'destruction,' fl. 2al (for avakirana). Kavkhorda, a kind of sorcery, fl. 2a1. Karnaka, a Naga, fl. III3. Kati, probably Prakritic for Karttiki, f. 1163. kritya, witchcraft,' fl. IIal (usually kritya). Kolaka, a Naga, fl. III. gupta, protection,' fl. Ib3 (for gupti). gola, 'district,' fl. IIb, IIIa2. Chhibbasuta, a Naga, fl. IIIa (Pali Chhabbyaputra). Dandapada, a Naga, fl. III. dushana, 'destroying,' 'antidote' (for dushana). dustaraka, the evil eye,' fl. 16 (opp. sutara). nisrita, inhabiting,' fl. III65 (only nisraya 'dwelling-place' noted in dictionaries). Nairavana, a Naga, fl. IIIa (Skr. Vaisravana) paritra, defence,' 'protection,' f. 163 (Pali paritta, from pri + tra). parivela (or parivela ?), 'circumference,' fl. IIIa2. Pithila, a Naga, fl. III. 353 Pundarika, a NAga, fl. III?1. makshi-roga, a kind of skin disease, fl. IIa. mahoratra, the time after midnight,' 'midnight,' fl. II61 (perhaps an error maharatra). Rishika, a Naga, fl. III3. Lambura, a Niga, fl. III4. Vatsiputra, a Niga, III4 fl. (Petersburg Dict., Vatsiputra). Vasumukha, a Naga, fl. IIIa. vahita, 'enunciated,' put forth,' fl. IV a. " Vegudi, a kind of goddess, fl. II. Sakatamukha, a Naga, fl. III. Sankhapada, a Naga, fl. III. Sramanera, a Naga, fl. IIIb1. Samharaka, a Naga, fl. IIIa (comp. Samhura in Petersburg Dict.) Saketaka, a Naga, fl. III63. Sunanda, a Naga, fl. III. Suchiloma, a Naga, fl. III (on the Bharaut Stupa). One more point should be noted. For the purpose of interpunctuation a small hook, very much resembling the modern comma is used. In the portion of the manuscript, published in my second instalment, a small stroke or dash' is employed. In the Nagari transcript, I have represented the hook by a dash, for clearness sake; but in the Roman transliteration I have used commas. In the concluding salutations, the visarga seems to be occasionally employed as a mark of interpunctuation, alternating with the usual comma, and resembling the modern semi-colon; thus after Buddhaya fl. IVas, after Muktaya fl. IVa. After rakshant in fl. IV62 the visarga is employed in addition to the usual mark of a double stroke, to indicate the "full stop." I have seen the visarga occasionally used in this way in modern Hindi manuscripts, as noted in my Gaudian Grammar. In the following transcript, transliteration and translation I have followed the same syste as in my previous instalments; see ante, pp. 134, 135.
Page #378
--------------------------------------------------------------------------
________________ 354 THE INDIAN ANTIQUARY. [DECEMBER, 1892. 1. 2. 3. TEXT. , Transeript. First Leaf: Obverse. 2 evaM mayA zrutamekasmi samaye bhagavA cchrAvastyA viharati jetavane anAthapiNDavasyArAma ...... samanyena zrAvastyA jetavane anAthapiNDavasyArAme-svAti ma bhikSu prativasati smu-navo baharaH staruNaH acirapravajitaH ajirAgataH imaM dharmavinayaM saMghasyAthai jentAkadArUNi pATayamAnI nya. tarAtpUtidArumu pa niSkramya mahatA kRSNasarpaNa dakSiNe pAdAMguSTe daSTaH sa kAntakAyaH bhUmau patitaH pheNaM sAvatyakSINi ca parivartayamAnaH AnAkSIdAyuSmAnAnanda svAtibhikSumanadhikaM bADhA. gAnaM phenaM vAhayamantamakSINi ca parivartayamANaM svarpata dRSTvA ca pana sari . sari ... First Leaf: Reverse. tasyAhaM bhagavaM kathaM pratipadyAmi-evamukta bhagavAnAyuSmantamAnandametadavAca-gaccha svamAnanda ...... vacanena-anayA mahAmAyUryA vidyArAjAyA svAtibhikSoM rakSA karIhi guptaM paritraM parimahaM paripAlanaM zAntisvastyayanaM daNDaparidharaM viSatuSaNaM viSanAzanaM sImAbandhaM dharaNIbandhaM ca karohi-devamahAtI -nAgamahAto-asurama .. -marutamahAto-garuDamahAto-gandharvagrahAto-kinnarapahAto-mahoragamahAso yakSamahAto-rAkSasagrahAto-pretamahAto-pizAcagrahAto-bhUtamahAto-kuMbhANDagrahAto-pUtanamahAto kaTapUtanamahAto-skandagrahAto-unmAdagrahAto-cchAyAgrahAto-apasmAramahAto-ostArakamahAto Second Leaf: Obverse. kRtyakarmaNa kanyo kiraNa-vetADacicapreSakadurbhuktatucchata-ducchAya bhopa . . . . . . . . . vadhUtAto jvarAdekAhikadvatIyakatraitIyakAcAturthakA sasAhikAvardhamAsikA mAsikAdeva sakRnmAtta. nityajvarAviSamajvarAGgatajvarAnmAnuSajvarAdamAnuSajvarA-vAtikapaittikaSmikasannipAtikAtsarvazvarA ziriporti parimapanaya ardhAvabhedaka-arocakaM-makSirogaM nAsArogaM mukharogaM kaNTharoga hRdayarogaM karNazUlaM-vaMtazulaM hRdayazUlaM-pArzvazulaM-pRSThazUlaM udarazUla-gaNDazulaM vastizUlaM jarUzUlaM jaMghAzUlaM-hastazUlaM-pArazUlaM-aMgapratyaMgazUlaM cApanaya-rAtrI svasti divA svasti svasti madhyadine Second Leaf: Reverse. sthite-svasti sarvamahorAtraM sarvabuddhA kucatu-mama / / iDi-viDi-hiviDi-niDe-aDe-yADedRgaDe-hariveguDi-pAMsupizAcini-Arohani-orohANa-ele-mele-tile-kile-tile-mele mile timi-tumipe-ihi-mihi-viSTabdhe-vimale-hu-huhu-azvamukhi kAhi-mahAkADi-prakIrNakezI-kula-kula-vasphalu-kolu-kolu-dhosAdumbA-dokhumbA-duma-tumba-golAya-zelAya-hizuhili-hi-mili-mili-tili-tili-cula-ula-mulu-mula-mula-mulu-mulu-mula-mulu-hue-duha 4. 6. -babA-cabA-cabA-cabA-bacA-jala-jala-jala-jala-jala-dama . . . . . Third Leaf: Obverse. tundubhI-garjanI-varSaNI-sphoTanI-patanI-pAcanI-hAriNI-kaMpana-madana-maDa .-..... ta me-golAyAH parivelAya varSatu devo samatena-dAle kisi svahA // maitrI me nitarASTrapa maitrI nairAvaNeSu ca-virUpAkSeSu me maitrI kRSNagautamakeSu ca-maNinA nAgarAjJA me maitrI vAsakInA mapi-daNDapAveSu . geSu pUrNabhadreSu ca sadA-nandopanando ye nAgA varNavanto yazasvinaH devAsura pi saMgrAmamanubhavati mahadhikA-anavataptena varuNena maitrI saMhArakena ca-takSakena anaMtena tathA vAsumukhena ca-aparAjitena me maitrI maitrI cchibbasutena ca-mahAmanasvinA nityaM tathaiva ca.
Page #379
--------------------------------------------------------------------------
________________ DECEMBER, 1892.] INSTALMENT OF THE BOWER MANUSCRIPT. 355 - 06 - 6 Third Leaf: Reverse. 1. manasvinA-kAlako apalAlazca bhogavAnzrAmaNerakaH dadhimukho maNizcaiva puNDarIko dizAM pani karkoTaka zaMkhapAdaH kaMbalAzvatarAvubhau-pateSvapi ca me maitrI nAgarAjeSu nityazaH-sAketakazca kuMbhIra sUcIlomastathaiva ca ugAtimena kAlena maitrI me riSikeSu ca-tathA pUraNakarNaka maitrI zakaTamukhena ca kolakena sunandena vatsIputreNa ca sadA-elapatreNa me maitrI maitrI laMbureNa ca-pithilazca mahAnAgo mucilintazca vizrutaH prithIvI carAzca ye nAgA tathaiva jalanigRtA-aMnarIkSacarA ye ca merusamAzritAH ekazIrSavIzIrSAhi maitrI tehi . nityazaH apAdeSu me maitrI maitrI vi. .. .. . Fourth Leaf: Obverse. deSu me maitrI maitrI bahupadeSu ca-mA me apAdako hisi mA ma .. ... . . . . . . . . . ca me bahupAdakaH sarvanAgaMSu mai maitrI ye nAgA jalanizritAH sarvabhUteSu me maitra ya sa . . . . . . sarvasatveSu me maitrI ye satvA trAsasthAvarAH jaMgamA saveM satvA sukho bhontu sarve bhonta anAmayA-savva bhadrANi pazyatu mA kazca pApamAcare-maitracittaM samAdAya karomi viSaduSaNaM-rakSAM parigrahaM cai5. va tayaiva paripAlanaM // namo buddhAyaH namo stu. bodhaye namo vimuktAya namo vimuktaye-namo stu zAntAya-namo stu zAntaye namo stu muktAyaH mamo taye-ye brahmANA vAhitapApA dharmAsteSAM namasta ca yazamitrasya Fourth Leaf : Reverse. 1. pAlayatu svAhA-sarvabhayebhyaH sarvopadravebhyaH sopasargopAyAbhyaH sarvajvarebhyaH 2 sarvavyAdhibhyaH sarvagrahebhyaH sarvaviSebhyaH rakSatuH / / II. Transliteration. First Leaf: Obverse. 1 D iva[m] maya rutam=dkasmi samaye Bhagava ch-Chhravastyar viharati Jeta vane Anathapindadasy=(a)r[a]m[6] [tena] . ... 2 samayera Srivastya Jetavane Anathapindadasy=arime, Svatir-nama bhikshu prati vasati smu8 navo daharah s=tarunahi achira-pravraji(tah) ajir-agatah imam dharmma-vinayam samghasy=arthe jentika-dartuni patayamand nya4 tarat=puti-darusu pa[ri]nishkramya mabata krishoa-sarpena dakshine padamgushte dashtah sa klanta-kayah bhuman pa5 titah phenam bravamty=akshini cha parivartta yamanah &vrakshidaayushmane Ananda Svitirsbhiksham=anadhikam badha6g[1]ana(m) phenam vihayamantamlonakshini cha parivarttayamapam sva(pa)m(ta)in (ri)sh (tv)a (cha) P[u] (na) s(a)ri. BDDiDOm Do... First Leaf : Reverse. 1 tasy aham Bhagavan katham pratipadyami, evam=ukte Bhagavin ayushmantam= Anandametad=avacha,ingachchha tv(am=Ananda) (T)[a](th)[A](g)[atas](y)= [aiva] 2 vachanena, anaya mahi-mayurya vidya-rajayits Sviti-bhiksho rakshan kardhi guptam paritram parigraham paripalanam santi. 1 Read Bhagavdi-Chhrivastya or Bhagavalinch-Chhrarastya, or possibly Bhagava in tho Pali form of the nom. sing, though this would not account for the change of the following initial to chchh. 8 Read ema. Read either daharas-taruna? or dahorah tarunah. 10 Here the original writing seems to have been udhayamanam which was corrected afterwards to vdhayamantam. 11 Read svaparitain. ___11 Read uwdcha. 13 Read rdjaya. " Read raksharit.
Page #380
--------------------------------------------------------------------------
________________ 356 THE INDIAN ANTIQUARY. [DECEMBER, 1892. 3 svastyayanan danda-parishJaram visha-dushanam visha-nasanam sima-bandhan dharani-bandham cha karobi, Deva-grahato, Naga-gra4 lato, Asura-gra[bato], Maruta-grahato, Garuda-grahato, Gandharva-grahato, Kinnara - grahito, Mahoraga-grahato 5 Yaksho-grahito, Rakshasa-grahato, Preta-grahato, Pisicha-grabato, Bhuta-grahatd, Kumbhanda-grahato, Putana-grabato 6 Kata-putana-gmhato, Skanda-grahato, Unmada-grahato, ch=Chhay415.grahato, Apasmaragrabito, Os(t)araka16-g[r]ah(at)o Second Leaf: Obverse. 1 kritya-karmman kavkhord17-kirana, Vetada-chicheba-preshaka-durbhukta-duchchhar. ddfilta, duchchly[^], (pra) ........ 2 radhatato jvarad=ekalika-dvotiyakn-traitiyakach-chatarthaka saptahikad-ardha-masika masikad=1&aiva sakri(n)-m[aa](h)a[r]tt[ika] 3 nitya-jvarad=vishama-jvarad=(bh)(Q]ta-jvaran=manusha-jvarad-a-manusha-jvara, vatika-pai ttika-sleshmika-sannipatikat=sarvva-jvara 4 sirisho-rtti19-pari-m-a panaya ardh-avabhedakam, arochakam, makshi-rogam nasa-rogato mukha-10gam kantha-rogam hridaya-roga 5 karonn-sulnin, damta-sulam20 hridaya-sulan, parava-sulam,20 prishtha-salam, adara sulan, ganda-sulam20 vasti-sulam Urd-60lam 6 jningha-sulan, hasta-salam pada-aula, anga-pratyamga -sulam ch=&panaya, ratran svasti diva svasti svasti maddhya-dine Second Leaf: Reverse. 1 sthite, [] svasti sarvva-mahoratran21 sarvva-buddha kurvvamtu, mama3% | Idi, vidi, hivili, nidd, ade, yade, 2 drigade, Hari-vegudi, Pameu-pisachini, Arohani, rohani, 23 ele, mele, tile, kile, 24 tile, mele mile 3 timi, dumipe, itti, mitti, vishtabdhe, vimale, haha, huhu. Asva-mukhi Katti, Mabakadi 26 Prakirnna. 4 kesi, kalu, kula, vasphalu, kolu, kolu, Dhosa-dumba, Do-dumba, dama, dumba, golaya, selaya, hisu, 5 hili, hi, mili, mili, tili, tili, chula, chulu, malu, mulu, mula, mulu, mala, mulu, mulu, huhu, huh[n], [huhu), huhu) 6 huhu, babi, baba, baba, baba, baba, jala, jala, jala, jala, jala, (d)[u](ma)..oi.......... Third Leaf : Obverse. 1 Dundubhi, Garjani, Varshani, Spotani, Patani, Pachant, Harini, Kampan[i] Madan[1], M[an]d[ani), .... 2 kta26 me, Golayah parivelaya varshata devd samantena, 27 Ili Kisi svaha 1 Maitri ine Dhritarashtreshu maitri Naira Arigade, mele mitti, 15 Or perhnpschhay, with short a; the akshara is indistinct; the Vyutpatti seems to read chhayd; see App. I. 16 Perhaps read dustaraka. 17 Perhaps intended for kakkharda, see App. III. * Read Epa. * See footnote to translation. 29 Read St. 21 Read muharatrath. 22 From ratrau to mmet is a 60ka, but the 4th pada has one syllable in ex000. Between mama and the two trokes of interpunctuation, there appears to have been originally alongish soroll which is now nearly washed out. 23 CY. Skr, orari hasi. Or perhaps bhili or tile. The first akshara is blurred. For Mahku. * The aksham kia is written on the margin, outside the line ; and the exact relation in which it stands to the text is donbtful. The full word may have been prayukta. 71 From goly a to samanstann are two padas of a sloka, but the second of them has one syllable in ex0088. * Read eriha. The first 1.stroke is not "abnormally short," but is entirely wanting. I have noticed the faulty fordi orahe also in modern Tibetan Buddhist scripts.
Page #381
--------------------------------------------------------------------------
________________ DECEMBER, 1992.] INSTALMENT OF THE BOWER MANUSCRIPT. 3 vaneshu cha, [1] Virupaksheshu me maitri Krishna-Gantamakeshu cha, 10 Manina naga-rajna me maitri Vasukina 4 m-api, Dandapideehu [n]geshu Purnnabhadreshu cha30 sada, [21] Nand opanando ye uig varnuavanto yasarvinah [1] dev-api samgramamm-anabham vamti mah-ardhika,33 [1 3 11] Varupena maitri Sambarakena cha, [1] Takshakena Anamtena Vasumukhena cha, [4] Aparajitena me maitri33 maitri ch-Chhibbasutena cha, [1] Mahimanasvina nitya tath-aiva cha Anavataptena Third Leaf Reverse. 5 suram 6 tathi naga 1 Manasvina, [ 5 ] Kalako Apalalas-cha Bhogavan-Sramaperakah [1] Dadhimukh Manis-ch-aiva Pundariko disam patih [ 6 ] Karkotaka me maitri 2 Samkhapadal35 Kambal-Asvatarav=ubhan, [1] eteshv-api cha rajesha rityasah, [7] Saketaka-cha Kumbhfra Suchild3 mas-tath-aiva cha, [1] Ugati(m)ena37 Kalena maitri me Rishikeshu tatha Purana-Karunakas maitri Sakatamukhena cha33 [1] 4 Kolakena Sunandena Vatsiputrena cha sala, [ 9 ] Elapatrena maitri Lamburena cha,10 [1] Pithilas cha maha-nago Machilindas-cha visruta [ 10 ] Prithivi-charis-cha ye naga tath-aiva jalanispita, [1] amtariksha-chara ye cha Meru-sama6 srital2 [ 11 ] Eka-sirsha-dvi-sirshahi43 maitri tehi me nityasah ] A-padeshu me maitri mai(tr) [m]e (d)[v]i-[pad]e[shu cha] [ 12 ] [Chatush-paFourth Leaf: Obrerse. cha, [ 8 ] me maitri 5 1 deshu me maitri maitri bahu-padeshu cha, [i] vui me a padak(6) h(im si ma (m)[e himsi] [d]v[ipadakah] [ 13 ] [MA me chatushpado himsi na] 2 cha me bahu-pidakah [] sarvva-ng-shn me maitri ye naga [u 14 ] Sarvva-bhutdshu me m(ai)tr[i] (y)[@] (s)[at](v)[i]. 3 sarvva-satveshu me maitri ye satva trasa-sthavarah jamgama46 [11 15 ] Sarvv satva7 sakho bhontu sarvve bhontu ana(ma)y(a), [] sa[r]vv[e] 357 4 bhadragi pasyamtu ma kas-cha papam-achare, [ 16 ] Maitra-chittam samadaya karomi visha-dushanam, [1] raksham parigraham ch-ai 5 va tath-aiva paripalanam 1 [17] Namo Buddhaya:49 namo stu bodhaye, nam Vimuktaya, namo vimuktaye, namo stu Santaya, na The quantity of this foot is false. 32 Read sangramam-anubhavamti. jala-nisritah 6 mo stu santaye, namo stu Muktaya: namo ktaye, ye Brahmana50 vahita-papa dharmas tesham namas te cha Yasamitrasya 29 Read Vasukind, m, c. a Read Nandipanando. 34 This pada has two syllables in excess. Or possibly Sasketakas-cha. 37 The penultimate consonant is mutilated, but is only suggestive of in. 11-07 Fourth Leaf: Reverse. 1 (p) [4](r)[am] palayamtu svaha, sarvva-bhayebhyah sarvv-opadravebhyah sarvv-opasargoplyabhyal sarvva-jvarthyab 2 sarvva-vyadhibhyah sarvva-grahebhyah sarvva-vishebhyah rakshamtu: 1! Usually spelled Elapatra. 4: This pada has one syllable in excess. Read prithvi, m. c. * This pada is short by two syllables. Read miru-prishtha or miru kata-samaritah. 33 This pada has one syllable in excess 35 This pada scans irregularly. Perhaps read Purana-Karanina. This pada is short by one syliable; insert me after maitri. Read stu muktaye. 31 Read pay bhyah. 43 Read duieirahehi, m. c. 4 M is nearly washed out and obliterated; morcover read me tehi, mi. c. Compare the Pali version in Appendix II. 46 Jamgama is superfluous. 47 Read here and thronghout satt 4 Probably read nams etu Buddhaya. 50 Read Brahmana.
Page #382
--------------------------------------------------------------------------
________________ 358 THE INDIAN ANTIQUARY [DECEMBER, 1892. TRANSLATION. Thus it has been related to me: Once upon a time the Blessed One was staying in Jetavana, the garden of Anathapindada in Sravasti. At that time there lived in Jetavana, the garden of Anathapindada in 'Sravasti, a mendicant, called Svati, (who was) new, fresh (and) young, (and) had but lately joined the Order, and but recently submitted to this (ie., the Buddhist) Doctrine and Discipline. While he was chopping fire-wood for the dry hot bath of the congregation, he was bitten in the great toe of his right foot by a large black snake (ie., cobra), which had crept out from another side among the logs of deodar-wood. He fell exhausted to the ground, foamed at his mouth, rolled his eyes, and tore his flesh. The venerable Ananda seeing the mendicant Svati as he lay in an unconscious state, utterly and thoroughly exhausted, foaming at his mouth and rolling his eyes, inquired of the master: First Leaf: Reverse. O Blessed One, how can I effect this man's recovery ?" When he said this, the Blessed one spoke thus to the venerable Ananda: "Go thon, O Ananda, (and) in the name of the Tathagata save the mendicant Svati with the following spell, the most excellent of the magic art! Grant him guard, 54 defence, assistance, protection, a charm for recovery, preservation from danger, counteraction of the poison, destruction of the poison, and apply a ligature to the wound, a ligature to the vein! Deliver him from seizure by a Deva, from seizure by a Naga, from seizure by an Asura, from seizure by a Maruta, from seizure by a Garuda, from seizure by a Gan harva, from seizure by a Kinnara, from seizure by a Mahoraga, from seizure by a Yaksha, from seizure by a Rakshasa, from seizure by a Pieta, from seizure by a Pisacha, from seizure by a Bhuta, from seizure by a Kumbhauda, from seizure by a Putana, from seizure by a Kataputana, from seizure by Skanda, from seizure by mania, from seizure by night-mare, from eizure by epilepsy, from seizure by the evil eye,50 Second Leaf: Obverse. from the exercise of witchcraft, from destruction by lakkhorda, from injury by Vetalas that attend at burning-places, 57 bad food, bad vomiting, bad night-mare,59 from fever, such as comes on every day or every second day or every third day or every fourth day or every seventh day, or every half-month, or every month, or even only once for a moment, from continued fever, from remittent fever, from fever such as spirits or such as men or such as non-human beings are subject to, from fever such as arises from derangement of the air or of the bile or of the phlegm or of all three combined, in short, from every kind of fever down to 52 Puti-duru I take to be the same as pati-kashtha which is said to be a species of pine, the Deodar; but perhaps it may here mean 'rotten logs of wood.' The PAli version (see App. II) has puti-rukkha, Skr. puti-vriksha; this is said in the Petersburg Dictionary to be Colosanthes Indica, but that would hardly yield fire-wood. 53 There are here slight traces visible of the letters t, th, g and subscribed y. With these and the known number of missing aksharas, I propose to fill up the lacuna, as given in the transliterated text. 54 Gupta for gupti, just as jata for jati in the Asoka inscriptions, see Jonrn. Germ. Or. Soc., Vol. XLII., p. 69. 55 Sima is properly the line of junction of the lips of a wound or puncture. 56 I do not know ustaraka; it should be the name of some mysterious evil; it may be a prakritized form of vastoraka or apastarala, but these words themselves are unknown. I am disposed to consider it a misspelling for dustaraka; the letters & and du have considerable likeness; there is probably a similar misspelling in fl. IIa1 6-pra or du-pra...., whatever the full word may have been (dub-prameha ). Dustarak a might be the 'evil eye,' opp. sutara, or good eye.' 57 I take chichcha to be a Prakritized form of Skr. chitya. 68 The MS. puts a comma after kiruna as well as after duchchharddita; but as all these nouns are in the crude base, while the context requires the ablative case, it would seem that they are all in composition with the ablative vidhutito (avadhitot), abl. sing. of avadhuta. Okirana stands for avakirana, lit. 'sweeping off'; the Charaka has avakira a for 'sweepings'; it is a synonym of avadhuta; or it may be derived from root kri (krindti) to kill.' Ou kakkhirda see Appendix III, Kritya I take to stand for Irityd; but it might be "demons who dig out corpses," oo Hiuen Teiang Vol. I.. p. 156, note 119).
