Descriptive Catalogue of Govt Collections of Manuscripts Part 3

Author(s): Hiralal R Kapadia
Publisher: Bhandarkar Oriental Research Institute
Catalog link: https://jainqq.org/explore/018039/1

Page #1
GOVERNMENT COLLECTIONS OF MANUSCRIPTS BHANDARKAR ORIENTAL RESEARCH INSTITUTE POONA FOUNDER 1917 Published by Bhandarkar Oriental Research Institute 1940

Page #2
DESCRIPTIVE CATALOGUE OF MANUSCRIPTS IN THE GOVERNMENT MANUSCRIPTS LIBRARY PREPARED UNDER THE SUPERVISION OF THE MANUSCRIPTS DEPARTMENT OF THE BHANDARKAR ORIENTAL RESEARCH INSTITUTE, POONA INSTITUTA POONA FOUNDED 1917 tejasvi "naavdhiitmstu|| Bhandarkar Oriental Research Institute. POONA 1940

Page #3
Copies can be had direct from the Bhandarkar Oriental Research Institute, Poona 4 (India) Price: Rs. 5 per copy, exclusive of postage, Printed and published by Dr. R. N. Dandekar, M.A., Ph.D. at the Bhandarkar Institute Press, Bhandarkar Oriental Research Institute, Poona No. 4 (India)

Page #4
Descriptive Catalogue of the Government Collections of Manuscripts deposited at the Bhandarkar Oriental Research Institute COMPILED BY HIRALAL RASIKDAS KAPADIA, M.A. Volume XVII: JAINA LITERATURE AND PHILOSOPHY Part III: (a) Agamika Literature Bhandarkar Oriental Besearch Institute POONA 1940

Page #5

Page #6
PAGE PREFACE XV-XXVI RULES FOR THE GOVT. MANUSCRIPTS LIBRARY XXVII-XXIX LIST OF CATALOGUES AND REPORTS XXX-XXXIII SYSTEM OF TRANSLITERATION XXXIV CONTENTS 667 668 A. AGAMIKA LITERATURE No. 644-649 Uttaradhyayanasutra PART III VI. 4 Mulasutras' The First Mulasutra 650 Asamskrtadhyayana ( Uttarao IV ) 651 Namipravrajyadhyayana ( UttaraR IX) 652 Moksamargagatyadhyayana (Uttara XXVIII) 653-661 Uttaradhyayanasutra with Sukhabodha 662,663 Sukhabodha (Uttaradhyayanasutravrtti) 664 Uttaradhyayanasutra with avacuri 665 Do Do vrtti 666 Do Do Do Do Do Do Do aksararha Do