Page #383
--------------------------------------------------------------------------
________________ DECEMBER, 1892.) INSTALMENT OF THE BOWER MANUSCRIPT. 359 headache.50 Remove (from him) also hemicrania, indigestion, fly-like diseases of the skin, so diseases of the nose, diseases of the mouth, diseases of the throat, diseases of the heart, pains in the ear, paius in the teeth, pains in the beart, pains in the side, pains in the back, pains in the belly, pains in the cheek, pains in the bladder, pains in the thigh, pains in the legs, pains in the hands, pains in the feet, pains in any limb, whether large or small. Health at night; health in the day; health wbile midday lasts; Second Leaf : Reverse. health all the time after midnight62; may all the Buddhas grant (it) to me! Idi, vidi, hividi! Nide, ade, yade, drigade ! Oh ye Vegudis of the sun-rays, ye dust-Pisachinis that ascerid and descend 163 Ele, mele, tile, kile, tile, mele, mile! Timi, dumipe! Itti, mitti! In a well fixed, spotless place! Hulu, huhu! O thou horse-faced-one Katti,64 Mahakali, with dishevelled hair! Kulu, kulu, vasphala, kolu, kolu! Dhosa dumba, Do-dumb 1,65 duma, dumba! In the district, 66 on the mountain ! Hisu, hili, hi. Mili, mili, tili, tili! Chulu, chalu, mulu, mula, mulu, mulu, mula, molu, mula! Huhu, hubu, huba, huhu, hahu! Baba, baba, baba, baba, baba! Jala, jala, jala, jala! Duma ........... Third Leaf : Obverse. (May) the goddesses of rumbling, thundering, raining, crashing, falling, ripening, captiva ting, waving, delighting, adorning (grant me prosperity 67). May the dava send rain all round over the borders of my district ! Ili Kisi! Svaha! "I do not quite understand the construction of this passage. There is no verb to govern jvarat and the other ablatives, except apanaye, which also belongs to sirishiriti. The construction of pari also is puzzling : it seems here to mean "from-to;" i.e., remove all diseases from the fovers down to the headache. Moreover pari seems to be compounded with firishortti (like upari), and the whole compound declined in the accusative case sirishorttiparim, instead of sirislirttori pari. But m might also be a mere connecting consonant.-Sirishortti is a curiously blundered compound, for Skr. firortti; for firisha ie a prikritised form of Skr. firsha, and the compound whould be firishartti. Perhaps firish Irtti is a mere clerical error for dirishartti. 60 Makshi-riga is not noticed in any dictionary accessible to me. But as makshikt is a synonym of malaka, I take makshiriga to be the same disease na malala. 61 Here the Mahdmdyuri or great apell' commences. The text has mah-ratram "the night of the festival;" but the context rather suggests maharolram "midnight" or "the time after midnight." The vowels 8 and & Are Occasionally confused in this part of the MS, compare firishdrtti for firinhlitti in I be (note 59), sukhs for sukh IVA 63 On the Pameu-pisachint or "the female Pisachas of the dust" see Childers' Pali Dictionary, s. v. Pislicho. They are one of the four kinds of Pretas. The phrase reminds one of the particles of dust that dance up and down in the rays of the sun. Vegude I take to be a vernacular (Pali or PrAkrit) form of the Skr. bdkurl, which is given in the smaller Petersburg Dictionary as an epithet of the Apearas. Hari I take to be here the "pun" or "the rays of the sun." Katti I take to be a vernacular form of Skr. Karttikt, the spouse or Sakti of Karttikeya (Skanda or Siva), the same as Mah&kalt. 65 Dhoad-dumbd and Do-dumba are probably also vernacular appellatives ; but I cannot identify them in Sanskrit. 65 GOLA occurs again on A. IIIA golayah parivelaya 'on the circumference of the district.' In Hemachandra's Grammar, li, 174, it is noted as a vernacular form of the river name G8ddvari : and in this sense it is taken by Prof. Buhler in the Vienna Oriental Journal, V, p. 106 and 107, footnote, who refers it to the well-known Godkvari of the Dekhan. Dr. Stein, however, points out, ibidem, p. 345, that there is also a small river, Godavari in Kasmir," which enjoys considerable sanctity and is still at the present time visited by pilgrims." If gold should have to be interpreted here as river name, the Kasmir Godavari has undoubtedly a better claim to consideration, 88 the character of the letters in which the MS. is written shows that it cannot have been produced in South India. But Dr. Stein adds that he has not yet in Kaamtr texts come across the shortened form of GAIA for Gadavart ;" and it seems to me moat improbable that the word can be here & river name. It is placed by the side of the word sila (or sell), which is clearly the Sanskrit saila, 'montain,' and is not the proper name of any partioular mountain. Similarly go (or gila) should be a mere common noun, and, accordingly, I take it in the sense circle,'' district.' This meaning also fita in better in the other phrase goldyah pariveldya, for parip 14 properly mean ciroumference, which can hardly be applied to a river. I prefer, therefore, adhering to my original translation in Proceedinge, 4e. 8oc, Beng., for 1891, p. 61. I may add that in the Abridged Petersburg Dictionary gild is noted with the meaning of disc,'circle,' and that the word is still used in the Indian Vernaculars in the sense of circle,' district." 67 I agree with Mr. Morris that we have here no "mantra for an oblation" (Prof. Buhler), and that the list of words does not contain the names of " various plants," but "epithets of Siva's female counterpart Durga."
Page #384
--------------------------------------------------------------------------
________________ 360 THE INDIAN ANTIQUARY. DECEMBER, 1892. (Verse 1) I hold friendship with Dhritarishtra and his race, and friendship with Nairavana and his races. With Virupaksha and his race I hold friendship, and with Krishna and Gautama and their races. (Verse 2) With Mapi, the king of Nigas, I hold friendship, also with Vasaki, and with the Nagas Dandapida and Purnabhadra and their races at all times. (Verse 3) With the Nagas Nanda and Upananda, the beautiful (and) glorious, who with their supernatural power assist even in the war of the devas with the Asuras, (Verse 4) with Anavatapta, Varuna and Samharaka I hold friendship; likewise with Takshaka, Ananta, and Vasumukha. (Verse 5) With A parajita I hold frieodship, and friendship with Chhibbasuta,69 likewise with Mahimanasvin always and Third Leaf: Reverse. with Munasvin. (Verse 6) Algo Kalaka, Apalala, Bhogavanta, Sramaneraka, Dadhimukha, Alani, and Pundarika, the lord of the quarters, (Verse 7) Karkotaka, Sankhapada, and both Kambala and Asvatara : with these kings of Nagas also I hold friendship perpetually : (Verse 8) and (with) Kumbhira (and) Saketaka, and likewise (with) Suchiloma. With Ugitima70 (and) Kala I hold friendship and with Risbika and his race. (Verse 9) Likewise with Parana and Karna I hold friendship and with Sakatamukha, and with Kolaka, Sananda (and) Vatsiputra at all times. (Verse 10) With Elpatra I hold friendship, and friendship with Lambura, and (with) Pithila, the great Naga; and Muchilinda,71 the famous. (Verse 11) The Nagas that live on land, likewise those that inhabit the water, and those that live on high, dwelling on Meru's summit; (verse 12) those with one hend and those with two heads, - with then I hold friendship perpetually. With the footless I hold friendship; I hold friendship with the twofooted ; (Verse 13) with the four-footed Fourth Leaf : Oboerse. 1 hold friendship, and friendship with the many-footed. The footless shall not do haro to me, nor shall the two-footed ; (Verse 14) (the four-footed shall do no harm to me), nor shall the many-footed. With all Nagas that inhabit the water I hold friendship; (Verse 15) with all living beings that live and shall live? I hold friendship; with all beings, whether movable or immovable, I hold friendship.73 (Verse 16) May all beings enjoy happiness, may all enjoy health ; may all experience pleasures, and may no one practise sin. (Verse 17) In the exercise of a friendly spirit I give a remedy counteracting the poison, (I grant) safety and assistance and protection.74 Reverence be to the Buddha ! Reverence be to the Truth! Reverence be to the Emanci. pated one, reverence be to the Emancipation! Reverence be to the Peaceful one, reverence be 1 think, they are divis, or perhaps Nagnis. It looks like a doscription of a thunderstorin in summer. First the Histant rumbling of thunder, then the near thunder and pouring rain, interspersed with crashes of thunder tben the gentle fall of rain; followed by the ripening of the crop, which waves in the breezy sunshine and delights men and adorns the landscape. The missing syllables may be thua supplied : samriddhith prayunkta me, may they grant me prosperity." 8 With regard to the plurals of tho names, seo a noto in Appendix II., so also with ngard to Nairavana. 10 Chhibbasuta occurs under the Pali form Chhabby&putta in Jat. II, p. 145. Soe Apieudix II. 74 The word ugatims is puzzling. In the Tibetan dharanis there is a snake-king, called Ugate, Ugitimu may, therefore, bo a name; but I am rather disposed to suggest that giis & clerical error for gra, and that the whole stands for Skr. ugratama, being an opithet of Kala," the most terrible Kala." Seu however Appendix I. 11 Muohilinda, the seven-hondod sanko, was the guardian of the MaudAkinl waters, and is famous on account orded by him to Buddha at the time of his trial. On him and the ochor Nhgarkjas mentioned in the spell, see the notes in Appendix I. T3 The missing portion of the text I would propose to supply by ye sattva bhdta-bhavinak. The PAli versiul (see Appendix II.) has satta, pana, bhan. Of these satta corresponds to our sattuil, and prind and bhuta would seem to correspond to our bhata. The Pali commentary explains pand ti bhat& bhivind nibbattana-vasena bhuti ti vachana-matt-vista/ vaditabba, i.e., between pana (prana) and bhata there is only a verbal difference, they mean : what lives and what will live through the principle of re-birth.' 78 The text here adde jagami. This is not only in excess of the metre, but is also a nynonym of trdsa. I conjecture that it is a gloss, added by the copyist, to explain trinn which should properly be spelt trasa. The latter means "movable," while tr 81 means "terrifying." it Here ends the spell.
Page #385
--------------------------------------------------------------------------
________________ DHCEMBER, 1892.) INSTALMENT OF THE BOWER MANUSCRIPT. 361 to the Peace ! Reverence be to the Delivered one, reverence be to the Deliverance! The principles of evil and good which have been declared by the Brahma (i. e., the Buddha), to them be reverence, and may they safeguard Yasumitra's welfare! Svaba.76 May they save (him) from all fears, all troubles, all temptations and allurements, all fevers, all diseases, all seizures, all poisons ! APPENDIX I. The Nagarajas. I append a list of the Nagarajas, Nagas, Devis, and the other supernatural beings invoked in the foregoing spell. To this I add such references and information as I have been able to gather. Of the Tibetan Dictionary, called the Mahavyutpatti the Asiatic Society of Bengal possesses a Manascript translation, prepared by Csoma de Koros. This is referred to in my notes as Vy. Dr. Waddoll, to whom we owe some valuablo papers published in the Journal of the Asiatic Society of Bengal, has given me several lists of Naga names, extracted from Tibetan Naga Dharanis or rain-charms. These are referred to as WI. In either case, I preserve the spelling of the respective informants. The Abridged Petersburg Sanskrit Dictionary is quoted as P. Dy. Childers' Pali Dictionary as Pali Dy., the Mahabharata as M. Bh., and Hinen Tsiang from Bual's Buddhist Records of the Western World. The Chinese Sutra, = Ch. S., is the Vardha Varsha Sitra quoted by Mr. Morris in the Academy. (I) Nagas and Nagarajas: 1, Dhritarashtra, 2, Nairavana, 3, Virupaksha, 4, Krishna, 5, Gautamaka, 6, Mani, 7, Vasuki, 8, Dandapida, 9, Parnabhadra, 10, Nanda, 11, Upanandis, 12, Anavatapta, 13, Varana, 14, Samharaka, 15, Takshaka, 16, Ananta, 17, Visumukha, 18, Aparajita, 19, Chhibbasuta, 20, Mahimanasvin, 21, Manasvin, 22, Kalaka, 23, Apalila, 24, Bhogavin, 25, Sramandra, 26, Dadhimukha, 27, Mani, 28, Pondarika, 29, Karkotaks. 30. Sankhapada, 31, Kambal, 32, Asvatara, 33, Saketaka, 34, Kumbhira, 35, Suchiloma, 36, UgAtima, 37, Kala, 38, Rishika, 39, Parana, 40, Karnaka, 41, Sakatamukha, 42, Kolaka, 43, Sunanda, 44, Vatsiputra, 45, la patra, 46, Lambura, 47, Pithila, 48, Muchilinda. There are altogether 48; among them Nos. 8, 10 and 11 are expressly called Nagas, and Nos. 6 and 22-32, Nagarajas; No. 47 is called a Mahanaga. The nature of the others is not specified, but they are, no doubt, all intended to be some species of Naga. The Vyutpatti gives a list of 79 Nagarajas, and 55 common Nagas. Among the former occur Nos. 7, 10, 11, 12, 13, 15, 23, 29, 30, 31, 32, 37, 45, altogether 13, and four others (Nos. 21, 27, 40, 44) that are uncertain. Among the latter occur No. 22, and probably Nos. 2 and 19. The Mahabharatha, Adiparvan, Chap. XXXV, (P. Ch. Roy's transl., p. 113) has a list of 78 Nagas. Among these occur our Nos. 1, 6 (or 27), 9, 15, 18, 26, 29, 31, 32, 39, 45 and perhaps Nos. 2, 30, 36, altogether 14. No.1, Dhritarashtra is not mentioned by the Vy. among any of the Nagas, but as the first in the list of Gandharvas; nor is ho accounted a Naga by the Tibetan Lamas; but in the M. Bh., Ch. S., the P. Dy., and by Morris he is stated to be a Nagaraja. No. 2, Nairavana. At first I doubtfully suggested that this might be the same as Airavana. This view was supported by Professors Buhler, Leninann, and Stein, who took the initial to be & connecting consonant (see Vienna Oriental Journal, Vol. V., p. 345). Nevertheless I now feel certain that Mr. Morris is correct in identifying Nairavana with Vaisravana (see Academy, Aug. 29, 1891, p. 179). In the first place, the use of " as a connecting consonant is very unusual; in fact, I do not recollect ever having met with a well-aathenticated instance. Next, as Mr. Morris points out, Dhritarashtra and Virupaksha are respectively the regents of the East and West, and accordingly one expects Vaisravana, the regent of the North, in the place of Nairavana. Virudhu ka, the regent of the South, is omitted, because he was not regarded as & snake-king, while all the three others were accounted Nagarajas. The four Laka pa las have their position at the entrance, e. g., of a temple; and the Nagarajas among them may be expected to be invoked in the commencement of a spell. There is also sufficient suggestiveness in the similarity of the two names. Lastly, what seems to me decisive is that 16 Suin in such connections practically corresponds to our 'Amen.
Page #386
--------------------------------------------------------------------------
________________ 362 THE INDIAN ANTIQUARY. [DECEMBER, 1892. Airavana is actually invoked in the concluding part of the list, under the form of Eldpatra; see the note below on the latter name. It cannot be supposed that the same Nagaraja would be invoked twice. I cannot account for the curious transformation of Vaisravana into Nairavana. It may be owing to a mere want of attention in the scribe, who confused Vaisravana with Airavana. The M. Bh., 1. C., however, enumerates both Airavata and Elapatra. No. 3. Virupa ksha. In the Vy. he is not named among the Nagas or Nagarajas, nor indeed among any of the special classes of spiritual beings. The only place where he is named is in the general class of "the gods inhabiting this world." Among these "gods," No. 31 is Lokapala, No. 32 Vairavaa, No. 33 Dhritarastra, No. 34 Virudhaka, No. 35 Virupuksha and from among these No. 32 is again enumerated at the head of the Yakshas, No. 33 at the head of the Gandharvas, No. 34 at the head of the Kumbhandas; but No. 35 is not referred to any special class. These four, Nos. 32-35, 88 is well known, are considered to be the four Guardians of the World" (lokapdla). As such, "their frescoes are found in the verandah of every Lamaic temple or gompa; but none of them, not even Virdpaksha, is considered a Naga, by any Lama" (Wd.). But among other Buddhists, Virupaksha would seem to have been placed at the head of the Nagas; see P. Dy. and Mr. Morris' noto; and in the Khandhavatta Jataka (Vol. I., p. 143) he is mentioned as one of the Nagarkjas. In any case, these facts would disprove any connection of our M8. with the Lamaism of Tibet. The list of names of the Lokapulas, compared with the three first names in our list, is rather suggestive of Nairavana being a misspelling for or confusion with Vaibravana. No. 4, Krishoa and No. 5 Gautamaka "are mentioned in the Divyavadana as two snake kings" (Morris), also in the Khandhavatta Jataka (Vol. I., p. 145). P. Dy. has Gautamaks. Nos. 6 and 27 Mani. This name ooours twice. Whether by mistake, or as two different Nagas P The M. Bh., l. C., and P. Dy. give Mani. No. 7, Vasuki. Vy. spells Vasuka ; Wd. gives Basnga in one Dharani and Basuki in another. Also in Ch. 8. No. 8, Dandapkda is not mentioned anywhere. No. 9, Parnabhadra occurs in the M. Bh. He is also known to the Jains. The P. Dy. bas him. Nog. 10 and 11, Nanda and Upananda. "These Nagarajas assisted the Devas in a struggle with the Agaras" (Morris). That struggle is narrated in the Kuldvaka Jataka (Jat, I., p. 203, 204), where it is stated generally that the Uragas or Nagas helped to guard Sakra's residence, bat neither Nanda nor Upananda are named. The reference in our spell would seem to refer to an occasion where these two Nagas distinguished themselves above the others. In the Vy., Nanda is enamerated by himself as the 15th of the Nagarajas, and again Nandopananda is mentioned as the 50th among them. It is not clear in the latter place whether one or two Nagas are meant. In our spell clearly two individuals are intended. The Oh. S. and P. Dy. give both. In wa. lists there is an Upanta and an Unanta. See also (Hiuen Tsiang, Vol. II., p. 166, note 77). No. 12. Anavatapta is the Nagaraja of the Sarik-kul lake in the Himalayas, the source of the Ganges, Indus, Oxus and Zarafshan (Hiuen Tsiang, Vol. I., p. 11, 12). He is No. 13 in Vv. Also in the Lalita Vistara, p. 249, 14. (P. Dy.), and in Ch. S. No. 13, Varuna. In Vy. he is No. 9. Also in P. Dy. and Ch. 8. No. 14, Samharaka. The P. Dy gives Samhara as the name of an Asura. Mr. Morris sug. gests a misreading for Fangara = Sagara, which is very improbable. No. 15, Taksbaka. Vy. No, 8, M. Bh., l. C., No. 4, also in P. Dy. and Ch. 8. No. 16, Ananta. Vy. No. 7, also in Wa., P. Dy., Pali Dy, No. 17, Vasumukha, not found anywhere else. No. 18, Aparajita in the M. Bh., l. C., also in P. Dy. No. 19, Chhibbasuta, as Prof. Buhler first pointed out, is mentioned in the Khandhavatta Jataka (Vol. I. p. 145) under the form ChhabbyA-putta. See Appendix II.
Page #387
--------------------------------------------------------------------------
________________ DECEMBER, 1992.] INSTALMENT OF THE BOWER MANUSCRIPT. 363 Noe. 20, and 21, MabAmanasvin and Manasvin. The latter in Ch. S. and in P. Dy. The Vy. has Manasti (sic) as No. 57. No. 22, Kalaka. The Vy. gives Kalaka as the 17th of the common Nagas, and a Kaliko as the 31st of the Nagarajas. The P. Dy, has it as the name of a Rakshasa and an Asura. No. 23, Apalala is mentioned by (Hiuen Tsiang, Vol. I, p. 122, 123, 126, note) as the Naga of the spring which forms the source of the Swat river in Udyana. He was prevailed upon by Buddha to desist from annually inundating the country. He is No. 45 in Vy. In P. Dy. it is the name of a Rakshasa, No. 24, Bhogavan, according to P. Dy, occurs in the Suparnidhyaya, p. 9, 1. No. 25, Sramanera is probably the Nagaraja whose story is told by (Hiuen Triang, Vol. I., p. 63, 64). He was originally a Srimanera, or Buddhist novice, but became the Naga king of a lake on the summit of a snowy mountain in the Hindu Kush. The Vy. has a Sramana as the 19th in the list of common Nagas. No. 26, Dadhimukha, in the M. Bh., l. c., also according to the P. Dy., in the Harivuriga (Calcutta ed.), v. 9503. No. 28, Pandarika, not mentioned elsewhere. The Vy., however, has a Padma, as the 4th of the Nagarajas. No. 29, Karkotaka is No. 2 of the Nagarajas in Vy. and No. 5 in the M. Bh., I. c. Wd. gives Karakotaye in one Dharani and Karkota in another. The P. Dy. has it. No. 30, Sankhapada. The Vy. has Sankhapalo as the first of the Nagarajas; there is also a 'Sankho as No. 22. wd. gives "Shangkapala" in all Dharanis. It can hardly be doubted that all these are intended for the same name. The M. Bh., 1. c., has Sankhapinda. Nos. 31 and 32, Kambala and Asvatara are enamerated in the Vy. under one No. 65, though stated to be two separate Nagarajas. They are Nos. 34, 35 in the M. Bh., 1. c. The Pali Dy. has Kambala, No. 33, SAketaka is not found elsewhere. It might be not a name, but an epithet of No. 34 Kambhira, meaning a native of the town of Sakete' (= Ayodhya in Oudh), and if all these names are those of sacred springs, we should here have the name of a spring in the centre of North India. It is just possible that the name may be Samketaka: but the apparent anngvara ia attached to the foot of the letter in the line above sakataka, and is, in all probability, part of that letter. No. 34, Kumbhira is, in Hiuen Tsiang, Vol. II., p. 49, the name of several Nagas of poole near Benares. In the P. Dy. it is the name of a Yaksha. No. 35, Suchiloma occurs in No. 74 of the inscriptions on the Bharaut Stupa as the nemo of a Yaksha (see ante, Vol. XXI., p. 233). No. 36, Ugatima. Wa. given Ugate. The M. Bh., l. o., has Ugraka. See note 70. No. 37, Kila is the 24th Nagaraja in Vy. He stood before Buddha and sang his praises just before his contest with Mara (Nidana Kathd, p. 97, in Rhys Davids' Buddhist Birth Stories). Also in P. Dy. and Pali Dy. (s. o. Nago). No. 38, Rishika; not found elsewhere. No. 39, Purana is No. 9 in the M. Bh., l. c. The P. Dy. quotes a Naga Paranaka from the Harivansa (Calcutta ed.), v. 9502. Nos. 40-43. Karnaka, Sakatamakha, Kolaka, Sananda are not found elsewhere. The Vy.. however, gives Kulika, as the name of the 3rd Nagaraja. No. 44, Vatsiputra, also spelled Vatsiputra, and quoted by the P. Dy., as the name of a Naga, from the Karanda Vyuha 2, 13. No. 45, Elapatra, also spelled Elapatra. With the latter spelling it occurs as the name of the 43rd Nagaraja in Vy., and as No. 11 in the M. Bh., l. c.; also in Ch. 8. and P. Dy. Another spelling is Erapata (in Skr. Airavata) or Erapatha, with the conjunct tr simplified into t or th
Page #388
--------------------------------------------------------------------------
________________ 364 THE INDIAN ANTIQUARY. [DecemBER, 1892. (as in etha for atra). The former (with t) occurs in Nos. 59 and 60 of the inscriptions on the Bharaut Stupa (see ante, Vol. X., p. 258 and Vol. XXI, p. 232). The other (with th) is the commoner one, and occurs in the Khandhavatta Jataka (Vol. I., p. 145); see also Pali Dy., 8. v. Nago. A third spelling is Elapana or Eravana, of which the former is given by Mr. Morris from Ch. S., while the other corresponds to the Sanskrit form Airavana. There was a Nagaraja of this name both near Takshabila and Banaras, see Hiuen Triang, Vol. I., p. LXVIII. and p. 187. No. 46. Lambara may be the Nagaraja of the lake on the crest of the mountain of "Lanpo-lu," in Udyana, whose story is given by (Hiuen Tsiang, Vol. I. p. 128 ff). Vy. gives Lambuka as the name of the 12th Nagaraja (also in the P. Dy.) No. 47. Pithila, not found elsewhere. No. 48. Muchilinda, (or Machalinda), was the blind Naga king of the Mandakint lake near Gaya, who, after Buddha's enlightenment, shielded him in seven folds during a storm (Hiuen Tsiang, VOL. I., p. LXIII., Vol. II., 128, Nidana Katha, p. 109). Also in Oh. 8., P. Dy. and Pdli Dy. II.-Black Nagas. Dr. Waddell informs me that the Nagas invoked in Tibetan rain-charms are of three kinds: white, black, and angry. The names of the black and the angry Nagas are mostly such unintelligible words, as Hili, Mili, Jala, &c. Many of these occur in our spell. I believe they are really mere unintelligible jargon, interspersed here and there with a real name, such as Pamsn-pisachini, or a real word, such as goldya. It was only pedantio sabtlety that made them into names of Nagas. In the Krahamanta-ndma Dharani occur the following names of black Nagas : Limi Limi, Hili Hili, Tsili Tsili, Jala Jala, Pata Pata, Brara Brara Kati Kati (Wd.). In another Dharani are found the following angry Nagas: Mili, Hili, Jala Puta, Brara, Kuti, Takra, Hala, Hulu, Siti, Kuru, Egate, Arare, Madhaye, Patini, Apare Shibate, Ture. Of these Hili, Jaia, Mili also occur in our spell; and Tsili, Brara, Hulu, Kuru, Arare may be respectively compared with our Chala, Baba, Huhu, Kala or Kola, Ade. A few unintelligible names are also given in the Vyutpatti among those of the Nagarajas: thus its No. 36 Edo, No. 51 Holudo, No. 52 Ulako, No. 71 Dramadro. With these may be compared our Ele, Huhu, Duma or Dumba or Dodumba. Dr. Waddell gives me from the Klu-i-sde or classes of Nagas' in the Mdo-mang or collection of sutras' the following list of Naga kings and Nagas : "Om Nagaraja Ananta svaha! Nagaraja Upanata, Takshaka, Karkota, Ulika, Ananta, Basuki, Maliki, Shangkapala, Panaye, Kanale, Babute. Om maerzang Naga Gayana, Nagaraja Ugate, Naga Mujiki, Majalasho, Prashanaye, Naga Garaneye swaha; Dakuri svaha; Shona Majalasho, Prashona, Kurani, Dukari (No. 2), Maruni, Debaya, Gaya, Bhanajayu, Bayama, Ragashaya, Ratsayu, Debaya, Nagaraja Yu, Naga Nate, Nagaraja Debaya, Ja hung bam ho ! Nagaraja Ye svaha! Nagaraja Naye, Naga Ragashaye, Yunaye, Upaye, Ghanagudeye. Om Nagaraja Ananta Svaha! Nagaraja Unanta, Upanatana, Tagnan svaha! Nagaraja Karkota, Ulika, Basuki, Malika, Shangkala, Naga Kili kili svaha! Mili mili svaha! Jala, jala; Pata pats. Dhama dhama, Ehara bhara, Kuti kati, Hara hara, Tara tara, Hula hula, Hulu hulu. Siti siti, Svati svati, svaha! Naga Guru guru svaha! Agete, Arate, Marate, Badane, Apara, Sbabae svahA! Tari turi, Buri buri, Hatse hutse svaha! Salutation to all the Naga kings, including Ananda!" III. Dovis or Nagis. Of the 10 names mentioned on A.IIIal I have only noticod one which is similar in Dr. Waddell's list. It is Patini, which appears, however, as the name of an angry Naga, in a Dharani of the latter Nagas. The Vyutpatti gives no list of names of Devis or Nagis. IV.-Grahas or Seizures. Twenty-one are enumerated in our MS. : 1, Deva, 2, Naga, 3, Asura, 4, Marata, 5, Garuda, 6, Gandharva, 7, Kinnara, 8, Mahoraga, 9, Yaksha, 10, Rakshasa, 11, Preta, 12, Pisacha, 13, Bhata, 14, Kumbhanda, 15, Putana, 16, Katapatana, 17, Skande. 18. Uamida, 19, Chhaya, 20, Apasmara, 21, Dustaraka. Nearly the same list is given in the Vyatpatti: the nine first mentioned, together with No. 14 Kumbhanda constitute its entire 156th chapter of names of supernatural beings, viz., 1, Deva, 2, Naga, 3, Yaksha 4,
Page #389
--------------------------------------------------------------------------
________________ INSTALMENT OF THE BOWER MANUSCRIPT. DECEMBER, 1892.] Gandharva, 5, Asura, 6, Daitya (instead of our Maruta), 7, Garnda, 8, Kinnara, 9, Mahoraga, 10, Kumbhanda. The remainder, with the exception of Dustaraka, are mentioned in the 200th chapter on the Yidags or 'evil spirits,' in nearly the same order: Preta, Kumbhanda (here again enumerated), Pisacha, Bhuta, Patana, Katapatana, Unmada, Skanda, Apasmara, Chhaya, Rakshasa. Skanda is here explained to mean an evil spirit that "makes dry or causes consumption," and Chhaya (spelled thus), one that "causes defilement." In the Sueruta (Uttaratantra, chapter 27), however, Skanda is said to be the Grahadhipati, or Chief of the Grahas' which affect children. In the Sueruta and the Vangasena (p. 910), skanda-graha is explained as 'convulsions' (gatrasya spandana-kampanam, and samrabdhah kara-charanais-cha nrityati), &c. Chhaya is generally said to mean 'nightmare.' Unmada mania and apasmara 'epilepsy' are treated in the Charaka and other medical books as ordinary diseases. After the grahas the spell proceeds to mention ordinary ills or diseases. APPENDIX II. The Khandavatta Jataka. There is such a remarkable agreement of portions of this Jataka with the story of our MS. that a translation of the substance of it may be welcome for comparison.76 365 The commentary of the Jataka narrates the occasion of giving it thus: The Master related this Jataka concerning a certain monk, while he was staying in Jetavana. That monk was chopping wood at the door of the firing-room (jantaghara-dvare), when he was bitten in a toe (padanguliya) by a snake which came from out a Puti tree (putirukkh-antara); and he died then and there. The fact of his death became known in the whole monastery. In the religious assembly the monks began to discuss the occurrence among themselves. The Master on entering asked them what they were talking about; and when he was told what it was, he said to the monks: "if that monk had cultivated the friendship of the four snake-kings and their races, the snake would not have bitten him; for Buddha in a former ascetic existence cultivated the friendship of the four snake-kings and their races, and thus, so far as those snake-kings were concerned, he was not exposed to the risk of a re-birth (through being bitten to death by a snake)." He then proceeded to relate the following legend: In the past, when Brahmadatta was king of Banaras, the Bodhisattva was born in the family of a Kasi Brahman; but when he came of age, he retired from the world and made for himself a hermitage in a bend of the Ganges in the interior of the Himalayas, where, in the company of other Rishis, he devoted himself to a life of meditation. That place was infested by snakes of various sorts, and in consequence the death of a Rishi was a thing of frequent occurrence. The ascetics represented this state of things to the Bodhisattva. He advised them that they should cultivate the friendship of the four Snake-kings and their races, then no snake would bite them; and for this purpose he taught them the following gatha (aloka) verses: 1, Virupakkheh me mettah mettam Erapathehi me | Chhabbyapattehi me mettcm Kanha-Gotamakehi cha 11 2, Apadakehi me mettam mettam dipadakehi me chatuppadehi me mettai mettam bahuppadehi me 3, Ma mam apadako hinsi ma mam himhsi dipadako ma mam chatuppado himsi ma mam hishsi bahuppado || 4, Sabbe satta sabbe pana sabbe bhuta cha kevala | sabbe bhadrani passantu ma kan-chi papai agama || 14 There appears to be a similar passage in the Chulavagga V, 6 (see Jat., Introd., p. LII. and Academy, 29th August 1891, p. 178), but that book has not been accessible to me here (Darjeeling). 17 This and the other plurals are explained in the Pali commentary to include the races (hula) of the respective Snake-kings. The Tibetan Vyutpatti gives Dhritarashtra as the first, or at the head, of the race of (eleven) Gan. dharvas, and places Sankhapala as the first, or at the head, of the Nagarajas. See Appendix I.
Page #390
--------------------------------------------------------------------------
________________ 366 THE INDIAN ANTIQUARY. [DECEMBER, 1892. i. e. " With the race of Virupaksha I keep friendship, and friendship with the race of Erapatha; with the race of Chhabbyaputta I keep friendship, and with the race of Krisha and Gotamaka. (2) With the footless I keep friendship, and friendship with the twofooted; with the four-footed I keep friendship, and friendship with the many-footed. (3) Let not the footless harm me, nor barm me the two-footed; let not the four-footed harm me, nor harm me the many-footed. (4) All that exist, all that live, all that will live hereafter, one and all, may they experience the good things, may none of them fall into sin." Buddha explained to them that by the first verse they would establish friendship with the four Nagarajas and their races, and by the second, with snakes and fishes, men and birds, elephants, horses and all other quadrapeds, scorpions, centipedes and other multipedes, and thus they would become proof against being bitten or injured by any of them. The third would serve them as a request, by reason of that friendship, to be saved from all danger from those different classes of beings. The fourth would show their feeling of goodwill to all creatures. He then proceeded to explain how all anfety (paritta) was ultimately to be ascribed to the transcendent power of the three gems, Buddha, Dharma and Sangha, and concluded by teaching them the following hymn : "My safety is secured, my protection is secured! Let all creatures leave me in peace! So I will praise the Blessed One; I will praise all that through him are saved!" In this manner the company of Rishis found protection ; and thenceforward, by the virtue of the charm taught by the Bodhisattva, the snakes left them in peace. The Bodhisattva himself in due time went to heaven. The incident related in tho Jataka book is clearly the same as that narrated in our Manuscript. But what is there given in the form of a Jataka, an incident from a former existence of Buddha, is here related as an Avadana, an incident from his last existence. There the monk (Svati) is represented as dead, and the spell as having been given on a long-past occasion. Here Svati is represented as only being near death, and as going to be saved by the spell given on that very occasion. The spell, moreover, is here given in a very expanded form. To the first verse of the spell in the Jalaka correspond ten verses (1-10) in our MS.; to the second and third verses there, correspond five verses (11-15) here, while the fourth verse there, corresponds to the sixteenth verse here. Some portions of the spell in our Manuscript look very much like direct translations from the Pali. Our verses 126, 13, 14a and 16 are Sanskrit versions of verses 2, 3, 4 in the Jataka. Verse 13a has actually preserved, in hissi, a fragment of the original Pali. But the different wording of verse 16a would seem to show that the Sansktit version in our Manuscript is based on a Pali recension different from that contained in the Southern Buddhist Jataka book. Other Pali fragments are scattered, here and there, through the whole of our Sansksit version; thus we have kardhi on A. Ib2 and teli on f. 11166. Thia would seem to indicate that the Northern Buddhism possessed an original Pali recension co-extensive with the Sanskrit recension in our Manuscript. To my mind, the transformation of the story from a Jataka to an Aradana form, as well as its expansion in the latter form, is an evidence of the story in this form being of a later age than that in the Jataka book. This in itself is an evidence of the genuineness and the antiquity of the story in the Jataka form as preserved by the Southern Buddhists of Ceylon. APPENDIX III. The Mahamayuri Spell. I was at first disposed to suggest that this spell may have reccived its name Mahd-mayuri from the fact, that some part of the peafowl (mayiru) was used along with it. As a matter of
Page #391
--------------------------------------------------------------------------
________________ DECEMBER, 1892.) INSTALMENT OF THE BOWER MANUSCRIPT. 367 fact the quills of its tail-feathers, or its feet, burned and powdered, and its bile, form the ingredients of several medicines and antidotes prescribed in the older Indian medical works. Thus a powder containing burned quills (Sikhi-nada dagdham) occurs in the larger medical treatise of the Bower MS. on A. I 62. A very similar powder or tincture is given in the Charaka: p. 7:26 (mayura-nalan dagdhva), in the Susruta, p. 850 (barhi-patra-prasutam bhasma, i. e., ashes of peacock-feathers'), in the Vangasena, p. 288 (barhi-padar dagdhau i.e. burned peacock's feet '), and in the Chakradatta, p. 277 (aikhi-puchchha-bhati, i. e., ashes of peacock's tail-feathers').78 This, however, is not prescribed as an antidote; but an antidote against snakepoison, containing the powdered quills of the tail-feathers of the peacock (aikhi-barha) is given in the Charaka, p. 764. This powder is to be mixed with clarified butter and set fire to ; and with it one's house, bed, and clothes are to be fumigated. Again in.Charaka, p. 774, the broth (rusa) and tail-feathers (parshatu) of the peafowl, in Charaka, p. 760 its bile (sil:hi-pitta), and in Charaka, p. 773, its eggs (barhin-anda) are prescribed to be taken, with other things, as an antidote against snake-poison, and in Charaka, p. 776, the peafowl is, therefore, directed to be kept on one's premises. Similar prescriptions occur in the Sueruta ; see, e. 9, p. 632, 650, and in the Vangasena, p. 935 (mayara-pitta, i. e,, bile of a peacock). I cannot find any such prescriptions in the Ashtanga Hridaya. But while searching for these references, I came across a much more curious circumstance. The Charaka describes an antidote against the poison of snakes as well as poisons generally, which exhibits some striking features resembling those of the spell in pur manuscript. It is given on pages 762-764.80 It is called the Maha-gandhahasti (lit. the great scent-elephant'), and is described as very powerful. This antidote consists of 60 drugs which are to be made up with the bile of cows (pittena gavam) into pills (gudilca) for internal, or into a liniment (pralepa) for external use. Used internally, the patient will quickly recover from poisoning; if applied externally, a person will be proof against poison, he may handle snakes or eat poison without any risk. It may also be smeared on various musical instruments and these sounded, or on umbrellas or flags, and these exhibited ; in that case, they will act as a protection against infantine seizare (hala-graha), kharkhota,81 witchcraft, Vetalas, magic spells (atharvana mantrak), every kind of seizure (sarva-graha), fire-arms (agni-sastra), kings (nripa) and robbers (chaura). In short there will be prosperity, whenever this antidote is present. During the process of grinding its ingredients, the following spell (mantra) should be pronounced :. "To my mother success and glory! success and glory to my father! To me saccess, to my son success, may I be successful ! Reverence to the Perfect (Purusha-sisha) Vishan, the Creator (visvakarman), the Eternal Krishna who upholds and renews the world! may his wonderful control be at once seen over Vtishayapi,8Brahma and Indra, so that I may not witness the discomfiture of Vasudeva, nor the marriage of my mother, nor the drying up of the ocean. May this antidote be made efficacious by means of this true spell! Hili, Mili! With this all-healing powder protect me! Svaha !" What appears to be intended for the same antidote is given in the Susruta, p. 641, 642, under the name Mahd-sugandhi ("the great sweet-scented one'), but it is made to consist of 85 ingredients. It is given as one of those antidotes, which are "to be sounded with drums" (dundubhi-svaniya). On p. 629 the Susruta says, that drums (dundubhi) which are smeared with an antidote, are to be sounded in the presence of the patient (see also p. 633). There is this difference, however, that the Susruta prescribes no particular spell to be said during the preparation of the Maha-sugandhi antidote. * I quote Jivananda's editions of the Charaka and Susruta. The editions of the Vangasena and Chakradatta are specified in my first instalment, in Journal As. Soc. Beng., Vol. XL., P. 149, 150. 59 Parshata means the 4 parti-coloured part," and is in that place of the Charaka applied to the skin of the antelope (Ana), the fonthers of the peafowl, quail and partridge (ikhin, Iva, taittiri), and the bristles of the porcupine (vavith). 0 In tho Bongkili odition, it is in Vol. III., PP. 495, 496. 1 For this the Bengali recension reade rakshasi 'Rakshasas,' and for VetA148 it reads mantra 'spells." 82 The Beng. recension reads visha.kshaye.wonderful in its destruction of poison.'
Page #392
--------------------------------------------------------------------------
________________ 368 THE INDIAN ANTIQUARY. [DECEMBER, 1892. Further, the Ashtanga Hridaya gives an antidote under the name of Chandradaya ("moonrise '), which it praises as a most excellent protection against poisons of every kind, as well as against Vetalas, seizures, witch-craft, papma (disaster'), plague, disease, famine, and war. It is made up of 28 drugs mixed in honey, and is to be applied to the patient by a pure virgin, while the physician is to pronounce the following spell during the process of preparing and applying it : "Reverence to the Purusha-simha! reverence to Narayana! So may I not witness the discomfiture of Krishna in the strife! May through this true spell my antidote be made efficacions ! Hulu, Hulu! Protect me from all poisons, O Gauri, Gandhari, Chandalt, Matangi! Svaha !" It appears that according to the Charaka and Sueruta, spells (mantra) are to be used along with important operations in cases of poisoning. But the Susruta, on p. 626, prescribes this expressly at the time of the application of the ligature to the bitten part. That operation is called the arishta-bandhana or dhamani-bandha (Chakradatto, p. 689). It is the first thing to be done, and is afterwards followed by the administration of antidotes. In the preparation or administration of the latter, the use of a spell was not prescribed. Out of a very large number of antidotes, the Maha-gandhahasti and the Chandrodaya are the only two to which spells are annexed, which circumstance would show that they were exceptions, being considered antidotes of magical efficacy. Now there are three poin is to be noted. In the first place, the spell in our Manuscript is clearly intended to be a spell to be used at the time of tying the ligature. This is shown by the direction : sima-bandhari dharani-bandhan karohi, 'apply a ligature to the wound and to the vein,' followed by the spell. I do not now, therefore, think it probable, that the spell had its name of Mahd mdyuri from any ingredient in an antidote used along with the spell. An additional reason is that there is no indication in the spell and its story of the use of any antidote. In the second place: there is a considerable resemblance in the enumeration of evils which the spell is supposed to counteract, as given in our Manuscript and in the Charaka and the Ashtanga Hridaya. This is shown in the following table : Bower MS. Charaka. Ashtanga. 1. Graha (21 kinds). 2. Kritya-karman. 3. Kavkhord-okirana. 4. Vetada, de. 5. Durbhakta, &c. 6. Jvara, &c. 7. loga (various). bala-graha. sarva-graba. karmana. kharkhoda. Vetala. graha. karmana. papman. Vetala. dur-bhiksha. maraka. vyadhi The Charaka and Ashtanga add a few other ills, such as war, oppression and robbery, but these are covered by the second list of evils at the end of our spell. It seems to me impossible to avoid the impression that there is some connection between the three versions. In the third place: there is a curious verbal coincidence between the word kharkhopa in the Charala and kavkhordu in our MS. The abridged Petersburg Dictionary gives a various reading Kharkhida. The word appears to have been unintelligible in later times; for the Ashtanga Hridaya substitutes papman, and the Bengali edition of the Charaka, rakshames. It is, so far as I know, only known to occur in one other place; viz., in the Rajatarangimi, V. 239 (in Dr. Stein's new edition). There it is related that the treasurer of king Gopala Varman, in order to conceal his delinquencies, caused a person Ramadeva, who was a proficient in Khar. ichola, to compass the death of the king by his sorcery (abhichara). This story shows, that by
Page #393
--------------------------------------------------------------------------
________________ DECEMBER, 1892.) SACRED LITERATURE OF THE JAINS. 369 kharkhoda a deadly kind of charm was understood. While preparing the present instalment, however, I have received another ancient manuscript; and in this I have been lucky enough to discover the same word in two places. The manuscript was dug out of a ruined house, near the town of Kugiar, not far from the Yarkand frontier. It is written on Daphne paper, and contains apparently six or seven separate treatises. These are written in two entirely different types of characters. One portion is written in the well-known North-Indian Gupta characters, very closely resembling those in the Bower MS.; but the other portion is written in the Central-Asian type of characters, a specimen of which has lately been published by Mr. S. d'Oldenburg in the Records of the Oriental Transactions of the Imperial Russian Archeological Society, Vol. VII, 81-82. These latter have a close resemblance to the so-called "Warta" characters, which are said to have been brought into Tibet early in the seventh century A.D. from Liyul or Khoten.$3 One of the treatises of this second portion, in the Central-Asian characters, contains the story of a charm, apparently given by Buddha to a Senapati. In it the word, which is here spelled kakkhordda or kdkkhordda, occurs twice. Unfortunately the mannscript is much mutilated; but the better preserved of the two passages runs thus; ....dandena parimuchchishyati .. evam=eva parimu(chch)(ishyati] .... bastra[i] kramati na visha n-agni nousi-visha na kakkhordda na Vaitala na ...... (ma)[haba]lai karoti, i.e., "he will be delivered from danger by ...., even so he will be delivered ..., no weapon hurts (him), no poison, no fire, co snake-poison, no kakkhordda, no Vaitala, no.i.... has any overpowering effect." The other passage has .... kritya-kakkhordda-putanaik...... (parimuchchish]yati, i.e., "be will be delivered from witchcraft (or demons who dig out corpses), kakkhordda and Putanas (eVaitalas)." The spelling slightly differs; the first passage spells the word with a short a, the second with a long a. The dental d (not cerebral !), and the position of rin the second syllable (not in the first) would now seem to be the correct spelling. The variation in the spelling of the initial letter (le or kh) is possible; a similar instance is kakhafa and khakhata hard,' both given in the Petersburg Dictionary. The spelling kavkhorda in the Bower Manuscript I take to be a clerical error for kakkhorda; the v is not well made. There is another curious verbal coincidence in the word santi-svastyayanam 'mystic spell for recovery,' which is used both in our Mannscript and the Ashanga Hridaya. The latter applies this term to the Chandrodaya spell, which I have above quoted as parallel to our Mahamayuri spell. WEBER'S SACRED LITERATURE OF THE JAINS. TRANSLATED BY DR. HERBERT WEIR SMYTH. (Concluded from page 156.) XLVI. Fourth malasatram, pindaniryukti. There is no text of this name in Berlin. We find MSS. of it mentioned in Kielhorn (Report 1881) pp. 9, 26-29, 95, and Peterson's Palm-leaf 166.1 According to what I have cited on page 79 from the Vidhiprapa, [81] the pindan. is connected with the fifth chapter of the third mulagutra. It is surprising that a niryakti text should appear as a part of the Siddh., (see above p. 41). It deserves to be noticed that the pindan, is not woentioned in the anangapavittha list of the Nandi (see p. 11 ff). In the list of Raj. L. Mitra and Kasinath Kunte pindaniryukti appears as the name of their fourth chhodasutra; Kasinath says that its contents is on the cause of hunger and the patare and kind of food to be taken." A pindaniryuktivsitti is ascribed to the old Haribhadra (see p. 458). Kielhorn, 1. c., cites & vsitti of Viragana, (see above pp. 44, 51). According to his account its extent is 61 leaves, four or five lines on a page, each line 50 aksh. and in all about 900 alokas. This appears to be the correct Tibetan tradition, a Baba 8. C. Dhe now informs me. They were not brought from Magadha. See Journal, As. Soc. Bengal, Vol. LVII., Part I., p. 41. # Ah is a serpent's fang: in the abridged Petersburg Dictionary, 4.. n It begins according to Peterson-as follows:- pinda nggamani uppdyanesan samjoganappamameyas, and concludes: nijjaraphala sjjhattha visobijattesse.
Page #394
--------------------------------------------------------------------------
________________ 370 THE INDIAN ANTIQUARY [DECEMBER, 1892. It remains for us to give a brief account of those texts quoted as parts of the Siddhanta in the Ratnasagara, and by Rajendra Lala Mitra, and Kasinath Kunte - see pp. 3%, 227 - which do not appear in Buhler's list. In the first place in reference to the jitakalpao2 cited in the Ratnasagara as the sixth chhedasutra and in reference to the gach hayara called ibid. the eighth painnam. Cf. pages 478 and 445.93 [82] The third variation in the Ratnasagara from Buhler's list which we find there has reference to the fourth mulasutram whose place is taken by the oghaniryaktiot and in fact as No. 3. We have already seen (p. 61) from Av. Nijj. 6, 88, that a text of this name ought strictly to be cited there as a constituent part of the text of the Av. Nijj. in P. it is actually cited as such and from the scholia on it and on Uttarajjh. 26, above p. 48, that tradition regards it as an excerpt made by Bhadrabrihusvamin from purva 9, 3, 30. This is confirmed by the introduction of the avachuri to the oghan. We have also seen (p. 357) that this composition cannot be referred to the old Bhadrabahu (+ 170 Vira), since in the introductory verse cited in the Av. 6, so the dasapuvvi, dasapurvin are honored besides the arihamta and the chauddesapavvis. It is quite surprising that this verse also refers especially to the ikkarasamgasuttadharae; a fact diametrically opposed to the tradition just mentioned that regards a part of anga 12 as the source of the ogh. Further on in our present ogh. we find a direct reference in v. 14 to anga 12 : sa mayari dhe nayajjhayanain (anga 6 ?) ditthivad a 1 loiyakappasai anukkama karaga chauro 11 It is, however, sub judice whether or no this verse belonged to the original text. That this was quite a different text from that wbich the present ogh. as an independent work presents, is proved by the fact that the two Avasyaka-MSS. P, which [83] cite it as integral part of the A vasy. nijj. and allot to it but 58 (P.) or 79 (-) verses (cf. above p. 62). The oghanijj. which exists in detached form embraces, according to its last verse, 1,160 gathas: 95 ikkarasehi siehi satthiahiehi samgahiya.96 The contents is stated in yv. 4, 5 to be as follows: vaya (vrata) 6 samanadhamma 10 sahjama " veyavachcham w cha bambhagatti 1 nanaitiyam s tava 12 kohaniggahai 4 charanam eyam 11 11 pim dayishfo7 samiibhavana 12 padima 12 ya indiyaniroho si padilehana 35 guttio , abhiggahi cheva karanam tu 11 6 11 The contents consequently refers to a right name of living; charanakaranatmika is the designation of the oghaniryukti in the introduction of the avachuri on it, and it calls itself at the end (vv. 1156-57) samayari (see above p. 48). The beginning of the avachuri98 contains several accounts in reference to the connection of the text with the Avasyaka, and samayikadhyayana. These accounts are very obscure because 02 Fifth "kalpasutra" in Raj. L. M. and Kash. 03 I add that Jitakalpastram is mentioned by Kielhorn, 1. o. p. 51 and a jitakalpachorpi on p. 17; also in Peterson's Palm leaf 101, where the beginning and the conclusion are given, the total contents being 202 (102) this. It begins siddhisahayiramAyayanibhavadavamayanapadibhalna kamo kiram sira niran virat naniam 10 ahAviram || 1 || vochchham pamchagaparihanipagaranam, -closes: gan eu ll jitakalpastram samaptam. # Fifth chhedasutra in the list of Raj. L. M. and Kash., who says that the contents is "on the duties of Sadhus." 96 The MS. shows but 1,158 and the text belonging to the avachdri has but 1,132 vv. * In the palm-loaf MS. 165 of Peterson those words run: ekkiraahim sehin athahim (!) ahihish sangahiya; the number of verses is stated to the 1,156 (!). 87 A text of this name by Jinavallabhagani appears in the account of Kielhorn, p. 30 (with commentary) 95 and in the list of Peterson's Palm-leaf 86m. 104c. 1774 # Composed by Jnanasigara savat 1439, and belonging to the veitti of Dronicharya. n prakrAmto 'yam Avakyakannyogas, tatra simfyikAdhyayanam Anavartate, tasya chat fry anuygadyfirlini (cf. p. 24): upakramd nikshepo 'nugamo nayah: &dyau dvv uktau, anugamo dvidhi: niryoktyanugamo shtranugamas cha; Adyas tridh&: nikshpl-'podgh Ata-satraspareiniryuktyanugamabbodat (800 pp. 36, 38), strasparsiniryuktyanugamo 'nugato vakshyamanas cha, upodgh&taniryuktyanagamaa tv Abhyfri dykragathAbhy Am anugaritavyah: uddege niddese (see p. 67n1) ity-Adi ...
Page #395
--------------------------------------------------------------------------
________________ DECEMBRR, 1892.] SACRED LITERATURE OF THE JAINS. 371 we do not possess any of the immediate sources whence they are taken. [84] A propos of v. 1 several interesting statements are made concerning the relations of the dasapurvin to the chaturdasapurvin (trayodasapurvinah are said to have never existed). The dasap. are said to be u pakarakah, upa igadi(dinam C)-samgrahanyuparachanena ('nena hetuna C). I have found no other trace of the devavijjiyi, see p. 491 cited in the Ratnasagara as the sixth painpam. The jyotishkaraydam which is the ninth painnam in the Ratnasagara is at least mentioned in the paznna list in Avi, see p. 427. As regards the texts enumerated by Rajendra Lila Mitra and Kabinath Kunte, I refer to pages 392 and 11 for the maha pannavana mentioned by K. K. as the sixth upangam. In both the above authorities we find the second mulasutram called viseshavasyakasutra : and a text of this name exists according to Kielhorn's Report, pp. 36 to 38. In the beginning of Ratnasekhara's commentary on the sraddhapratikramanasutra it is cited as a work of a Jinabhadra (see above p. 70): yad khuh sri Jinabhadragaviksliamasmmapapadah sri viseshavasyake (then two gathas in Prakrit). According to Klatt 2476 and Kielhorn, p. 37 Jinabhadra is merely author of a commentary on this work. A tika by Kotyacharya is cited by Kielhorn, the MS. dating san vat 1138 (A. D. 1082). According to Klatt Kotyacharya is another appellation of Silaj ka, whose commentary on aiga 1, see p. 250 dates A. D. 876. Kielhorn mentions [85] an anonymous commentary on the text itself, which bears the much sought for name sishyahita (see pp. 44, 51, 81). This MS., too, is very old snnvat 119-(?) i.e. dates at least from A. D. 1134. The viseshavasyakam is often cited in the Vicharampitasangraha. According to Kasinath Kunte it contains " a detailed explanation of what is written in the Avasyaka Sutra." The fourth malasutram in the list of Rajendra Lala Mitra, by name pakshikasatran, contains (with some independent additions) the same enumeration of the aigabahira texts, etc., which is found in the Nandi. See p. 10 ff. According to an introduction100 consisting of +yathas it deals in prose especially with the 5 mahav vayas to which as the sixth the raibh yana veramanam is joined. See p. 78. Then follows a metrical discussion of the same subject in 41 (13, 7 and 23) Arya. Thereupon (esa khalu mahavvaya-uchcharani kaya, ichha mo sutta. kittayam kaum) reverential salutations (nama) for the khamasamana by which partly imam vaiya chhavviham kvassayam bhagavatam, partly : imam vaiyam amgabahiram kaliyam, or ukkaliyam, bhagavantam, and partly: imam vaiyar du valasamga ganipidagam. According to Kasinath Kunte the work gives "an account of all what is to done by the Sadhus in every fortnight." Perhaps the name is derived from the fact that it is to be recited every fortnight. [80] The work stated to be the third member in the group of Kalpasutras and which has the specific title Kalpastram is, according to the statements in Kas. the text which clains this title kar' deoxhv. It appears as the dasad section of the fourth chhedasutra. The first three members of the group of "Chhedasutras" in Raj. L. M. cf. p. 227: -- the brihat-, laghu- and madhyama-vachana of the mahanisitha, are stated by Kasinath to "treat of the penances to be performed by the Sadhus in a detailed, abridged and middling mauner respectively." I have not found any other nuention of this work. The sixth member of the same group paryushankalpa, contains, according to Kisiuath: "directions as to the manner of observing fasts and hearing the Kalpa Sutra from the twelfth day of Bhadon (Bhadrapada] Badi (dark fortnight)" to the 4th or 5th day of Bhadon Sudi (lunar, i. e. light, fortnight)." Is this the paryushanikalpanijjutti in 66 arya belonging to the 14. The first verao: tittha kare atitthe atitthasiddhe ya titthasidde ya.. vaihdami || 1 || glorifies strangely enough the atirtha, or atirthasiddha too. According to an avachuri on it this refers to the dharmavyavachheda "Suvidhiprabhpitinan tirthakrit&ri saptasv artareshu," see p. 211 fg. 242, 318. 1 brutotkirtanan in the avachuri, perhaps sutakio a badi, bahuladina, as sudi, instead of Sudi, buddhadica (or bukiadinu). See my treatise on the Ktiehra. janmashtami p. 380n.
Page #396
--------------------------------------------------------------------------
________________ 372 THE INDIAN ANTIQUARY. [DECEMBER, 1892. third part of "Kalpanatra" (Jacobi, pp. 86-95) ? This paryush. was commented on (see p. 476) by Jinaprabha at the end of his sandehavishaushadbi. See p. 82 on aughaniryukti and pp. 427, 429 on maranasamadhi. I give in conclusion a list of the texts which are either found in the Siddhanta itself (1-29), or are mentioned elsewhere (30 fg.) as belonging to the Siddl bnt which at present are no longer extant, at least as independent texts. [87] 1. divasagarapannatti, anga 3, 3, 1, 6, 1, see pp. 268, 389, also in the painna list in Avi, see pp. 427, 429 (where there is but one samgahani on it). 2. kammavivagadasau, ten ajjhayanas, aiga 3, 10,6 see p. 270 ; cf. Nos. 7, 10. 3. bamdhadasau, ten ajjh., anga 3, 10, see p. 278. 4. ddgiddhidasau, ten ajjh., ibid. 5. dihadasau, ten ajjh., ibid. (cf. up. 8-12). 6. samkheviyadasau, ibid., ten ajjh. viz. : - 1. khuddiya vimanapavibhatti, 3. mahalliya vim., 3. amgachaliya, 4. vaggachaliya, s vivahachaliya, 6. Aronovavad, 7. Varanovavie (Dhao), 8. Garulovavae, . Velamdharovavae, 10. Vesamanovavae. All these titles recor in essentially the same order in the Nandi among the anamgapavittha text, groap kaliya ; see pp. 13, 14. In the karikas quoted on pr. 223, 224 we find the statement that 1-5 belong to the fifth, and 6-10 to the twelfth year of study. 7. kammavivagajjhayana, anga 4, 48, see p. 280; cf. Nos. 2, 10. 8. isibhasiya devalogachayabhasiya, 44 ajjh., anga 4, 44; the isibhAsiyain also in the Nandi in the list of anamgapavitha texte ; see pp. 280, 250, 273, 403, 410, 483, 49, above pp. 13, 57, 58; on rishibhashita see also p. 446 8. 9. dovalogachuyabhasiye, see just above and also p. 280. [88] 10. pa vaphalavivagaim, 55 ajjh., Kalpas. Jinach. $ 147, see p. 474 ; cf. Nos. 2, 7. 11. mahakappam, Avasy. 8, 55, as first chheasattam, see pp. 46, 40; in the Nandi among the anamgapavitha texts, see p. 11 (mahakappasuam). 12. kappiyukappiam, N among the anamgap., p. 11. 13. chullakappasuam, ib., p. 11. 14. mahapannavana, ib., pp. 11, 84 ; see p. 392. 15. pamayappamayam, ib., p. 11. 16. porisimamdalam, ib., p. 12. 17. mandalappavesd, ib. 18. vijjacharanavipichchhad, ib. 19. jhanavibhatti, ib., and in the Vidhiprapa among the paznna, see p. 438. 20. maranavibhatti, in N among the anangap., p. 12. 21. dyavisohi, ib. 22. viyarayasuam, ib. 23. samle hanasuam, ib. 24. viharakapp, ib. 25. cbaranavihi, ib. * We Poss8088 Boveral texta on kammavivaga, thus 107 Prakrit-gath As by Jinavallabha in Peterson's Palm-leal 42 f.; also 168 ditto by Garga ibid. No. 52, 816,- and, without the name of the authors, Nos. 885, 106, 1610. There is a bAlavabodha on it by Matichandra, see Kielhorn p. 98. yaradasdu mentioned there are identical with chhednautrs 4. 1 The aputthavAgarapkin in 86 ajjh, mentioned ibid. are doubtless identical with malaantra 1. see p. 43.
Page #397
--------------------------------------------------------------------------
________________ DECEMBER, 1892.] SACRED LITERATURE OF THE JAINS. 26. devimdovavae, in N among the anamgap., p. 14. 27. utthanasuam, ib.; utthanasuyaiya chauro in the karikas quoted p. 224 as the subject of the study of the thirteenth year. 28. samutthapasue, p, 14. 29. nagapariyavaliyao, ib. 30. asivisabhavanao in the Pakshikasutra and the three simichari texte, ib.; in the karikas cited p. 214 as designed for the fourteenth year. [89] 31. ditthivisabhavanao, ib., for the 15th year. 32. charanabhavanao (chiranasamanabh), ib., 16th year. 33. mahasuviga (sumina)bhavanao, ib., 17th year. 378 34. teaganisaggi, ib., 18th year. According to Vidhiprapa title of the 15th book in anga 5, see p. 301, 35. maranavisohi, in Vidhiprapa among the anamgap., see p. 12. 36. rahanapadaga, in the paiuna list in Avi., see p. 427, 37. amgavijja, ib. 38. joisakaramdam, ib., and in the painna list of the Ratnasagara, see p. 41; cf. p. 84. 39. maranasamahi, in the painna list in Avi. and in Raj. L. M., see p. 427; p. 86. 40. titthogali, in the painna list in Avi., see p. 437. 41. narayavibhatti, ib. 42. devavijjiya, in the painna list of the Ratnasagara, see p. 431; cf. p. 84. Corresponding to the number of the 46 agamas which exist or are recognized as parts of the Siddhanta, we have 42 texts which are at present not extant. If we add panchakalpa and the two special vachanas of the mahanisiha, and if we count singly the ten titles comprised in No. 6 (as is always the case in anga 3 and elsewhere) then the number of the texts no longer extant [90] is eight greater than the number of those in existence. It must, however, be confessed that the ten pieces collected in No. 6 are very brief in compass, since they are each counted as one ajjhayanam; and the same may be the case as regards others of the texts now no longer extant. Nevertheless in the Siddhanta there are short texts and among the angas there is one and that is not small (anga 4) which has but a single ajjh. - If we take into consideration the conclusions which we were obliged to adopt in regard to the loss of the mahaparinna chapter in anga 1, in regard to the changes which angas 5, 7-11, up. 8-12 are proved to have undergone, and in regard to the total loss of anga 12 etc., etc. it is at once evident that great uncertainty reigns in this department of Indian literature, despite its seemingly firm articulation. The beginning of our knowledge is here contemporary with the beginning of our doubts. One fact is of cardinal importance: Nos. 6, 27, 30-34 of the above list existed at the date of the karikas cited on p. 224, and formed an integral part of the sacred study. The portion of the extant Siddhanta that is mentioned in p. 224 besides these is but trifling in comparison. The ultimate significance of this last assertion cannot, however, be seen at the present day. Cf. p. 225. In conclusion, I desire to extend my most hearty thanks to Dr. E. Leumann for the generous assistance he has rendered in reading the proof of this treatise. This assistance comprises very numerous corrections made on the basis of MSS. and printed matter which were not accessible to me. I have also used to great advantage Kielhorn's Report and especially Peterson's Detailed Report. The siddhapahudapannam ib. belongs to anga 12, see pp. 355, 361. In Kielhorn's report p. 94 there is mention made of a panchakalpasutrachurni by Amradevicharya. See p. 477.
Page #398
--------------------------------------------------------------------------
________________ 374 THE INDIAN ANTIQUARY. [DECEMBER, 1892 FOLKLORE IN SALSETTE. BY GEO. FR. D'PENHA. No. 13.-The Ill-treated Daughter-in-law. There once lived an old woman with her son and his wife, and after a few years of married life the wife became pregnant. The old woman's son, about this time, fitted out a ship to go to another country, but before going he asked his mother to take care of his wife as she was pregnant, and said : -"Mdla solera hoil te manje tarvavar soni achd paniin parel, ani sokori neil te rupiachd paniin parel; If a son be born to me a shower of gold will fall on my ship. but if a daughter then there will be a shower of silver." Then bidding farewell to his wife and mother he went away. After a few months had passed the wife felt her time of delivery approaching, and so she asked her mother-in-law if she might take her cot into the sleeping-room (lambra), but the old woman objected, saying: - "Kambra hai to devan dharmachd ; The sleeping-room belongs to the gods and religious rites." Then the daughter-in-law asked if she might place it in the hall (sd), and the mother-in. law again objected, saying: -"Sal hai te ulta baisuvchan ;1 The hall is meant for people. to sit in." Upon this the daughter-in-law asked if she might place her cot in the verandah (onta), and for the third time the old woman objected, saying: -"Onta hai to etiaizdtiuncha;' The verandah is mennt for passers-by to rest themselves." The poor daughter-in-law saw that there was no place in the house to be spared for her confinement, and at length resorted to a jungle, and there, under a mango-tree, was delivered of & boy. She left the child under the tree and went home, occasionally going back to give suck to the child. On the day the boy was born a shower of gold fell on his father's ship, upon which he distributed sugar to the crew and returned home. His mother, however, told him tales against his wife, and shewed him an Oronta (spice-grinding-stone), saying she had given birth to that stone! The husband's anger was roused against his wife, but he saw that he could do nothing and kept quiet. A few more years passed and the wife was again pregnant. This time also her husband proceeded on a voyage. He again asked his mother to take care of his wife, which, of course she promised to do; and saying: "Mala sokra hoil te manje tarudvar soniacha paniin parel. ani sokri hsil ti ripiacha panin parel; If a son be born to me there will fall on my ship a shower. of gold, but if a danghter is born there will be a shower of silvor," he went away. Some montlis after, when the time of her labour commenced, the wife ngain asked her mother-in-law if she might use the sleeping-room, but she met with the same objection as before : - "Kambra hdi ti devin dharmacha; The sleeping-room belongs to the gods and religious rites." She then asked for the use of the hall, bat again came the objection : -"Sal hdi te uta baisavchann; The hall is meant for people to sit in." Then the ase of the verandah was asked for, and again the old woman said: -" Onta hai 8 Stian zatiancha; The verandah is meant for such as come and go." The poor woman, for the second time, was refused a place for her confinement, and again went into the jungle and was delivered under a kazu troe (catchu-nut tree), where she left the child and went home, occasionally going back to the tree to suckle it. For the second time there fell a shower of gold on her husband's ship, and, again distributing sugar to the crew, he returned home with great joy; but only to be disappointed, for the old woman again told him a lot of 1 Literally, the hall is for rising and sitting.' Literally, the verandah is for such as come and go.'
Page #399
--------------------------------------------------------------------------
________________ DECEMBER, 1892.] FOLKLORE IN SALSETTE; No. 13. 875 tales, and produced a bovatra (Goa broom), saying that his wife had given birth to it! The husband was very much incensed against his wife, but cooled his ire, and had patience with her. Wben a few more years bad passed his wife again became pregnant, and for the third time her husband went on a voyage, leaving his wife to the care of his mother, who promised all care and to take every precaution that would ensure a successful delivery. Before he went away, he said : -" Mula sokra hoil te manje taroarar soniacha paniin parel, ani sokri hoil te rupiacha panin parel; Should a son be born to me there will fall on my ship a shower of gold, but if a danghter hen a shower of silver." Now in due time the wife felt her time approaching, and, therefore, asked her mother in-law if she might use the sleeping apartment, but she only got the same old answer: - "Kambri hai te devan dharmacha; The sleeping-room is assigned to the gods and religious rites." So also when she asked for a place in the hall, she was told :-"Sal hai le utja baisavchan ; The hall is meant for people to sit in." She now pleaded for the verandah, but was put off by the same answer: - "Oud hai to etian satiancha; The verandah is meant for passers-by." The poor woman saw no alternative, but had again to resort to the jungle, and was delivered this time of a daughter, ander a tamarind tree (chinch). After her delivery she left the child there and went home, occasionally going back to suckle it. Her husband witnessed a heavy shower of silver, and, after again distributing sugar to the crew, returned home; bot only to be disappointed for the third time, for he was now shown a movall (date-palm broom). Now, this time the old woman told him so many tales that he was mad with rage. She told him to get rid of his wife, and said she would get him married to another. Her son believed every word that was told him, and having chastised his wife most brutally, went and hanged her on an or tree (Ficus religiosa), and left her there a long time. Fortunately for her, however, there passed that way some gouhlas (onw-herds) who felt deeply for her, and thought within themselves : - "Bicharisin ka gunia kelei kon sine : pun apin sorvin tila; What offence the poor woman may have committed, who can say? But we will, nevertheless, set her free." So they get her free, and went their way to graze their cattle. She now went and fetched together her children. The two boys were pretty well advanced in years, and the girl had made wonderful progress in her growth. So they built a hut, and lived in it. The old woman, in the meanwhile, made arrangements for getting her son married to another girl, and on the appointed day our hero was dressed ap ready to go to the Church. But his former wife, who came to know that her husband was about to go to Church to be married to some one else, called to her children and taught them to say: Ambia birchid ambaya dada, kazu burchia kaziiya dadd, chinche burche salop baye, lal topivdla dmcha bap, orovar tanglei amchi ai, dharam kar go kausalne dje; Brother Mango from under the mango tree; Brother Catchu-nut from under the catcho-nut tree; Sister Salop from under the tamarind tree; the man with the red hat is our father, our mother is hanging on the banian tree; give alms, oh tale-telling grandmother!" When they were able to repeat this by heart, she told them to go and say it near their father's house. The children went and standing before the house repeated what their mother had taught them. Their father, who had never seen them before, was taken by their faces, and, as he did not understand what they had said, he told them to repeat it again, upon which they said : Ambia burchia ambaya dada, kasu burchid kuzayd dddd, chinche burche salop baye, lai topivdla Amcha bap, Ordvar tanglei amchi ai, dharam kar go kausalne aje ; Brother Mango from under
Page #400
--------------------------------------------------------------------------
________________ 876 THE INDIAN ANTIQUARY. [DECEMBER, 1892. the mango tree; Brother Catchu-nut from under the catchu-nut tree; Sister Salop from under the tamarind tree; the man with the red hat is our father; our mother is hanging on the banian tree; give alms, oh tale-telling grandmother!" Their father called to his mother and told her to give them some ore. She came out, but, suspecting who the children were, refused to give them anything. Their father, however, himself went to the cook-house, and fetched some ore and gave them to the children. He then made them repeat what they said over and over again several times. At last he thought there must be some meaning attached to what they said, and asked them where they had learnt it. The children told him that their mother had taught them. Upon this he told them to call their mother (his own wife), and when she came in his presence, he asked her whose children they were that were standing before them, and she said: "These children are yours and mine." When she said this, he told her to explain what it all meant. She then told him all: - How she had been prevented from being delivered in the house on the plea that "kambra hdi to davas dharmacha, the sleeping-room belongs to the gods and religious rites : sal hdi te. uta baisavchann, the hall is meant for sitting in : Onga hdi to etian zatiancha, the verandah belongs to Passers by ;" and how she haul resorted to the jungle, where she was delivered first of a boy under a mango tree, a second time of another boy under a catcha-put tree, and the third time of a girl under a tamarind tree; and how each time she was wont to go home leaving the children thero, occasionally going to thein to give them milk; and how his mother, whenever he came home, shewed him first an oronia (spice-grinding-stone), secondly a bovatra (Goa broom), and thirdly a movali (date-palm broom); and how, not content with these tricks, she had told him a great many tales. Upon this he embraced his wife and children, and asked her why she did not tell him all this long ago, even at the risk of her life. Then in a rage he took hold of his mothor, out her into three pieces, and hung the piocas up on three roads. After this he lived happily with his wife and children, MISCELLANEA. TIBETAN FOLKLORE. destroy these. But otherwise the cat is consi. 1.-Cats. dered to be the most sinful being on earth, on acoount of its constant desire for taking life, even The Cat is trented by Tibetans with the when gorged with food, and ite torture of its most marked attention and forbearance. victims. Its mild treatment is due to the Even when it spills milk, breaks or destroys any belief that whoever causes the death of & valaable object or kills some pet bird, it is never cat, whether accidentally or otherwise, will whipped or beaten in any way, but merely chid, have the sins of the cat transferred to his and gently driven away by the voice : - while shoulders. And so great is the burden of its were a dog or child to commit these offences they sins that even were one sfr (2 lbs.) of butter for would be soundly thrashed. each hair on the cat's body offered in feeding the Sachvery mild and considerate treatment temple lamps before Buddha's image, the crime might load one to suppose that the cat is esteemed would not be expiated. Hence ever would not be expiated. Hence everyone is most holy. But such is not the case. It is indeed careful to avoid incurring this calamity. And regarded as a useful animal to the extent that it when a cat dies its body is carried outside the contributes to the preservation of sacred pictures, village and deposited, if possible, at a place wbere robes, books, and sacrificinl food and the like, by killing the rate and mice which consume and L. A. WADDELL. * The process of making these lind (singular 8rd) is similar to making pus (nee ante, p. 143). But while pers are made in the shape of ordinary band-bread, or are made by putting lampe of wheaten dongh, thicker than that peed for pau, foto hofling oil. Ord are generally made on concions of weddings and feasta. * [This story is viablo sbewing where the necond part of the extraordinary story of Bapkhlat (ante, p. 148 f.) comes from Ep.1
Page #401
--------------------------------------------------------------------------
________________ DECEMBER, 1892.) ARCHAEOLOGICAL TOUR THROUGH RAMANNADESA. 377 NOTES ON AN ARCHAEOLOGICAL TOUR THROUGH RAMANNADESA (THE TALAING COUNTRY OF BURMA). BY TAW SEIN-KO. TINDER instructions from the Government of Burma, I left Rangoon for Moulmein on the 5th December, 1891. As it was my intention to explore the whole of the country, which constituted the ancient Talaing kingdom of Ramannadasa, with special reference to the elucidation of the history of the places mentioned in the Kalyani Inscriptions, I went down to Amherst by boat and returned to Moulmein by land, and the notes now published are those that I was enabled to make by the way. The Mun or Talaing language is still spoken in the villages between Amherst and Moulmein, and is stiil taaght in the monastic schools there ; but, owing to there being no Government grants-in-aid given for the encouragement of its study, it is not taught in the lay schools. The Talaing language has a unique literature of its own; numbers of inscriptions are recorded in it; and certain questions relating to the ethnography, history, antiquities, and languages of the peoples inhabiting Burma are awaiting solution, because the Talaing literature is still a terra incognita. Considering that the study of the insignificant dialects of the Karen language, which has no indigenous literature, and whose alphabet was invented by Doctor Wade, an American Missionary, in 1832, receives considerable encouragement, it would be well if the Education Department could see its way to recognize Talaing in the curriculum of studies for indigenous schools in those parts of the Tavoy, Amherst, Shwegyin, and Pega districta, where it is still spoken and studied. This measure would, no doubt, be pleasing to the Talaings, and would be a token of gracions, althongh late, recognition of the services rendered by their fellow-countrymen to the British in the first and second Burmese Wars.1 About 20 miles from Amherst is WAgar, originally founded by King Wagaru near the close of the 13th Century, A. D. The site of the old city is now completely covered with jungle; but traces of its walls and moat still exist. It is said that its walls were of laterite, and that images of the same material existed in its vicinity. But I saw neither the walls nor the images ; apparently the laterite walls have served as road-metal for the contractors of the Public Works Department, and the images are hidden by jungle. I am not sure whether any excavations carried out at Wagaru would bring to light any inscriptions or objects of archeological interest, On the 11th December, Pagat was visited. There are caves of great historical interest in its neighbourhood. Pagat is the birth-place of Wagar, who restored the Talaing monarchy after Ramannadesa had been subject to Burmese rule for over two centuries, and is full of historical associations. It was here that Dala ban, the . Hereward the Wake' of the Talaings, utilized the strategic position of the place, and for long defied the Burmese foroes of (Alaungp'aya) Alompra's son and immediate successor, Naungdogyi." The caves are natural openings in hills of submarine limestone rock. Some of them are over 1,000 feet in height and have precipitous sides. It is reported that large boxes of Talaing palm-leaf manuscripts, which were originally hidden by patriotic Talaings to escapo destruction from the ruthless hands of the Burmese conquerore, are decaying in the sequestered parts of these caves. [I fully endorse this plea for the preservation of the Taming language. It is rapidly disappearing before Burmese, and it is pitiable to note the absolute ignorange of many Talnings of their distinotive language. But historically it is quite a valuable an Burmese, if not more so. It is not desirable, speaking practically, to revive Talaing, but academically its preservation would be invaluable and obair in the Rangoon College might well be devoted to Talking and its epigraphy and literature.--Ed.] id=a in Italian cosa. w in 'law. * Subsequently, I learnt from a priest of the Mahdyin kyaung (monastery) at Kado, that complete sets of Talaing manuscripts are being preserved in the Royal Libraries at Bangkok. It would be a good thing to obtain set for the Bernard Free Library at Rangoon. Perhaps the British Consul could be moved to prefer a request to
Page #402
--------------------------------------------------------------------------
________________ 378 THE INDIAN ANTIQUARY. (DECEMBER, 1892. There are now few persons, who can read and understand these manuscripts; but, whenever they shall have been interpreted by a trained scholar, they will throw a flood of light on Talaing history, and on the history of learned, religious, and comme cial relations between Ramannadesa, Ceylon, and Southern India. They will also solve certain questions connected with Papi and Sanskrit philology and literature. Owing to want of time only two caves, namely, the Kogun and Pagat, could be visited. The former presents a splendid sight. Its precipitous side facing the Kogun village is completely covered by painted terra cotta tablets arranged symmetrically in the form of terraces and spires. Inside the cave are lying images of various sizes in different stages of decay and ruin. They are found to be made of the following substances : lead, brass, wood, stone, brick, and lacquerware. The majority of them bespeak their antiquity, as they differ from modern ones in the following particulars the head is surmounted by a spiral truncated cone cepresenting the Buddhist nimbus ; the bristles of the hair are represented; the ears do not touch the shoulders; the forehead is prominent, but remarkably narrow; the eyebrows, eyes, and lips are the most prominent features of the face; the body is short and stort and the head is disproportionately big; the limbs are full and large; the sole of the right foot is not displayed. No history is known to exist about the caves of this neighbourhood ; nor is there any person, layman or priest, who can relate anything historically true about them. But, judging from the fact that Ramannadesa was subject to Cambodian rule from the 6th to the 10th century A. D., and again to Siamese rale in the 14th century, it may be safely inferred that most of the images are of Cambodian or Siamese origin. The general architectural effect of the cave, and the resemblance of these images to those of Siam, favour this view. A closer examination in detail, however, might reveal the fact that some of the images were dedicated to Brahmanical worship, which was favoured by the ancient Kings of Cambodia, that others are of Sinhalese or Dravidian origin, and that there is some relationship, historical, religious, and architectural, between the caves in the Amherst district and the cave temples of Cambodia and India. I brought away three small wooden images with legends, now illegible, but conjectured to be in the Siamese characters inscribed on their pedestals. (See plate.) The Pagat Cave was next visited. It contains nothing of interest. It is now the home of bats, whose dung yields an annua. revenue of Rs. 600. It would appear that the contents of this cave have been made away with in order to make room for the more valuable dung! Near this cave is a monastery, now occupied by a priest from Upper Burma. Since the annexation of that province to the British Crown, numbers of Buddhist priests from it have settled down in this district. Owing to their reputed learning and their conversational powers, they are highly esteemed and are abundantly supplied with the necessaries of life. The Talaing priests are, as a rule, somewhat lax in their observance of strict precepte : e. 9., they are possessed of boats and landed estates, drive about in bullock-carts, drink tes in the evenings, and smoke cigars in public! Such conduct is now being followed by the priests from Upper Burma, who appear to be imbued with the truth of the proverb: "At Rome, do as Rome does." The burden of supporting the priests, who do very little in return for their maintenance, and who idle away most of their time, because the educational work is better and more efficiently done by the lay schools, is in the Talaing Conntry indeed a heavy one. On an average about 100 houses support a kyaung, and every village that has any pretence to piety must have a loyaung of its own. The standard of material cozofort of the villagers, this effect to His Siamese Majesty. The late Dr. Forchhammer succeeded in proouring number of ancient Talaing manuscripts from the caves in the neighbourhood of Pagat. I understand some of them, if not all, are now lying in the Bernard Free Library. [The Chief Commissioner, Barmah, has addressed the British Constal at Bangkok on the subject.-ED.]
Page #403
--------------------------------------------------------------------------
________________ Indian Antiquary. INSCRIBED WOODEN IMAGES FROM THE KOGUN CAVE. is Taw Bela ko. Photo inco, 8 1. O. Calcutta Scale625. Be Na Major R. Temple.-J4D 83.-506.
Page #404
--------------------------------------------------------------------------
Page #405
--------------------------------------------------------------------------
________________ DECEMBER, 1892.] ARCHEOLOGICAL TOUR THROUGH RAMANNADESA. 879 who maintain the kyaung, may be a low one, but the pongyi in charge of the kyaung is fed on the fat of the land. On the 14th December, I visited Kokarok, which is inhabited by Burmans, Talaings, Shans, Karens, and Taungous. The Taungous are an interesting people. They have a literatures of their own, and I obtained a copy of a poetical work called Suttanippan (Suttanibbana or Nibbunasutta). The language of the Taungoas contains words bodily borrowed from the languages of the peoples by whom they are surrounded. The Taungous resemble their congeners, the Karens, in physical appearance; their build is thick-set, and they have full, round, and heavy features. At Kokarek the Taungou language is purer than at Thaton, although there have been many inter-marriages between the Taungous and the Shans. The meaning of the word "Taunga' is Highlander, in contradistinction to the people of the lowlands. A similar distinction obtains in Cambodia, the ancient Kingdom of the Khmers.7 The latter M. Mouhot describes thus: "Having a great taste for music, and being gifted with ears excessively fine, with them originated the tam-tam, so prized among the neighbouring nations; and by uniting its sounds to those of a large drum, they obtain music tolerably harmonious. The art of writing is unknown to them; and as they necessarily lead a wandering life, they seem to have lost nearly all traditions of the past. The only information I could extract from their oldest chief was, that far beyond the chain of mountains which crosses the country from north to south, are other people of the high country (such is the name they give themselves; that of savage wounds them greatly), that they have many relations there, and they even cite names of villages or hamlets as far as the provinces occupied by the Annamite invaders. Their practice is to bury their dead." The above description would, with slight modifications and with the exception of the part relating to their ignorance of the art of writing, answer very well for that of the Taungus. The Taungous call themselves Phao, i. e., ancient fathers, and have a tradition that large numbers of them emigrated years ago from their original seat of Thaton to a State of the same name in the Shan country. Since then they have borrowed largely from Shan literature: in fact, their books, most of which have been translated from Shan, contain a large admixture of Shan words." The Taunga alphabet appears to have a closer affinity to that of the Talaings or the Burmans than to that of the Shans, as it recognises the medial letters, which are absent in Shan. The one peculiarity deserving of notice in the pronunciation of the letters is the Indian sound accorded to the letters of the palatal class, e.g., is pronounced ch and not s, as the Tibetans, Burmans, and Talaings pronounce. This is a remarkable fact showing the probability of the Taung as having received their alphabet direct from Indian colonists.10 5" My authority for this is the following extract of a note from a gentleman of the American Mission to Lieutenant Newmarch : "The Toungthoos have a written language and books, and kyoungs and priests. I have seen their books, and on the fall of Sebastopol I printed the Governor-General's proclamation for Lieutenant Burn in Toungthoo, but I confess it was the first and only thing that was ever printed in Toungthoo."-Yale's Mission to Ava, Appendix M., page 383. [This is now in the British Museum. Dr. Cushing informs me that Taunga MSS. are frequently to be met with in Shan monasteries, and that the commonest text of all is the Suttanippan.-ED.] | Vide Mouhot's Travels in the Central Parts of Indo-China, Cambodia, and Laos, page 24. Savages to the East of Cambodia, called by the Cambodians their elder brothers. [Dr. Cushing informs me that the Taunga Language is closely related to that of the Pgho Karens and that a Taunga can easily learn to make himself intelligible to a Pgho Karen in a short time.-ED.] 10 [It may some day help much in determining the original sound of many Burmese words, which, no doubt have, in historical times, changed their sounds.-ED.]
Page #406
--------------------------------------------------------------------------
________________ 380 THE INDIAN ANTIQUARY. (DECEMBER, 1892. The Taungu language, as evidenced by the oomparative vocabulary shown below, has closer affinity to Burmese than to Shan or Talaing : Taung80. Burmese Meaning One. Ta-pall ... Ni-pa Son-pa Lit-pa Ngat-pa Su-pa ... Niv-pa Sot-pa Kut-pa ... Tachi: 12 ... Mi: 13 Ta, tit ... Hna, hnit bon: 14 ... Le: ... Nga : ... Chauk ... Khuhnit... Shit ... K : Taselt ... Ne La Kud' Pha Mi La ... Two. Three. Four. Five. Six. Seven. Eight. Nino. Ten. Sun. La Cha Pha Me: L6 Moon. Star. Father. Mother. Man. ... ... ... . ... ... On the 28th, I started for Thaton and reached it on the same day. Daton, as the name spelt Thaton, Thahtun, and Thatone, is pronounced, has been identified by Burmese and Talaing writers as the Suvannabhumi of the Buddhist books, and the Aurea Regio of Ptolemy and others. It is bounded on the east by the Dinganek Range, which is about 12 miles long, and trends from north to south. On the west is an immense rice plain, which is about 15 miles in breadth, and beyond that is the sea. In the rainy season the plain is covered by water and navigation over it by boat is possible. According to a Talaing tradition, Thaton was founded by Sharaja, a contemporary of Gautama Buddha. In choosing the site of the new city he consulted his foster-father, the Rishi of Zingyaik, and was advised to select & spot where gold was found, and to which & large population would be attracted in a short time. The spot where the Jubilee Memorial Fountain, erected in 1888, is now playing, is still pointed out as the site of the palace of Siharaja and Mannha, the first and last kings of Thaton. Close by is the gold-bearing stream of the Shw@gyaung San, which is perennial and issues from the Dinganek (Singanika) Hill. Gold is still worked by isolated individuals at the beginning and close of the rainy season, but the quantities obtained are not commensurate with the amount of labour involved. There are five Talaing inscriptions at Thaton : four in the enclosure of the Shwezayan Pagoda, and the remaining one ander a banyan tree at Nyaungwaing. Their paliography indicates that their age is about 400 years. Three brick buildings near the Shweziyan Pagoda are known as the libraries, whence Andratazo, King of Pagan, is said to have removed the "five elephant-loads of Buddhist scriptures" in 1057 A. D. 11 Pa denotes an individual unit. Ita cognate form, pronounced with the heavy tone, is employed ma numeral co-efficient in Burmese. 13 Ch in Tannga in interchangeable with in Burmese. 13 This word means fire in Burmese; but the primitive conception of the sun as the source of heal' may, bare possibly existed. 14 The sign & denotes that the syllable to which it is affixed should be pronounced with the heavy tone. 15 d as ai in pair.' 16 Ky =ch in Burmese as often as not.
Page #407
--------------------------------------------------------------------------
________________ DECEMBER, 1892.) ARCHAEOLOGICAL TOUR THROUGH RAMANNADESA. 381 Terra cotta tablets, inserted in niches in the Dagyapay& (pagoda) within the same enclosure are of considerable interest. Most of them have been destroyed, and the meaning of the representations is not accurately understood. But they appear to indicate that the people, whoever they were, who constracted these tablets, undoubtedly professed Brahmanism or Hinduism, and that they had attained to some degree of civilization. Siva with his trident is the predominant figure; conveyances are drawn by single ponies, and women wear their hair in big knots at the back of the head. The features of the persons represented are of Mongolian cast, and resemble those of the Karens and Taangus of the present day.17 The Dagyap'aya, in common with other sacred edifices built by the Talaings, is constructed of hewn laterite ; and the existence of several tanks in its vicinity indicates the source whence this building material was obtained. There are three sculptures in bas-relief on stone, representing Vaishnava symbols, lying in the enclosure of the Assistant Commissioner's Court-house. These have been removed to the Phayre Museum at Rangoon.18 Nat (i.e. spirit) worship is still, as in other parts of Burma, one of the prevailing forms of belief at Thaton. I visited the temple of the Nat called Pho-pho=Grandfather. Tradition, which is, in this case, prima facie palpably false, says that, when this Nat was a human being, he was charged by Sona and Uttara, the Buddhist missionaries who visited Ramannadesa in the third century B.C., to safeguard Thaton against the attacks of the biliis or ogres. The image of Pho-pho represents an old man of about 60 years of age, sitting cross-legged, with a white fillet round the head, and a moustache and pointed beard. The forehead is broad and the face bears an intelligent expression. The upper portion of the body is nude, and the lower is dressed in a chek paso, or loin-cloth, of the zigzag pattern so much prized by the people of Burma. The right hand rests on the right knee, and the left is in the act of counting the beads of a rosary. The height of the figure is about five feet. In the apartment on the left of Pho-pho is an image representing & benign-looking wun, or governor, in full official dress. Facing the second image in a separate apartment is the representation of a wild, fierce-looking 16, or military officer, in uniform. The fourth apartment on the left of the bo is dedicated to a female nat, who is presumably the wife of Pho-pho. But there is no image representing her. It is a noteworthy fact that, as it would be if in India and Ceylon, this temple is held in veneration by various nationalities professing different creeds. The images of the nats are in a good state of preservation, as they are in the custody of a medium, who gains a comfortable livelihood thereby. An annual festival, which is largely attended, is held in their honour. These nats are to my mind clearly an embodiment of hero-worship, representing some benevolent and sympathetic Burmese governor and his relatives, who left behind them a kindly memory.19 On the 31st December, I visited the Kokb@nnayon Hill, which is about eight miles to the west of Bilin. On the top of the hill are two images representing the Buddhist missionaries, sona and Uttara, 'in a recumbent posture and with their hands clasped towards a stone vessel placed between them. The vessel is reputed to contain a hair of Gaatama Buddha. Around Sona and Uttara are the figures of yahandas, or Buddhist saints, with full, round, and heavy features. The foreheads of these figures are broad and prominent, but retreating; the nose is big and long; and the month large. At the four corners of the platform on the top of the hill, are figures of a strange monster, half man, half beast, called, by a false Palicism, Manussiha. 17 A description of these tablets is given at pages 716 and 717 of the British Burma Gazetteer, Vol. II. [I do not personally quite agree with the statements in the text and will endeavour to show, in paper now preparing for publiontion in this Journal, that all the Thaton soulptures are quite compatible with the Buddhist onlt.--Ep.1 [Though of a most interesting Indian character, it is probably yet premature to state their precise nature.-ED.). 1 [I may note that, when I was in Thaton, I was told that they represent a Portuguese governor and his staff, and that they are consulted before entering on any kind of project. If they smile the project will supoeed. -ED.]
Page #408
--------------------------------------------------------------------------
________________ 382 THE INDIAN ANTIQUARY. [DECEMBER, 1892. There is no such Pali word, but the term has been coined to designate a monster with one human head and two lions' bodies. The origin of the manussiha is thus recorded in the Kalyani Inscriptions - "The town (G6lamattikanagara the modern Ayetbema in the Shwgyin district) was situated on the sea-shore ; and there was a rakkhasi, who lived in the sea, and was in the habit of always seizing and devouring every child that was born in the king's palace. On the very night of the arrival of the two theras, the chief queen of the king gave birth to a child. The rakkhasi, knowing that a child had been born in the king's palace, came towards the town, surrounded by 500 other rakkhasas, with the object of devoaring it. When the people saw the rakk hasi, they were stricken with terror, and raised a loud cry. The two theras, perceiving that the rakkhase and her attendants had assumed the exceedingly frightful appearance of lions, each with one bead and two bodies, created by means of their supernatural power) monsters of similar appearance, but twice the number of those accompanying the rakkhast, and these monsters chased the rakkhasas and obstructed their further progress. When the pisdchas saw. twice their own number of monsters created by the sapernatural power of the two theras, they cried out: Now we shall become their prey, and being stricken with terror, fled towards the sea." Fergusson, in his History of Indian and Eastern Architecture (page 622), makes the following pertinent remarks on the origin of this monster: "This illustration (of the Shwedagon Pagoda at Rangoon) is also valuable as showing the last lineal descendant of these great haman-headed winged lions that once adorned the portals of the palaces at Nineveh ; but after nearly 3,000 years of wandering and ill-treatment have degenerated into these wretched caricatures of their former selves."0 In an image-house at the foot of the hill is a brass bell on which the old Talaing inscription has beon effaced, and a modern Burmese one engraved. It is, perhaps, hopeless to recover a copy of the ancient inscription. On the 1st January 1892, I visited the Tigaung Pagoda at Zokthok village, which is about 6 miles to the north of Bilin. The basement of the pagoda is constructed of blocks of laterite, each about 2 feet by 1} feet by 1 foot in dimension. Some of the images, as well as the receptacles for offerings, &c., placed around it are of the same material, and bear traces of ornamentation. In the neighbourhood are sculptures in relief engraved on large laterite blocks, which are so arranged as to form pagels on the face of a wall or rampart of earth 450 feet long and 12 feet high. They are known as the sindat-myindat (elephants and horses of war); but the representations are those of elephants and tigers, or lions, alternately with those of nats interspersed between them." The Kolaba (Kolasa) Pagoda - the Kel&sabhapabbatachetiya" of the Kalyani Inscriptions - was visited on the 2nd January. It is situated on a steep hill about 2,000 feet high, and appears to have been renovated. It derives its sanctity from the tradition that, like the Kyaiktiyo and Kokbennayon Pagodas, it contains one of the three hairs given by Gautama Buddha to the Rishi Kelasa. Near the pagoda are two stone insoriptions cut by King Dhammach@ti. They are in the Talaing character. The engraved portion of one has been entirely destroyed and only the socket remains standing, while half of the other has been broken. Only one manussiha, facing seawards, is found on the pagoda platform. Numbers of square bricks with the representation of a lotus flower impressed upon them are lying about the place. * [The very remarkable resemblanan of the chin 88 of Burma (out of which, no doubt, grow the manualna) to the winged lion of Nineveh, down to the very beard, has often impreened me. So also has that of the to of Burma to the winged ball. An intermediary form of the chinge is perhaps to be seen in the two lions couchant (chin8") from the Amaravati Tope in the British Museum.-ED.) 21 [They probably were intended to represent a military expedition. See below, note 29.-ED.) 12 The syllable bha in this word is remarkable, and oocurs, apparently as focal peculiarity, in other Pulicisms of the Talainge. E.., Tikumbhachiti - the modern Palicized name of the Shwedagon Pagoda.-ED.)
Page #409
--------------------------------------------------------------------------
________________ DECEMBER, 1892.] ARCHEOLOGICAL TOUR THROUGH RAMANNADESA. 389 The Kelesa Hill abounds in plants used in Burmese medicine. The plant, called maukk'ado, is employed as an antidote against snake-poison, and another, called 'wegaungzawet, is used in curing hydrophobia. On the same day, the village of Ayetbeme, which is four miles off, was visited. It is the ancient Taikkula and the Golamattikanagara of the Kalyani Inscriptions. Dr. Forchhammer in his Notes on the Early History and Geography of British Burma, II. page 7, says: "Though the seashore is now about twelve miles"" to the west, this place was still an impor tant seaport in the 16th and 17th centuries; it is marked on the map of Professor Lassen as Takkala, but erroneously placed a few miles north of Tavoy. Cables, ropes, and other vestiges of sea-going vessels are still frequently dug up about Taikkula.""" As to Golamattikanagara (for Gola read Skr. Gauda), if the evidence afforded by the Kalyani Inscriptions can be relied on, the settlement in Suvannabhumi was apparently colonized from Bengal during one of the struggles for supremacy between Buddhism and Brahmanism and possibly Jainism also." At the conclusion of the third Buddhist Council it was remembered by the mother-country, and missionaries were sent to it in order to re-establish community of faith. There used to be a Talaing inscription near Ayetbema, but it was removed to the Phayre Museum at Rangoon about eight years ago. Traces of a wall and moat still exist, and fragments of pottery and of glazed tiles are found in the neighbourhood. Pegu was reached on the night of the 3rd January. Extensive ruins are extant on the east and west face of the town. The ruins at Zaingganaing, on the west side, comprise those of Kalyanisima, Mahacheti, Yabemyo, Kyaikpun," and Shwegugyi. There are ten inscriptions at Kalyanisima, one at Yabemyo and twenty-two at Shwegugyi. Between Kalyanisima and Mahacheti is an enormous image of Gautama Buddha in a recumbent posture, measuring about 181 feet in length. Treasure-hunters have been hard at work among these ruins, and I am told that their acts of vandalism are countenanced both by the pongyis and the native officials, who expect a share in the "finds." Most of the stone inscriptions have been broken by treasure-hunters, or by pagoda slaves, who were anxious to obliterate the record of their origin. In some cases, the names of persons dedicated as pagoda slaves have been carefully chiselled out."" Pegu is the Thebaid of Ramannadesa, as Pagan is of Burma Proper, and its ruins have great claim to a detailed archeological survey. The Kalyanisima is the most interesting of all. (See plate No. 1.) It is an ancient Hall of Ordination, to which Buddhist priests from all parts of Barma, and even from Ceylon and Siam, used to flock to receive their upasampada ordination. Close by are ten stone-slabs covered with inscriptions on both sides. All of them are more or less broken, but the fragments, which are lying scattered about are Of late, the sea has been encroaching on the land. At the time of my visit, the sites of many villages, which derived their wealth and prosperity from the rice trade, were under water. The subject of the identification of this place with the Takola of Ptolemy and the Kalah of Arabian Geographers is discussed, op. cit., at pages 12-16, and at pages 198 and 199 of McCrindle's Ancient India described by Ptolemy. 35 The Kalyan! Inscriptions (1476 A. D), obverse of first stone, say "this town is called to this day Golamatikanagara, because it contains many mud and wattle houses resembling those of the Gola people." Four colossal images of Buddha sitting cross-legged, back to back, and facing the cardinal points. The height of each image is about 90 feet; the thumb measures 8 feet, the arm from the inner elbow-joint to the tip of the middle finger 33 feet, the distance from knee to knee 62 feet. The images represent the four Buddhas, who have appeared in this Kalpa, namely, Kakusandha, Konagamana, Kassapa, and Gautama. Similar images are found at Pagan, the prototype being probably those of Angkor Thom. [These peculiar images are clearly Cambodian, and form a tower of the ordinary Cambodian type. Terra cotta tablets, much mutilated unfortunately, found in the neighbourhood clearly represent Cambodian figures, such as are common in Pnom-Penh.-ED.] [A common and unfortunate practice all over Burma.-ED.]
Page #410
--------------------------------------------------------------------------
________________ 384 THE INDIAN ANTIQUARY. [DECEMBER, 1892. capable of restoration. Their average dimensions are about 12 feet high, 4 feet 2 inches wide, and 1 foot and 3 inches thick. They were set up by King Dhammacheti after he had founded the Kalyan sima in 1476 A. D. The language of the inscriptions is partly Pali and partly Talaing. (See plate No. 2.) Numerous copies of the Pali portion on palm-leaf are extant, and from two of them I have prepared a text transcribed in the Roman character. The great value of the Kalyani Inscriptions rests on the detailed information they give of the manner in which simus (bengs) should be consecrated in order to secure their validity, of the intercourse of Pegu and Burma with Ceylon and Southern India in the 15th century A.D., and of the Burmese view of the apostolic succession of the Buddhist priesthood. The Mandcheti Pagoda is a huge pile of brick and laterite, built by Hanbawadi Sinbyuyin about the middle of the 20th century A. D. Only the square basement now remains, measuring about 320 feet wide at the base, and about 170 feet high. Nothing definite is known about the rains of Yabemyo, Kyaikpun, and Shwegugyi. In the neighbourhood of the last-named Pagoda, glazed terra cotta tablets exhibiting, in relief, figures of human beings and animals were found lying scattered about. A number of such tablets have been collected in Mr. Jackson's garden near the Kalyanisima. All these should be acquired by Government and sent to the Pbayre Museum at Rangoon. They appear to have been manufactured by colonists from India." The religious buildings at Pegu suffered greatly at the hands of the Portuguese adventurer, Philip de Brito y Nicote, alias Maung Zinge, who held his Court at Syriam at the beginning of the 17th century, and also at the hands of Alompra's soldiery, who, being incensed at the acts of sacrilege committed by the Talaings during their ephemeral conquest of Burma Proper, wreaked their vengeance when their turn came. It is said that Maung Zinga, who was originally a ship-boy, and was stationed at Syriam to watch events and to represent his master, the King of Arakan, entertained ambitious designs of holding Pegu as a dependency of the Crown of Portugal and of converting the Peguans to Christianity. For the attainment of this object, he allied himself with Byinnya Dald, the Governor of Martaban, who was tributary to Siam, and opened communications with the Viceroy of Goa. He failed in his object and met with his death, because he had alienated the sympathy of the people by breaking down their religious buildings and shipping off to Goa the treasures obtained therefrom in "five ships." In the plaintive words of the bamaing or history of the Shwemddd Pagoda : "Maung Zinga was a heretic, who, for ten years, searched for pagodas to destroy them. Religion perished in Ramanna, and good works were no longer performed." The Sbw@gagalo Pagoda is in a good state of preservation. Its basement consists of a gallery containing 64 images of Buddha, each 4 feet 8 inches high, which were apparently constructed by Siamese architecte. It is octagonal in shape, and is a remarkable structure. On each side is an entrance, 6 feet high by 3 feet 2 inches wide, and 7 feet 2 inches long; these entrances lead to an interior gallery, 5 feet 2 inches wide and 7 feet 3 inches high ; the entire gallery, passing round the central portion, measures 246 feet. Close to the Mazinchaung, is the Shwenaba Pagoda. It contains an image sonlptured in relief on a tablet of sandstone measuring 5 feet by 4 feet. The image has an Indian cast of features, and is fabled to be shackled with fetters owing to its having once fled from Pega. It is said that this image, as well as a similar one of the same name on the eastern face of the . (To be published later in this Journal. With help from the Government, generously scoorded, I am making an effort to restore these invaluable documents to their original condition and to preserve them from further injury.ED.) 19 [Through Mr. Jackson's kindness and as a result of a visit by myself to the spot, over 100 of these tablets have been secured for the Phayre Museum. Foar are in the Pitt-Rivers Museum at Oxford and two in the British Museum. They represent the march, battle and defeat of a foreign (ogre) army. Those found at the other spot mentioned in this article, represent what I take to be Cambodian figures of nobles, and perhaps, ancient Sirih se also. A few are inscribed in the KyauksA (Kiousa) character. Personally, I should doubt their Indian origin-Er]
Page #411
--------------------------------------------------------------------------
________________ TAW SEIN KO dv No.1. THE KALYANI SIMA AT PEGU. No. 2. THE STONES ON WHICH THE KALYANI INSCRIPTIONS ARE CUT.
Page #412
--------------------------------------------------------------------------
Page #413
--------------------------------------------------------------------------
________________ DECEMBER, 1892.) ARCHAEOLOGICAL TOUR THROUGH RAMANNADESA. 385 city, were brought away from Taikkula. The resemblance between them and the figure of Avalokitesvara" is very striking, and suggests the idea that they have probably been modified from an Indian original to suit new surroundings. Near this image was picked up a small terra cotta tablet bearing a Sanskrit legend which, with other old images lying about the place, was apparently obtained by ransacking the relic-chambers of ancient pagodas. This tablet, now in the British Museum, is of peculiar interest. Some years ago half dozen similar tablets were presented to that museum, which were found at Buddha Gaya; and the probable history of the specimen found at Pegu is that it was brought from Gays as part of the collection of relics procured by the Mission sent thither by king Dhammachoti in the latter half of the 15th Century, A. D., and deposited in the relic-chamber of some pagoda erected after their return. The legend is said to be the formula of the three refuges." The general character of the tablet, independently of the inscription on it, is distinctly Indian." The eastern face of Pegu was visited on the 5th January. The Shwemodo Pagoda, said to contain two bairs of Gautama Buddha enshrined by Mahasala and Chulasala, sons of Pindakamabusetthi of Zaungta, was being re-gilt under the supervision of its trustees. The Pagoda was last repaired by Boddp'aya, about a hundred years ago, and a broken inscription recording this meritorious act is lying on the Pagoda platform. There is also an ancient brass bell said to have been presented by Byinnya Dala after his conquest of Ava in 1752 A. D." Like the Shwedagon Pagoda at Rangoon, the Shwemddd is a Buddhist shrine of great sanctity. Successive kings of Burma and Pegu lavished their treasures on it in repairing and enlarging it. When originally built, it was only 75 feet high, but as it now stands, it is about 288 feet high, and about 1,350 feet in circumference at the base. A little to the north-east of the Shwemddd is a small hill, fabled to have been the resting. place of two hansa birds, when the region about Pega was under the sea. At the foot of this hill are two octagonal pillars of fine granite. The length of one is about 11 feet and that of the other is about 5. They bear no inscriptions, but a tradition is current that they were erected by kula, i. e., foreign or Indian, merchants, who subsequently claimed the country as their own by virtue of pre-occupation, and that they were driven out by a Talaing prince. However, the true history of the pillars appears to be that, like a similar granite pillar in the ancient town of Tenasserim (Tanindayt) in the Mergai District, they were erected when Ramannadesa was subject to Siamese rule, to mark the centre of the ancient city of Hamsavati, and that most probably human beings were buried alive below the pillars, in the belief that the spirits of the deceased would keep an unremitting watch over the city. A good panoramic view of Pega and its suburbs is obtained from the Shwdaungyo Pagoda, which is situated at the south-east corner of the city walls. At about 700 yards from the southern face is Jetovati, the encampment of Alompra, who beleaguered Pega in 1757 A. D. Within the walls are visible the sites of the palaces of the great kings of Hamsavati, such as * Plate LV. of The Cave Temples of India, by Fergusson and Burgess *1 [The legend of the Pega specimen is by itself mostly illegible, but a nearly identical specimen from Gay at the British Museum the inscription is legible enough. It probably is some well-known formula, but it is not that of the " three refuges." There must either have been some reciprocity in the production of those votive tablets between Gayl and other places whence pilgrima oame, or the pilgrims must have induced the looal artists to copy inscriptions on their particular gifts in their own various tongues, because among the British Museum specimens is one which has what appear to be imitations of the Kyaukad characters of Burma, much resembling those of the Tenerim medals figured by Phayre in the International Numismata Orientalia, Vol. III., Plates III. and IV., and another bus illegible imitation characters on it of some tongue unknown to the artist who made it. Sir Alexander Cunningham hus figured some of these tablete, which, he calls sals, in his new book, Mahabodhi, Plate XXIV. These are apparently from his own collection of finds at Buddha Gay, and there are other good samples at the South Kensington Museum, Indian Section, which are wrongly labelled there for the most part.-ED.) " It is said that the Shwedagon was raised to its present height in the last century by the Burmese in order to overtop the Shwemddd of the Talnings.
Page #414
--------------------------------------------------------------------------
________________ 386 THE INDIAN ANTIQUARY. [DECEMBER, 1892. Hanbawadi S'inbyayin known to European writers as Branginoco," Yazadarit,** and Dhammacheti, Traces of a double wall and moat are also seen, the walls being in good condition. I have now traversed through the whole of the ancient Talaing Kingdom of Ramannadesa proper. The stone inscriptions are the chief of many objects of archaeological value and should, if practicable, for the purpose of preservation, be removed to the Phayre Museum at Rangoon. In the case, however, of inscriptions, whose size and weight render their removal to Rangoon unadvisable, they should be collected at some convenient and central place and arrangements should be made to protect them from the weather. If they remain in situ they are liable to become defaced or weather-worn. Manuscripts of historical interest are extremely carce; the architectural structures have in too many cases been renovated in the modern tyle; and the religious buildings worthy of conservation are being looked after by the people. No true stupas or topes, like those of India, were met with, and the enquiries instituted failed to clicit any information regarding the existence of any records, lithic or otherwise, in the Asoka character. The absence of any records in this character, both in Ramannadesa and at Pagan, whither it is supposed the Burmese conquerors removed their spoils of war, throws considerable doubt on the authenticity of the account relating to the mission of Sona and Uttara at the conclusion of the Third Council, as stated in the Mah&vamsa and other Buddhist books. The question, however, may be considered to be an open one, until the information afforded by Talaing, Cambodian, and Siamese records, shall have helped its solution. * ("Branginoco" represents the title Bayin Naung, perhaps then pronounced Bharin Nong. It is spelt Bhuran Non.-ED.] [This word Yaddarit is spelt Rijdirdj and seems to clearly equal Rajadhirga. I may as well note that Yuz0-di-badi, Nara-di-badi, Send-di-badi, and similar titles in books about Burma are simply the familiar Rajadhipati, Naradhipati, Senadhipati, etc., in disguise. The Di-ba-di title, which has puzzled so many writers, is really always the latter part of some title, which includes the term adhipati, ruler, regent, king,' and means that the holder called himself 'overlord of whatever the first part of the word might mean.-ED.]
Page #415
--------------------------------------------------------------------------
________________ INDEX. d, the suffix, its wide range in the Tibeto. | Ayetbema, antiquities of 383; is Taikkula Burmese languages ...... ... 128 383; is Golamattikanagara .................. 388 Adam, Father, in a folktale ..................... 343 | Ayyappan, a note on the pagoda of ............ 96 adjectives unknown in the Tibeto-Burmese languages and substitutes described .......... 126 adoption among the Shans ......................... 118 Bajidd, king of Burma, grandson of Bodoair, flying through, the flying bed ............... 187 paya ......... .......*********** 290 ajjhayanas of the existing Nijjuti examined 328 ff. Balatkara-Gana, the, was probably founded Alaungp'aya Alompra ............................ 289 by Guptigupta ................................ 139 Alompra, the story of his being a hunter dis. Baleocomos of Ptolemy= Vilivayakura...... 204 cussed 252 and note :- his Dynasty, genea- Bases, consonantal, declension of, in the inlogy of the 289:-Dynasty, succession of scriptions at Girnar 5, in the inscriptions at the kings of the ............. ................ 287 ff. Kapur di Giri 12, in the remaining edicts alphabet, list of inscriptions in the N. E. 101; conjugation of, in the inscriptions at Gupta 48; list of inscriptions of the N. W. Girnar 7, in the inscriptions at Kapur di Gupta 41, 42; list of inscriptions of N. W. Giri 13, in the remaining edicts 104:Post-Gupta 42 :- the N. W., of India had vocalic, declension of, in the inscriptions no signs for marking long vowels 175: map at Girnar 5 f., in the inscriptions at shewing distribution of ancient Indian Kapur di Giri 12 f., in the remaining edicts 102 40 IP.; test letters of ancient Indian.........50 ff. bathing customs in Madras ........................ 252 amanta arrangement of the lunar fortnights Baungahe = Haka q. v. 123; their real name was used in connection with the Saka era is Poi 190; geographical distribution of in Cambodia at least as early as A. D. the 190, border on the Welaung Chins 626 ................................................... 47. 48 215; speak nearly the same language as Anuyogadvarasstram, a notice of the 293 f.; the Tashon Chins .............................. 190 f. detailed description of 301 ff.; age of ...... 309 bees, bad omens as to, in South India ......... 224 anangapavittham, a list of the Jain Siddhanta Belgaum District, an inscription from the, texts not in the angas ...... edited ............... Andhra =Trikalinga = Telunga Trilinga. 198 Betmaraja, ancestor of Ganapati of Kanchi. Andhrabhrityas, genealogy of 204, chrono pura ....................................... ...... 197 logy of the 203 f., their reigns filled the Betsileo, a tribe of the Malagasy greater portion of the second century A. D. 207 Betsiriry, a Malagasy tribe... **. *............ 250 Anga King Soniya of Champa, legendary Bhadalpur, the original seat of the Digam. accounts of his sons ......... ................ 21 ff. baras, not yet identified ...................... 60, 61 animals, grateful, in folktales, eagle 165f.:- Bhadrabdhu; division of the Jains in his time 59 Malagasy belief in mythical ...................251 f. Bhadrabhu I., the last of the Sruta-Keva. Andrat'dzd of Pagan, his sack of the Taulaing lins .............. ................ 156 to 159 library at Thaton ............ .. ............ 880 Bhadrab&hu II., the last but one of the antiquities, Fuhrer's list of, in N. W. P. and Minor-Angine ............. ................ 158 to 160 Oudh .............. ................. 318 ff. BhadrubAhusvamin, the author of the SuriyaApabhramba Prakrit discussed .................261 ff. pannatti ............ Aparajita, a Jain teacher........................... 158 Bhagavadgita, identical passages in the, and Appaya-Dikshita, his date discussed........... 28 in the Bhagavata-Purana......... ... 94 Ardha-Magadhi Prakrit discussed ...........261 ff. Bhagavata-Purdna, identical passages in the, a88, superstitions as to the, in Madras ......... 318 and in the Bhagavadgita ......... Assyrian winged lions and bulls, degrada- Bhandarkar, Prof., wrong as to Vaghela tion of the, in Burma ........ ............. 882 dates ............... ............ 277 astronomy, of the Jains, discussed 14 ff., list Bharata, a Jain version of the legends of the of technical terms .......... .................15 1. kings of ............. .................. 18 f. Avakyakasutram of the Jains, the only text Bharaut Bharhut .........................225 f. note extant ........................ ............ 328 Bharhut = Bharaut ......................... 225 f. note LB HOL M be angas ................ .....297 AT 1 . . 93 ........... . .. 9
Page #416
--------------------------------------------------------------------------
________________ 388 INDEX. Bhil, notes on the life of a . 123 Bilari, in Muradabad district, full of antiqui ties............................................................ 319 Bilin, antiquities of, noted.........................382 f. birth customs among the Chins 223 :- among the Shans ....... ........ 117 blood used for divination 216; can restore to life 343 :- drinking as an oath Bodop'aya, king of Burma, son of Alompra... 290 Boi, a Chin chief....................................... 192 Bonthadevi, wife of Vikramaditya IV.......... 168 Bower Manuscript, description of 29 f., 349 ff.; an instalment of 129 ff.:-comprises several treatises 129; subjects of, are medicine, divination and conjuration 129:- remarks on the chronology of the treatises 129f.; a note on the date of the 29 ff. ; was written between 350 and 500 A. D. 37; was probably written, later portions about 450 A.D., earlier, about 400 A.D. 37, 38:- remarks on the orthography of 130 f.: is not in the Sarade alphabet, but in the more ancient Gupta alphabet 32; is a North Indian MS. 30; is written throughout in the NorthWestern alphabet 31; clerical errors in the 350 f.: remarks on the language of 131; the grammar of 131 f., grammatical anomalies in 350 f.:-origin of the name ...... 29 " bor-headed" characters ........................ 93 Branginoco, the title explained ................. 386 bricks, glazed, see glazed bricks. Brito, Philip de, his doings.......................... 384 Briddba, usually called Bhagavat in the Bharaut inscriptions 226; huge recumbent image of, at Pegu ................................. 383 Buddhila, a Jain teacher ............................ 158 Buddhist canon and its subdivisions known in first century B. C. 227 :- tradition in the Bower MS. 350:- priests, modern, of the Talaings, their habits 378 f.:-images, ancient, described ................................. 378 building, prevention of, by miraculous means .......... .............. 96 Burmese, Sanskpit words in ............94 4., 193 f. Chalamartiganda, a biruda both of Rudra. mbi and Prat&parudra .............................. 199 Chalukyas, Western ................................ 167, 168 Chandapannatti, the seventh undnaam of the Jains ............. .............. 20 Chandragiri, a hill at Sravana-Belgola; men tioned by the ancient name of Katavapra. 158 Chandragupta, a son, according to the Rojdvalkkathe, of Asoka's son Kunala, 157:- a disciple who is allotted by tradition to Bhadrabhu I., 156, 157;-his real name was Guptigupta .............. ................ 159 charm against evils in general 350 ff.; against snake bite 350 ff.; throwing & stone at & pitcher makes it heavy .......................... 314 Chashtana, grandfather of Rudradaman, 204; date of, is circ. 135-145 A. D. ......... 205 chhedasutram, the first, described 180 f. ; the second, described 181 ff. ; the third, described 210 f.; the fourth, described 211 ff.; the fifth, described 214; the sixth, de scribed ..............................................214 f. chhedasutras of the Jains described 178 ff.; are of considerable antiquity 179, 180; correspond to the Buddhist vinaya 179; contain rules of conduct for the clergy 179; traditions regarding the, quoted 379; commentaries on the ...................... 180 chief, installation of a, among the Karennis.. 318 chiefship among the Karennis is of a sacred character .. .................. 317 f. Chin (see Banngshe, Chinbon, Chinbok, HAka, Kadin, Kanho, Kwonan, Sagyilaing, Siyin, Sochaung, Tashon, Tlangtlang, Welaung, Yindu and Yokwa). Chinbok Chins, border on the W@laune Chins 215; geographical distribution of the 215; claim descent from the Baungshe Chins 215; a note on their language ...... 190 Chinbon Chins, geographical distribution of the 215, border on the Yindu Chins 215; claim Burmese descent ......................... 216 Chins, population estimated 192 f.:- human proper names among the 223 :- limitation of the capacity of the, to denote time 191 - dress of the 216 ff. :- dwelling of the 220 :- agriculture of the 192, 219:- are keen sportemen 221:- polity of the, described 216; raids among the 221 f.; chiefship among the 192:- dialects of the, noted 216 ; petty dialects among the 123:-- the religion of the, noticed 191; are spirit worshippers 191, devoted spirit worshippers 216 - oaths among 923 :customary law of the 191 1., 216 and note :- birth customs 223; marriage customs 229 ; funeral ceremonies of the 191; calumniated persons in folktales, wife ......374 ff. Cambodian rule in Burma, traces of............ 378 cannibalism among the Shans....................... 120 caste, power of prejudices as to ............. 47 note cat, folklore of the, in Tibet ..................... 376 cattle; it is a sin, in Madras, to pass cattle crossing a path ......................................... 278 caves in the Talaing country of Lower Bur. na ................ .........377 ff. Ceylon, see Singhalam. Chakkarakottam stormed by Kulottunga Chola as yuvardja ............ ............ 28
Page #417
--------------------------------------------------------------------------
________________ INDEX. 389 death customs 2:3 :- drunkenness among cow, to kill a, a sin in Madras 278:- to eat the 222 : tattooing among the ............... products of it, it sin in Madras .................. 278 Chins, Hika Tribe, were probably one race crow, superstitions as to the. in Matras ..... !68 with the Lushais not long since 1.27; cures: water restores to life 180 throwin: Macnabb's book on the Haka dialect of the.1238. a baby at the deul restores to life 189 chinde of Burma is the Assyrian winged lion, for snake poieon 383:--for hydrophobia ... 383 degraded ............. ................... 382 customs, social, in Southern India 221, in Chalika. Paisachi Prakrit discussed .........261 ff. Madras......... ............. 193 chre='casus belli among the Karennis 317, cyclic years, instances of the use of them: is an hereditary vendetta.......................... 317 Partliva 32), Sanmya 122, 197, Viksiti ... 322 Cinderella, variant tale of ..................... 187 f. coins, a catalogue of the, in the Lahore Dala ban, the Talning General................... 377 Museum noted 194 f. :- punch-marked, an Dalmin, a note on the fort of .................. 329 Indian invention 3+5; cast, 315 f. ; lead, Damodara (Early Kadamba); his rock.cut in India, noted 347 :- of ancient India, inscription at Konnur, edited. ............... 93 Cunningham's, reviewed 344 ff.; South dazurs, the, of the Jains described.........211 f1. Indian 321 ff.; of Nepal noted 347 f.; dates - degree of the sun specified in French of Kurikal 327 :- of Amoghabhuti 49:- recorded in days of the Kaliyuga car noted 346; of Avanipasokhara of Madura in MSS. 49 f. : - luni-solar used in MSS. 324; of British East India Company 326 f.; 49:-- solar used in MSS. 49 : froin of the Cholas 323; of Dhama Pa lasini noted inscriptions and MSS. discussed 47 ff. :347; of Harihara Vijayanagara 321; of of the Vaghela Kings of Gujarat ......... 276 f. Kosambi noted 346; of Madura 323 f; of day, the 172nd day of a regnal year menMallikarjunariya 321; of the Mitras noted tioned in a recorded date........................ 282 Sti; of Odumbara noted 916; of Sadasi. days, "ivil, of the fortnight, or month, devaraya of Vijayanagara 322; of Taxila noted noted by buli or auti and badi or vudi and 346; of Tirumalaraya of Vijayanagarat :22; vati and mentioned in recorded dates: of Vijayanagara 321; of Visvanatha of dark fortnight :Madura noted 325 f.; of the Yaudheyas eighth .......................... ............... 51 noted..................... ...................... 347 bright fortnight :companions of hero in folktales, minister 185, fifth ..................... demon 188, monkey ............................... 188 eleventh ................ conjugation in the inscriptions at Girnar ... 7 f. fortnight not specified :conjuration in Ancient India .................. 349 fr. twenty-first ............ consonants, weakening of hard, into soft days, lunar, i. e., tithis, mentioned in recorded 259; substitution of hard for soft, in the dates : Priksits 260:-- ancient Indian alphabets dark fortnight :did double identical or homogenous 175; tbird ............... doubling of, importance of, as a criterion fourth ................ . by which to judge of Prakpit 271; doubling sixth ............................ .............. of, the main point of difference between eleventh ................................... 121, 197 monumental and literary Praksit 269 f.; thirteenth .................................... 122 the inscriptions of Piyadasi do not bright fortnight:observe the rule of doubling homogenous third .............. 146:- simple, changes in, in the inscriptions fifth ............... at Girnar 3; changes in, in the inscription thirteenth ......... at Kapur di Giri 9, in the remaining edicta days, lunar, mentioned in MSS. :88 f.; suppressed, in the inscriptions at brigbt fortnight, eighth Girnar 3, in the inscriptions at Kapur di fortnight unknown, seventh Giri 91., in the remaining edicta 89; added, days, solar, mentioned in recorded dates :in the inscriptions at Girnar 3, in the inscriptions at Kapur di Giri, 9 PS., in the days of the week, names of them as used in remaining edicts 89:- compound, in the recorded dates :inscriptions at Girnar 3 f., in the inscrip Aditya (Sunday) ............ tions at Kapur di Giri 10 f., in the remain Budha (Wednesday) .....................51, ing edicts 89 -- peculiarities in all the Guru (Thursday) edicts except at Girnar and Kapur di Giri 88.1 Indu (Monday) 25+ ........... ninth .....
Page #418
--------------------------------------------------------------------------
________________ 390 48 ****************** Jiva (Thursday) Nayarru (Sunday) ............... 322 Ravi (Sunday) .....49, 50 Sani (Saturday) .122, 277 Seva (Tuesday) 343 Soma (Monday) Su (Sukra) (Friday) Sukra (Friday) Velli (Friday) Vri (Vrihaspati) (Thursday)................. 48 Vrihaspati (Thursday) 51 days, lucky for shaving in Madras 252; of the week, lucky and unlucky in Madras 193 days, Jain names for the, of the calendar 16 death customs, in Madras 252; among the Shans 119; among the Chins 344 ... 924 **********.... 191, 223 death, temporary 342 f.; recovery from ..186, 189 death-bird in South India declension of consonantal bases in the inscriptions at Girnar 5, at Kapur di Giri 12, in the remaining edicts 101:- of vocalic bases in the inscriptions at Girnar 5 f., at Kapur di Giri 12, in the remaining edicts 102 of pronouns in the inscriptions at Girnar 6, in the inscriptions at Kapur di Giri 12 f., in the remaining edrets 103:-of numerals in the inscriptions at Girnar 6, Kapur di Giri 13, in the remaining edicts... 104 degree of the sun specified in dates 49 Devanandin, the author of the Jainendraryuikarana .......................................................156 note Devagiri = Daulatabad 197 Devapala his copper-plate grant found at Mungir 253; genealogy of....253, 254 Devi Nagi ............................................ 364 Dhammacheti of Pegu, his great inscriptions at th Kalyanisima near Pegu Dharmaditya probably Samudra Gupta 45 of Vijayapura 169 Dhritishena, a Jain teacher...... 158 dialects, literary, of ancient. India were Vedic, classical Sanskrit, mixed Sanskrit, literary Prakrits ............................. *************** ........... - ************** ********** ************* **************** ********************************* ***********..... ****************** ******...*** INDEX. ********.... 51 48 49 384 275 .386 n. Di-ba-di, the Burmese title, explained dice, use of, in ancient India as a means of divination 132 f., still in use in India and adjacent countries 134- ancient techni calities in connection with, esplained...... 133 f. Digambaras, their migrations were South to North CO; arose as a seet about 162-173 A. V. 60; separated from the Svetambaras in the time of Bhadrabahu 59; divided into four divisions in the days of Maghanan lin 59 the gachchas of the Digam baras. merely side branches of the main line 52 there are two distinct traditions as to pektifical succession among the 57; points of difference in the traditions as to the pontifical succession, discussed 57 ff.:details of the differences in names and dates of the pontifical succession among the 62-63 Pattavalis of the ..............57. Dinachintamani, wife of Kulottunga-Chola... 282 disease, Shan notions as to the origin and cause of ............... ............................. 119 disguise in folktales, effected by a skin......... 164 divination- by means of shooting an arrow at random 160:- Indian, as recorded in the Bower MS. 129 ff.:- in ancient India by dice 132 f.:- among the Jains 216by fowl's bones among the Karennis........ 318 divorce among the Shans.................... 119 eating, superstition connected with, in Madras.......... ............. 252 eclipse, customs in Madras at .......................................**** 123 eggs used for divination 206: the use of, in Parsi festivals... .144 note Ekamranatha (see Samanta-Bhoja Dochi) 197: is a Saiva temple at Kanchipura 197 Ekasilanagara Worangal ****......... = 198 28 elephants, images of, as offerings Elisaivallabhi, wife of Kulottunga-Chola 252 eishemin yuvaraja.......... 290 ...... ********************* dates: *************** ****** cras: Gupta, commencement of the, 203 and note: Lakshamanascna, note on the 50 f.Saka, commencement of the 203; founded by Kanishka 206; Kanishka and his successors used the 78; used in the two Mathura inscriptions dated year 135 and year 280, 207; Nahapana the Kalaharata and the Kshatrapa Senas of Gurajat used 207 *****.. the cras used in recorded dates:Kaliyuga Lakshmanasena Newar ...50, 51 ***************** *************** 52 ...... Saka...............47, 48, 49, 50, 122, 197, 322 Vikrama.............. ....51, 277 eras, Muhammadan, used in recorded Hindu 50 50 Mahammada Yavana Hijra) euphemisms, folk origin for........................ 261 Eve in a folktale evil eye instance of 93; in Bibar 168; in Persia 342 ************...*** 168 f, a rare sound in the Tibeto-Burmese languages........................................... fairy spirit 165 lives in well 342:-- can perform penance 165, can give and take away disease 342:- marriage of, with a 127
Page #419
--------------------------------------------------------------------------
________________ INDEX. 391 human being 164:- odour of mortals Govardhana, a Jain teacher ......................... 158 barmful to 105:- a tale of .................. 186 f. graha a seizure, the varieties of ............36. f. Faizi Fayazi, relics of ......... ................. 319 grammar, in the Bower MS., remarks on Falam, the capital of the Tashon Chins ...... 190 131 f., 350 f.:--- questions of dialect in the faxanim.pito-loha, a mythical animal of the inscriptions of Piyadasi discussed 171 4.: Malagasy ............................................ 251 notes on some general points of, in the fate, belief in, among native Christiane, exhi- inscriptions of Piyadasi 155, 146 f.; and bited 47 note:-- in folktales, unavoidable... 46 f. differences of dialects in the inscriptions of feather (see hair) burnt, magic property of, Piyadasi are less decided than might be to aid in distress .................................. 166 expected 155:-written, of Prakrit, cannot feuds among the Karennis, Kachins, Chins, be carlier than 2nd-4th centuries A. D. etc................................. ................ 317 270:- Magadhi dialect of Agoka - term tirst fruits, offering of the, amongst the Shan's 1:0 explained ............................................. 173 flute, magic, a story of a........ ............... 165 f. Gudupharas = Gondophares = Yndopherres 207 folklore in Hindustan 185 ff., 277 ff., 341 ff.; Gupta, Samudra, = probably Dharmaditya.. 45 of the Komatis 93 f.; of the Malagasy 250; Gupta Alphabet, list of inscriptions in the in Salsette 23 ff., 45 ff., 312 ff., 374 ff.; in N.-E. 43; list of inscriptions in the N.-W. Tibet 376; in Western India ............... 160 ff. 41; list of inscriptions in the N.-W. Post-. 42 forbidden things in folktales - touching a Gupta era, commencement of the... 203 and note fairy's (human) skin ...........................164 ff. Guptigupta, disciple of Bhadra bahu II., 159; fortnights, Ilindu lunar; see amantu ...... 47, 48 - he is inentioned in certain inscriptions fortunu-aecking, by hero in folktales ......... 161 L as Chandragupta ......... ............ 156 Gachchas, the, of the Digambaras merely hair (sce feather); cock's feathers used for side-brunches of the main lino ................ 59 divination 216:-(burnt) magic property Gudag in the Dharwad District, an extract of, to aid in distress ................................. 166 from an inscription at ....................... 167 Haka Chins, geographical distribution of the gambling in folktales ......... ................ 341 190:- dialect of 123 ff.; compared with Ganapati of Katchi = the Kakatiya king of Lushai and cognate dialects 124 ff.; the Orugallu (Worangal) 122; was the 5th most nearly related language to it is Lushai Kakatiya king of Worangal 199; was 125; its place in the Tibeto-Burmese nephew of Rudradeva of Worangal 197; languages............................................. 126 his descendants 199; conquered by Sundara- HanbAwadi S'inbyQyin, king of Pegu, his great Pandya 121 ; his contemporaries 198:-his pagoda 38+; his various titles ............... 586 Kanchipura inscription is dated 8th June Hanumadachula, the Skr. name of Anuma1249 and he died in 1957 A. D. 122; the kogda ........................ ............... 198 Ekimranatha inscription of ..................197 ff. Haribhadra, commentator on the second Gangaikonda-Chola = Rajondra-Chola ...... 823 mulastitram .......................................... Gangaikonda-Solapuram, a ruined town, note Harihara of Vijayanagara, a coin of ......... 321 on ....................... ................. 323 Hashtnugar, a note on the date of a Greeco. garuda = the royal eagle, = the white kite Buddhist inscription at .........................166 f. in Madras ........................ .................. 278 i Hemachandrasuri, commentator on the Gathi dialect = Mixed Sanskrit ............... 2+3 f. Anuyogadurasastram ......................... 309 Gauda = Bengal ......... ............... 197 Hongtan Ariman Nat, a spirit of the Chine... 191 Gautama, the Jain Paramarshi ................... 158 hero, in folktale, outs off his own head 46: Gautami River = Godavari ..................... 199 Beeke fortune, in folktales 161: his com : gender in the inscriptions at Girnar 5, at panion, minister 185, demon, 188, monkey. 18H Kapur di Giri 11 f., in the remaining Hidimba is in the neighbourhood of Woranedicts .................. ............... 101 gal .................. .................. 198 glazed bricks at Pegu 384:- at Thaton ...... 381 Hirimun, the parrot, a tale of.................... 183 guld, the term in the Bower MS. discussed...350 f. honey, to eat, a sin in Madras ............. 275 Gola = Gauda............. ............... 383 hovse, superstitions as to the, in Madras Gulumattikanagara is Ayethema in Lower 318:- image of, as an offering .............. 28 Burma ......... ...................... 382 Hova, a Malagasy tribe, 'its Malay origin Gondophares = Yndopherres = Gudupharas. 207 250 :- folklore of, not Malay' 250:- a Gotamipata Sakatani the Andhrabhritya ... 20+ tradition of the origin of ......................... 25 ...... ...
Page #420
--------------------------------------------------------------------------
________________ 392 INDEX. 84 **********. 118 ill-luck- unpleasant expressions are unlucky in Bengal image, chained, at the Shwenaba Pagoda in Pegu 384 f. Indranandin, the author of the Nitisdra, a note on him and his date inheritance, Shan law of 119, 120: Shin law of royal 120 of adopted sons among the Shans inscriptions (see Piyadasi:- dates from, discussed 47 ff.: the first in Sanskrit is dated 155-160 A. D., 244; of the 3rd to 5th century A. D., absence of material for determining dates of 208 f.: notes on the dates of South-Indian in the 3rd to th centuries A. D. 209 f.:- list of, in the N.-E. Gupta Alphabet 43; list of the, in the N.-W. Gupta Alphabet 41; list of, in the N.-W. Post-Gupta Alphabet 42:at Bharaut, date of, discussed 225, date of, proved by that of Vatsiputra Dhanabhati in the reign of the Sungas 225, vocabulary of the 239-note of a Cambodian 47 f.:of the Cholas noted 323; three Chola, noted 282- in English at Maulmain 52-a note on the Faridpur inscription of Dharmaditya 44, 45 at Girnar, details of the grammar of the 2 ff.; Girnar of Rudradaman, the first in Sanskrit 244 f. - GraecoBuddhist, at Hashtnagar, a note on the date of 166 f.:- Jambukesvara inscription of Jatavarman noted 314; Jambukesvara inscriptions of Prataparudra 200 f.: of Jasdhan 205-210 A. D. contains mixed Sanskrit 245 Kapur di Giri, detail of the grammar of the 8 ft.;- the Kachipura inscription of Ganapati noted 122; two Kanchipura inscriptions of Kanda-Gopaladeva 122; Kanchi inscription of Mallikarjunadeva noted 321 f.; Kanchi inscription. of Virupakshadeva noted 321f.:- Buddhist at Khandagiri, Ramnath, Kangra, Rewi, Western Caves, Sanchi, Bharhut. Amravati, date of 208 Kilpalavur inscription of Kulottunga-Chola 281-two, at Mathura dated year 135 and year 280 are in the Saka era 207: noted copper-plate grant of Mahipala 98:- of Nahapana, seven in number 213; those of Nahajana and the Andhrabhrityas contemporaneous 243, are in mixed Sanskrit 244; differences between the language of those of Nahapana and the Andhrabhrityas 243 f. the Nanaghat are a century earlier than Gotamiputa Satakani 203: copperplate of Narayanapala noted 98 of the Pandyas noted 323 unpublished Ranganatha of ******* 252 Sundara-Pandya noted 324 f.:- Srirangam inscription of Sundara-Pandya 121 f., corresponds to Saka 1182 expired 122:- Ranganatha of Sundara-Pandya noted 314:Takhitibahi inscription of Gudupharas, date of 207 Taxila inscription of Moga, date of 207-Tanjavur inscription of RajendraChola noted 323:- Tirukkalukkunram inscription of Kulottunga-Chola 281 ff.:Tirukkajukkugram inscription of SundaraPandya quoted 343 f.:- Tirupparankunram inscription of Maravarman noted 341Tiruppavanam inscription of SundaraPandya quoted 344: Tiruvidaimarudur inscription of Kulottunga-Chola 282-of the Turusbkas are in mixed Sanskrit 244:unpublished Vikkiramangalam of SundaraPandya noted 344: Pegu of Dhammachoti, noted 382; Kalyani of Dhammachets, allusions to 377 Talaing, five at Thaton, 380; at Ayetbema 383; nt Yabemyo 38,; at Shwogugyi 388; at Kalyanisima 383 f.; general noted inscriptions at Bharaut..... inscriptions, on copper, edited:Dovapiladeva Jayaditya of Vijayapura Vigrahapaladeva inscriptions, on stone, edited :Bharaut.... : ************* .258 ...169 9 ***** ************ Damodara (Early Kadamba) Ganapati (at kamranatha temple) Kulottunga-Chola (at Kanchipuram)......... Sarangadeva (Vaghela) 03 .19 Jackals, superstitions as to, in Madras. Jainendra-vyekarana, the; the names of the author of it..... .....15 Jains (see Digambaras):- community undivided until the days of Bhadrabahu 59; the great separation took place about 162-170 A. V. 60; the traditional migration of the. from Ujjain 158, 160:- schismus among the, detailed 335 ff. astronomy of the, discussed 14 ff. sacred literature of the ...... 14 ff., 10c ff., 177 fr., 30 ff.. 293 ff.. 327 ff.. 36 Jaipur, the final residence of the Digambara Pontiffs....... 1. Jambu, a Jain teacher. Jambuddirapannatti, the sixth pingum of the Jains....... 17f Jambudvipa, a Jain description of 18 f. Jatakas, scenes from the, represented at Bharaut... ......225 f. Jatavarman Sundara-Pandya .121, 31-4 ************ ********************* *****.***...
Page #421
--------------------------------------------------------------------------
________________ INDEX 393 Jayanaman, a Jain teacher .... .... 158 king local magnate in folktales...........45 note Jayaditya of Vijayapura, his copper-plate kinoly, a mythical animal of the Malagasy ... 259 punt found at Gorakhpur.......................169 f. kirita = Ro Keren .............................. 317 yetuvati, a suburb of Pegu ......................... 385 Kite, superstitions as to the, in Madras ...... 273 pinaprabhamuni, the author of the Sandtha- Kogun, caves at, described ............ ......... 378 vishanshadir ....................................... 21+ Kokarek, a visit to ............. ............ 379 Jinendrabuddhi, another name of Deva. Kokbun na yun Hill, visited ......................381 f. nandin ..... ........... 156 n. Kumati, folk-etymology of the name 93:-- a folktale of the caste .............................93 f. Konagumana the Buddha, mentioned in the K and t, contusion of, in the Haki Chin lan Bharaut inscriptions .............................. 226 guage ............ ................. 128 Kongbaung Thariwadi, King of Burna ... 290 k, a prefix to verbal roots in Chin, explained. 125 Kongunan dalam, conquered by KulotttungaKachins, a tribe of the Shan States ............. 116 Chola............ ............. 282 Kadambas, the Early .............................. 93 Kornur, a village in the Belgaum District; Kadin Chins, their language ...................... 216 the rock-cut inscription of Damodara (Early Kakatiya kings of Worangal, their genealogy 197 Kaulamba), edited ............ ................. 33 Kakutsanda, the Buddha, mentioned in the Ko Rajakosarivarman = Kulottunga-Ckola Bharaut inscriptions ......... ................ 226 281, 282 Kula princes, logendary accounts of the ......21 ff. Koring Nat, a spirit of the Ching ................ 191 Kalinira king, defeated by Ganapati of Kan. Kot Salbahan in Sahaswun ........................ 319 chipura ............ ................. 197 Krittikare Ksittikaryn, a Jain teacher, 158; Taine l elsewhere alingamandalam conquered by Kulottunga. the name is Kshattriya ......................... 158 n. Chola.......... . ..................... 283 Kulttunga-Chola, his life 282 f.: acceded wigattu-Parani, its notices of Kulut. 1071 A. D., 283:- inscriptions of him ...281 ff. tunya-Chola............. ................... 283 | Kuntala (= Western Chalukya) fight with Kalit a shrine in North Travancore ......... 95, 96 the kings of, by Kulottunga-Chola ......... 282 kalpintarvachydini, a note on the 211, de. Kwonun Chins, their dress ..................... 216 scried 213, its recent date .................... 21+ Kyaikpun near Pegu, ruins at, notes on......383 f. kalpasitra, a note on the 211:- the first Juin text translated ......... Kalsi, real local name of ...... .......... 319 luck, good, to go to see a sacred image with Kalyani inscriptions at Pegu, allusion to...... the eyes closed 96; in seeing the deity first Kalyanisima, account of 383; inscriptions at, of all things at a fixed festival 96:- bad, noted...................................... a disgrace............................................. 102 Kanchipura was included in the dominions Las, a tribo in the Shan States .................. of the Kakatiya kings ...... .................. 197 Lata =Gujarat ................ Kanh) Chins occupy the country to S. of life-index, instance of 187 f. :-is a jowel...... Lohtrya, a Jain teacher Manipur ................... 190 Kanishka founded the Saka era 206, le and lunar astronomy of the Jains his successors used the Saka era.............. Lunar Race, the, included the Western kauton = Kanh) ............ 190 Chalukyas ................ Kerant quoted Taitila..... Lushais were probably one race with the il... . .................. 18 f. Karennis, their customs ...........................317 f. Haka Chins not long since 197; their lanKarens in the Shan States 116: customs of guage most nearly related to Haki Chins... 123 the Red, 317 f.:-language, noted ............. 377 Kirikal, real name is Karaikkal.................. 327 ma, the letter, is a test letter in ancient Kasyura the Buldha mentioned in the Indian Alphabets ............ .......... 0 Bharint inscriptions .............................. 926 Midhariputa Sirisena the Ardurabhritya ... 204 Katarapra, ancient name of the Chandragiri Migudhi Prikcit discussed 26 f.:- as the hill at Sravanil-Belgola ...... ................ 158 ! dialect of Asoka, term explained 173; was Kansambli = Kosa mentioned in the the official dialect of Asoku's Court .......173 f. Bharaut inscriptions .......... .............. 225 Maghanandin, the Digambaras divided into Kaya = Red Karen .................................. 317 four divisions in his time ......... ......... 59 K daba Pagoda visited 382; is che Kolasubba Mahicheti, an ancient Pagoda at Pego, notes pabbatacbetiya of the Kalyani inscriptions. 382 on ....................................... ....... 3S3 . Khundaruttu Jutaku described ..................305 f. Mahadeva, father of Ganapati of Kaachipura 197 78 . . . ............ 16
Page #422
--------------------------------------------------------------------------
________________ 894 = Mahamayurt, the great spell in the Bower ****** *****...... MS. 350, 366 ff. Mahanistham, the name of the second Chhedasutram 181; various mentions of it 183 maharajadhiraja .97, 253, 254 Maharashtri Prakrit discussed 264 f.; its relation to the popular tongue........265 ff. Mahipala, a copper-plate grant of, noted...... 98 Malayagiri, his commentary on the Suriyapannatti 20; his commentary on the Chamdapannatti. 20 Malika-jarika, story of Princess 160 ff. Mallikarjunariya of Vijayanagara. .............. 821 manusstha, the, described 381 f. Maravarman: Sundara-Pandya 344 Marco Polo, possible identification of Sender Bandi 122 marriage in folktales; fairy with a human being 164; postponement of 188: invitations to a, in Madras 193: customs among the Chins 223; of the Parsis 113 ff.; the Shans, mere cohabitation on the increase 119, the forbidden degrees of consanguinity 119, proposals for marriage 118, burial ceremony of unmarried persons 118 songs of the Parsis **********.... ************** ********** 161 ************** ************ Mati, ruins of Maung Maung, King of Burma, son of Naungdoji ....... 289 Maung Zinga 384 Philip de Brito metamorphosis in folktales, fairy into a female monkey metempsychosis among the Malagasy men into serpents 251; resurrection after partial decomposition ******************* 252 Minakshi, goddess of Madura..................... 362 Mindon, King of Burma, son of Pagan Min. 290 minba prince .....289 note mixed Sanskrit, described 244 f.; a Buddhistic language 247; is a manner of writing Prakrit 275; is a special literary orthography 245:- Rajendralala Mitra on, criticism of 245:- Burnouf on, criticisms of 245:- origin of 246 ff.; nature of 245; characteristic peculiarity of 246; development of 246; period of 244 f.:- disappeared on the introduction of Sanskrit 246; its relationship to Sanskrit months, Jain names for the 16; Jain notions on the calendar 16, on the lunar 16:lunar, zodiacal sign quoted instead of months, Hindu lunar, names of the, men. tioned in recorded dates: ............................... ..................... Asuji (Asvina) Chaitra Chaitra (MS.) Jyeshtha.......... *************** .... ************* ************* ........................................... ********************** INDEX. 113 ff. 319 ******...................... 246 49 48 97 ************* 49 ... 57, 122, 197 Karttika Marga **************** **************** Margasiraha (MS.)...... Phalguna (MS.) Vaisakha........ ...............................................................47, 48, months, Hindu solar, names of the, mentioned in recorded dates: Makara.... Mithuna Mesha (MS.) Mesha Rishabha Simha 48 ..256, 277 51 **************** ***************** ************* *************** ***................******* **************** ************* 34 .121, 341 12. Vrischika....................................... 32 25 ************* ******************** ..............................***** Mudgagiri = Mungri Mugdhavabodhamanktika, a notice of an edition of ................52 Mugdhavabodhimauktika is a handbook of Sanskrit Grammar muhurtas, Jain names for the Mulasutram, the first described 310 f., 327 ff.; the second described 327 f; the third described 329 f.; the fourth described...369 ff. Mulasutras of the Jains discussed.309 A Mummadamba, the mother of Prata parudra 198 f. Man, language=Talaing...00000 HOAT 377 Mungir = Mudgagiri 251 Munja, a king overthrown by Taila II.......... 168 murder, compensation for, among the Shans. 119 Mwo Nat, a spirit of the Chins .... 191 ***************** ****************** ************* ****************** 323 12 *********....... 350 ************* n, dental, in monumental Prakrit ............ 259 , palatal, irregular use of, in monumental Prakrit.............. ************** 260 n, cerebral, in monumental Prakrit... 259 Nagarajas, a discussion on the 361 f.; identification of the....... Nagas, the Black, a note on............. 364 Nagis, a note on the 364 Nahapana, the Khaharata king destroyed by Gotamiputa Satakani ........................... 204 nakshatras, Jain notions on the connection of the moon with the 16 f.; Jain tutelary divinities of the *************** **********.. ........ 16 nakshatras, names of the, mentioned in recorded dates : E 1 Anuradha ****************** .....48, 121 48 **************... Asvini............................................. Kara (Hasta) **************** 49 Krittika ************** ..47, 321 Punarvasu................................. 343 ******************* Rohini ***********.. 122 Sravana ..51, 322 Simha ......................................... 48 Uttara-Bhadrapada ............................................................. .48, 122 Uttarashidh& *********************** Vis&kha 122 344
Page #423
--------------------------------------------------------------------------
________________ names, male, for queens 199 and note:proper, of persons, among the Chins....... 223 naming customs among the Shans 117: of ***.***... the Burmese and Shans borrowed direct ......117 note from India... Nandi-Samgha, another name of the Balatkara-Gana Nandisutram, a notice of the 293 f.; a detailed description of 294 ff.; commentaries on...... 301 Nasika = Nasik, mentioned in the Bharaut 225 inscriptions nat spirit in Burma 191: worship of, noted. 381 Naungdoji, King of Burma, son of Alompra.. 289 97 Nayapala, mention of... Niraydvalikas, the eighth to the twelfth upangas of the Jains 20 ff.: contain legendary accounts of the Kala Princes, sons of the Anga king Seniya of Champa 21 ff. Pisthajjhayanam, the first chhedasutra......180 f. Nilisara, a note on the Deccan College MS. of the ********** 84 north, the, an unlucky direction in Madras. 193 numeral-coefficients, use of, in the Lushai .....................................**** ********* *****..... 126 language numerals, declension of, in the inscription at Girnar. 6, at Kapur di Giri 13, in the remaining edicts 104: denoted by letters of the Alphabet, in Jain MSS........ .............. 214 *************** INDEX. caths, among the Chins 223: among the Karennis ....................................********** 159 ***************** 318 278 ocean, leaping the, in folktales odour of mortals destructive to fairies... 165 Edipus, variant of the tale of, in India...... 47 offerings to godlings in Bengal 28:- a list of ................ 96 omens in Madras 318:- bad, in Madras 168; . in Malabar 279; in South India 224; for a journey in Madras 193:- good, in Malabar 279; for a journey in Madras 193: -- of rain, flying foxes seen in the day time 278: words of ill omen, "no" 93:on birth of son 374:- jackal's howl 341; donkey's bray.... 341 Oragalla Worangal ..................... 197 note orthography of the Bower MS. 350:- of the mscriptions of Piyadasi discussed 171 ff.; obeyed learned historical influences 155; shews a tendency towards a learned 146, 149; is not strictly phonetic 149, 155; Semitic influence on, noted 175:- of the monumental Prakrits ................ 254 f. Orugalla Worangal ............. 197 note owl a bird of bad omen in South India O'.yu-t'o of Hiuen Tsiang identified. ............ 320 *********. ...... 224 ***********... pd male in the Tibeto-Burmese languages. 126 Pagan Min, King of Burma, son of Tharawadi 290 Pagat, caves at, described .................................................. 377 f. pahuda and pdhudapahuda, divisions of the Suriyapannati painnam, the first described 108 f.; the second described 110; the third described 110; the fourth described 111; the fifth described 111; the sixth described 112; the seventh described 112; the eighth described 112; the ninth described 113; the tenth described...... **********.... ...............177 f. painnas, scattered pieces relating to the Siddhanta texts of the Jains..............106 f. Paisachi Prakrit discussed ..........261 ff. palace, subterranean, tale of a 186 f. Palas, genealogy of the .....................98 f., 254 Palaungs, a tribe of the Shan States. 116 Pali, date of......... 271 17 pamana year of the Jains, the Pamchanamaskara, the, discussed........... 213 168 Panchala, a king overthrown by Taila II. Pandimandalam conquered by Kulottunga-. Chia .282 f. ************* Pandya, the Southern, conquered by Kalottunga-Chola............ 282 Panthays in the Shan States................. 116 Parabala of the Rashtrakuta family = 254 Govinda III. Paral, a sacred pagoda near Trichur... 96 Paramabhattaraka....... 253 253 97 96 277 Parametvara = ***......... 395 *******.... ********... ************** www ************* *************** *********... ***********... Paramesvara-Paramabhattaraka *******... Parola = Paral parrots, kingdoms of the Parsis, marriage customs of 113 ff.; nuptial ..113 ff. songs of the.... Pataliputra Patna, mentioned in the Bharaut inscriptions......... Patna Srinagara = Pattavalis of the Digambaras, detailed description of three 63-83- a notice of three...................... ..............................................................57 ff. Paungasa, a title of Maung Maung, King of Burma 289 note Pega, antiquities of, described...383 ff. 165 penance in fairies Phao, a name for the Taungoos. ................... 379 Phopho, the great nat at Thaton, account of... 381 pilgrimage, an object of, to be cured of dumbness 96, to attain literary perfection... 96 Piyadasi, inscriptions of 243 ff., 258 ff.; chronology of 203 ff.; Semitic influence in the orthography of, noted 175; their linguistic value summed up 174: language of, discussed 166, 85 ff., 145 ff., 171 ff., 203 ff.; divide themselves into two types by lan ******************* *************** *********** *********.. *************** 14 ............................................................ 225 254
Page #424
--------------------------------------------------------------------------
________________ 396 INDEX. pronouns, declension of, in the inscriptions at Girnar 6 f., at Kapur di Giri 12 f., iu che remaining edicts ............ .............. 103 Proshbila, a Jain teacher ........................ 158 Pajyapada, another name of Dovanandin ...156 n. Pulumayi Vasithip uta the Andhrabhsitya 204; date of, is circ. 135-145 A. D............ 203 punctuation in the Bower MS................... 351 punishments in folktales - mutilation after death ....................... ...................... 376 ...... Punyavachanam, purification rite in Madras.. 198 purification rites in Madras......................... 193 quantity, grammatical, not shewn in the inscriptions at Girnar, 2- changes of, in the inscriptions at Kapur di Giri, 2, in the remaining edicts .......................... 85 queen = wife of local magnate in folktales 45 noto queens, male names for ..................199 and note guage 210, into two dialectic groupe 171 f.; do not faithfully represent the dialect of the country in which they have been engraved 172 f.; do not pretend to invariably represent in their integrity the sounds of the spoken language 146, 149, 155; subdialecte discernible in 172:- Sanskrit not a fixed language at their date 175:- grammar of, discussed, at Girnir 2 ff., at Kapur di Giri 8 ff., of remaining edicts 85 ff.:-notes on some general grammatical points 146 ff., 155:- detail of the conjugations at Girnar 7 ff., at Kapur di Giri 13 ff.; detail of the grammatical inflexions at Girnar 5 ff., Kapur di Giri 11 ff.; detail of the phonetics at Girnar 2 ff., at Kapur di Giri 8 ff., of remaining edicts ............. .................85 it. Poi (see Baungshe) .............. ................... 190 polygamy among the Shan ......................... 119 Pondicherry, real name is Puduchcheri......... 327 Prabhachandra, a Jain Achurya, of about the seventh century A. D., who died at Sravana-Belgo!a ...........................158 to 160 Prakasananda, his probable date ................. 28 Prakrit, shews signs of culture in the time of Piyadasi 177:-monumental and literary discussed 258 ff.:- literary, date of use of, discussed 267 1., 270, fixed between the 2nd und 4th centuries A. D. 276; is an artificial dialeet 261, not understood by the people 261 ff.: is not a faithful representation of the popular tongue 264; origin of 373 f; characteristics of 261 ; its relation to monumental, discussed 268 ff. ; never appears on monuments 261 :- monumental, period of 25; is one dialect 260; is not a faithful representation of the popular tongue 260 f.; is not subject to rigorous rules 261; characteristics of 258 f.; ita relation to literary, discussed 268 ff.; never appears in literature 261 Prataparudra was the 7th of the Kakatiya dynasty 199; his descent from Ganapati of Kanchipura............. .............. .................. 198 1 Pratapurudrayabobhishana, its value to prove the genealogy of Ganapati of Kanchipura. 198 f. Prataparudriya, see preceding word. Pravachanaparlleshd of Dharmasagara, wrong as to Vaghela dates ............. 277 priests among the Chins ............................ 191 prince = local magnate in folktales.........45 note princess = wife of local magnate in folk tales .................................................... 45 note Prularaja = Prola, a Kakatiya king of Worangal 197: ancestor of Ganpati of Kanchipura 97; constructed the Jagati kesari-tataka tank ......... Prola (see Prudaraja). ............... 168 r, only one sign to represent, in the Piyadasi inscriptions ..................................... 175 Rajaraja-Chola, inscription of, quoted......... 282 Rajendra-Chula, a name for Kulottunga Chola 283 ; inscription of, quoted ............ 282 Rajiga of Vengi = Kulottunga-Chofa ......... 283 Ramannadesa, is now the Talaing country of Burma 377; was the ancient Talaing king dom 377; antiquities of, summed up........ 386 Rannadevi, wife of Devapala, daughter of the Rashtrakuta Parabula ............................. 254 Rashtraktas of Malkhot; they were over thrown by Taila II. in A. D. 973-74 ...167, 168 Rattas, = Rashtrakatas ....... regnal years, use of, in recorded dates 121, 122, 254, 282, 286, 313, 344 ri, the vowel, not known ut time of the Piya dasi inscriptions........................................ 176 Rung Nat, a spirit of the Chins .................. 191 Rudra = Maharaja-Rudra = Rudramba, daughter of Ganapati of Kasichipura......... 199 Rudradaman of the Girnar inscription lived temp. Vasithiputa Satakani 204; and temp. Siriyawa Satakani 204; commenced to reign circ. 150 A. D. ...... Rudradova, ancestor of Ganapati of Kanchi. pura 197; was a Kakatiya king of Worangal 197 Rudramba = Rudra = Maharaja-Rudra 199; was the 8th of the Kakatiya dynasty... 199 6, palatal, a test letter in the Bower MS. 349 f. ; or at the date of the Piyadasi inscriptions ................ ............................ 176 sacrifices among the Chins .................191, 216 Sagyilanng Chins, geographical distribu tion of the .......................................... 190 Sah@t-Mahet, a note on........... 320 ... 197
Page #425
--------------------------------------------------------------------------
________________ Chapa (or Dhanuh) Mesha ******************* Simha ........................ Tavura mouth of 186: charm against snake-bite Saka era (see era), commencement of 203: - its use in Cambodia 47 f., in Java....... 48 Sakyamuni Buddha in the Bharaut in ******************** 350 ff. Sevana, Yadava king = Ramachandra of Devagiri 200; defeated by Prata parudra... 199 Sevana Country = Seuna = Sinnar in Nasik District 199, also Devagiri sh is later than the date of the Piyadasi inscriptions............. ********.... 197 ************ 214 ************** scriptions 226 Salsette, folk lore in ..................23 ff., 45 ff. Samanta-Bhoja Dochi, governor of Kanchi, endows the Ekamranatha temple Samdehavishaushadir, a commentary on the fourth chhedasutra sha, the letter, is a test letter in ancient ******************** sashkranti, zodiacal sign, mentioned in a Indian Alphabets 30 recorded date instead of the lunar month... 49 Sha-chi of Fa-Hian identified............. 320 saskrantis, names of, mentioned in recorded Shan States, tribes of the, enumerated 116; dates:tribal divisions of the 71: a legend of the 120, 121:- customs of the 116 ff.; naming customs of the 117f.; war customs of the 120 the cosmogony of the 121:their ideas as to the origin and cause of disease 119: their law of inheritance 119, 120 instances of cannibalism amongst the ....................................... 120 Shasthavu : = Ayyappan shrew, taming of a, an Indian folktale...... 317 Shweaungyo Pagoda at Pegu, note on 385 Shwebo Min = Tharawadi, King of Burma.. 290 Shwegagale Pagoda described..................... 384 Shwegugyi near Pegu, notes on the ruins at ****************** 96 383 f.; inscriptions at...383 f. Shwemodo Pagoda described .................... 385 Shwenaba Pagoda described .................. 384 f. Siamese rule in Burma, traces of....... ..... 378 sibilants not distinguished in the inscriptions of Piyadasi... 176 ************ Siddhanta, a list of texts in the Jain.........372 f. Siddhantaleea, note on the ......... 28 Siddhantamuktavali, a notice of the............. 28 Siddhartha, a Jain teacher.... 158 Siharaja of Thaton, account of .................. 380 Simhana probably the Yadava king Singhana II. of Devagiri 198; defeated by Ganapati of Kanchipura ..... 197 S'inbyamayin, mother of Sup'ayalat .... 290 f. S'inbyuyin, King of Burma, son of Alompra 289 Singhalam (Ceylon) invaded by Kulottunga-Chola ******************** ...... 282 Singusa, King of Burma, son of S'inbyayin. 299 Siri Polemaios of Ptolemy Pulumayi Visithiputa .......... 204 Siriyana Gotamiputa Satakani the Andhrabhritya. ********* = 204 Siyin Chins, geographical distribution of 190 the sleep, aspect of, in Madras ................ 193 sleeping beauty, variant of the tale of 186 f. snake (see serpent). ***...........................********** sankrantis, names of, mentioned in MSS. dates: Chaitra Karkata Mesha *************** : ************* = 49 49 ************* ..49, 50 Samudra Gupta- probably Dharmaditya... 45 sandhi in the inscriptions at Girnar 5, at Kapur di Giri 11, in the remaining edicts Sanskrit (see mixed Sanskrit): 90 ************** origin of 246 ff.; is a Brahmanical language 247 not a fixed language at the date of the inscriptions of Piyadasi 175:not yet a written language in the time of Piyadasi 177: in its ultimate form did not exist in the time of Piyadasi 177:proof of the date of introduction of 247: first inscription in, is dated 155-160 A. D. 244 classical first used in 2nd century A. D. 275, elalorated after 3rd century B. C. 275:- additions to the vocabulary of, as evidenced in the Bower MS...... .......131 f., 351 Sanskrit, inscribed tablet from Pegu 385; is Genl. Cunningham's "Buddhist seal"...... 385 Santichandra, the commentator of the Jombuddivapannati Sarada alphabet, a note on the ...............31 note Sarasvati-Gachcha of the Digambaras, merely a side-branch of the main line 59 Sauraseni Prakrit discussed 264 f. scapegoat, the, an instance of, in Tibet ...... 376 sculptures, supposed Vaishnava, from Thatun 381 Senas, the accession to power of the, was circ. 19 ************ ***********....... ********** 128-130 A. D...... Seniya, king of Champa, legendary account of his sons .................................. ************ *********** : INDEX. *************** 48 48 serpents, superstitions as to, in Madras 224:among the Malagasy are embodied spirits 251, seven-headed 251:- jewel in the 49 47 21 ff. - 397 ************ ************* ***************** 199 177 sneezing, a bad omen in Madras ............... 168 Sochaung Chins, their language.................. 216 solar astronomy of the Jains .15 f.
Page #426
--------------------------------------------------------------------------
________________ 398 INDEX. 199 first ............. ... 110 . .............. 14 ............ . ... ...... 117 Soma, wife of Ganapati of Kanchipura ......... Surishtra, chronology of the kings of.........203 f. Somasundara, commentator on the first Sariyapannatti, a most important work on painnam .............. Jain astronomy .............. ............... 14 Somavamsa, the, included the Western Cha- Suriyapannatti Bhagavats, is the fifth upas. lukyas .................... 168 gam of the Jains........ Somesvars II., Western Chalukya.............. 283 Suryaprajnapti = Suriyapannatti, q. o. ...... 14 son, only, in folktales 23;- youngest, the, in Suttanippan, a Taungfa MS. work, described. 379 folktales, his doings ....... ...............312 ff. Svetambaras, separated from the Digambaras Sona and Uttara, the Buddhist missionaries, in the time of Bhadrabahu ..................... in the time of Bhadrababu ... 59 images of, at Kokbennsyon Hill 381; story of, doubtful........................................... 386 songomby, a mythical animal of the Mala- t and k, confusion of, in Haka Chin ............ 128 gasy ................ ............... 251 tablets, glazed, see glazed bricks. sons, three, in folktales 312: seven, in folk- tabu, limits to cohabitation among the Shans tales .............. 119:- forbidden occupation to busbands of ........................... 160 Sophia, nickname of Sap'ayllat ...........290 note lying-in women among the Shans 117 :spells in Ancient India ........ forbidden articles of food to lying-in India ... ..................... 3+9 ff. spirit=fairy 165 :- loses " virtue" by touch women among the Shans 117:- forbidden ing a human being .165:- haunts of, in things to women during a war expedition Madras 279:- Chin notions of 216; of a among the Shans ............... ................... 120 tree, among the Chins 191; of the forest, Tai family of Shan Tribes, the................116, 117 among the Chins 191:- worship of, in Taik'e = Chinese Share ............................ 117 Madagascar .............................................. 251 Taikkuld is Ayet bema ............................... 383 Sravana-Belgola; remarks on the real purport Taila II. (Western Chalukya) established the of an inscription here, which has been dynasty, by overthrowing the Rashtra supposed to mention the Sruta-Kevalin katas, in A. D. 973-74 ............. 167 Bhadrabahu ............ 156 Taileng = Taitau ............ Srinagara = Patna ........... ... 25+ Tainamkam, a division of the Northern stone, turning into, in folktales .................. 189 Shans ................................................ 117 substituted person in folktales : wife 341 f.; Tainu = Northern Shans.......... 117 children ..........................................374 ff. Taitau = Southern Shans ......................... 117 subterraneous palace, a story of a ............161 ff. Talaing Country, the 377; ancient kingdom succession, rule of royal, brothers before sons of 377; language 377; its epigraphic and 287 ff. :-- practical application of 288: historical value 377; MSS. at Pagat...... 377 f. obtained in the Eastern and Western Tashon Chins, the geographical distribution Chalukya dynasties 288; in the Valabhi of the 190 ; geographical boundaries of the Line 289; in the Maler-Kotla State 283; 190; polity of the 190; names of their in Manipur 287; in the Shan States 288; chiefs 190 :- speak nearly the same language in ancient England 292 f. :- authority for, as the Baunghe Chins ........................190 f. from the Jitukas ......... tatsanas, in the inscriptions of Piyadasi...... 147 f. sudden action, a bad omen in Madras tattooing among the Chins ........................ 222 - noises unlucky in Madras ............. 318 Taung is, a Burmese tribe 205: origin of the Sukulava, a Malagasy tribe ........................ 250 215 f.; border on the Welaung Ching ...... 215 Sundar Bandi=Sundara-Pandya................ 122 Taungfus, notes on the 379 ff.; their lan. Sundara, a note on kings and princes in guage 379; their alphabet, its value historiS. India bearing that name ..................... 122 enlly .... ......... ........................ 379 Sundara. Panelya, materials for calculating Telunga = Andhra = Trikalinga = Trilinga 198 the date of 121 f.; his date settled by terminations, verbal, in the inscriptions at an inscription at Srirangam 121; bis Girnar 7 f., at Kapur di Giri 13:- verbal, accession falls between Saka 1162 and 1180, conjugation of, in the remaining ediets ...105 f. 122; Saka 1182 expired is the only year Thagyap'aya at Thaton, a note on the corresponding to his inscription 122 : glazed tablets on the......... .............. 381 = Jatavarman 122; (Jatavarman) distinct Tharkwadi, King of Burma, grandson of from Sundara-Pandya (Mar&varman) 344: Bodop'aya ..................... ............... 290 Marco Polo's Sender Bandi ................. 122 Thaton, a visit to 3R0; is the Suvanyabbami sipayd = royal princess ..................... 290 note of the Buddhist books 380; is the Aurea Sup'ayalat, Queen of Burma, wife of Thibd...290 f.! Regio of Ptolemy ............. 380 .......... 291
Page #427
--------------------------------------------------------------------------
________________ INDEX 399 Thebaw, Thecbaw = Thibo ................. 290 note Theobald, nickname of Thibo ............... 290 note theravall, the, of the dasiu, discussed .......... 212 Thibaw = Thibu .............................. 290 note Thibd, King of Burma, son of Mindon ...... 290 f. Tiastanea of Ptolemy Chashtana, grandfather of Rudradaman ...... . ......... 204 tithis method of quoting in MS. ............ 57 titles, Burmese, explained..................... 289 note Tirukkalukkugram inscription of Kulottunga Chola is dated 1105 A. D...................... 283 Tizaung Pagoda, the, visited ..................... 382 Tlantlang Chins, geographical distribution of the ............ ............... 190 to, the, of Burma is the Assyrian winged bull, degraded ............. .... .. 382 tokan-dia, a mythical amimal of the Malagasy 252 tones, a note on, in Tibeto-Burmese languages 128 Tribhuvanamalla, a biruda of Betmaraja...... 197 tricks in folktales .................................... 24 ff. Trikalinga = Andhra = Telunga = Trilinga 198 Trilinga, origin of the name ..................... 199 Tyagavalli, wife of Kulottunga-Chola ......... 282 Vikramaditya VI. (Western Chalukya) 283; his war with Kulottunga-Chola ............... 282 Vilivayakura, lived temp. Vasithiputra Sata kani ................................................... 204 Vipasyin, a Buddha mentioned in the Bharaut inscriptions ..........................................226 Vira-Kanda-Gopala =Kanda-Gopaladeva of the Kanchi inscriptions 122 : = Madhuvantaka-Kottappi-Chola 122; is conquer ed by Sundara. Pandya ......................... 121 Vira Rajendradeva = Kulottunga-Chola ... 283 Visakha, a Jain teacher .......... 158 Vigbnudova, a Jain teacher........................ 158 Visvabha, a Buddha mentioned in the Bharaut inscriptions......... 226 Visianagram Sanskrit Series, a notice of the 28 vowels, the inscriptions of Piyadasi in Indo Baotrian characters, do not distinguish between long and short 146 :- changes in the quality of, in the inscriptions at Girnar 2, at Kapur di Giri 8, in the remaining edicts 86 :- additional, in the inscriptions at Girnar 2, at Kapur di Giri, 8, in the remaining edicts 86:- suppressed, in the inscriptions at Girnar?, at Kapur di Giri 8, in the remaining edicta 86 - shortened, in the inscriptions at Girnar 2, in the remaining edicts 86:-- lengthened, in the i scription at Girnar 2, in the remaining edicta 85 f.:- contracted, in the inscriptions at Girnar 2, at Kapur di Giri 9, in the remaining edicts 86 f. :-nasalized, in the inscriptions at Girnar 2, at Kapur di Giri 9: -long not marked in the N.-W. Alphabet of India 175:- use of modified, in the Mongoloid Hill tribes ................... 125 Ujjain, the traditional migration of the Jains from .............. ................ 158, 160 upanayanam, the custom of investiture with the sacred thread in Madras ................. 193 unlucky words in Bengal,"no" ................ 344 o, omission of, in the Prakrita.................. 259 EUR. Vagh6lA kings of Gujarat, chronology of 276 f.: genealogy of some of the ............ 277 Vaidisa Bisnagar mentioned in the Bha raut inscriptions ............ ............. 225 vakahaskdra, a division of Jambuddhapan natti .............. Vasithfputa Chaturapana Satakaai . the Andhrabhsitya ........ 204 Vazimba, a Malagasy tribe 250 ; veneration for the graves of the ............................ 251 V6dae, language of the, was a cultured lan guage, 3rd century B 0 ............................. 275 vendetta among the Chins ... ................ 216 Vongi, Rajiga, lord of, - Kulottunga-Choja 283 Vidhusuta, day of the week.in MS. Wed. nesday ................................................. ............... 49 Vigrahapala, a copper-plate grant of ......... 97 ff. Vijayaditya VII., viceroy of Vengi ............. 283 Vijayapura of Jayaditya's inscription - not yet identified ..................... .................. 170 Vikkilan = Vikramaditya VI. of the West ern Chalukya dynasty .......................... 282 Vikrama-Chola, inscription of, quoted ......... 282 Vikrama-Prabandha, note on the ............... 83 Vikramaditya IV. (Western Chalukya) ...... 168 wd, bird or fowl, spread of the root in the Tibeto-Burmese language........................ 125 Wagara, a note on the remains at 377; on * King WAgard ............ ............. 377 war-prince, the, of Burma ............... 290 1. note Was, a tribe in the Shan States .................. 116 Welaung Chins are of Baungshe Chin origin 215: geographical distribution of ............ 215 widows, right to remarriage among the Shans 119 wire women in folktales ...........................187 f. women, variant of the tricks of............186 f, 278 y, omission of, in tu. Prakrits 259:- in the Prakrita represents Sanskrit soft consonante 259 ya, notes on the aksharas of the letter 39 f.: - is a test letter in ancient Indian alpha. bets 32 f. the ancient form of, not . known after 600 A. D. 33:- the form of, shews the Bower Manuscript was written between 350 and 500 A.D. ...............34 ff., 37
Page #428
--------------------------------------------------------------------------
________________ 400 Yabemyo near Pegu, notes on the ruins at 383 f.; inscriptions at Yazadarit, the title explained. year, Jain ideas on the 17:Saturn 17 the lakshana, of the Jains 17: the pamana, of the Jains 17:the Jain nakshatra, of 327 5} nukhthemera 17: the Jain lunar, of 354 1 nukhthemera 17: 51 INDEX. 383 ............... 386 the Jain of name of a, quoted in MS., Hemalambha... 57 Yindu Chins; geographical distribution of 215; border on the Chinbok Chins 215; claim descent from th Taung das........... ..... 215 Yndopherres = Gondophares Gudupharas. 207 yogas, names of, mentioned in recorded. dates: 49 Subha Vyatipata 48 f. Yokwa Chins, geographical distribution of the... 190 yuvardja, Burmese form is enshemin ......... $290 = ****************** ********** Zainganaing, a suburb of Pegu, antiquities of, described..... 383 f. Zinga, Maung, Philip de Brito 384 **********
Page #429
--------------------------------------------------------------------------
________________ ERRATA IN VOL. XXI. p. 157, line 26, for and built, read and built. > 27, for there," read "there." p. 347, lines 43 and 52, for "Horse and Bull Coins" read "Cock and Bull Coins."
Page #430
--------------------------------------------------------------------------
_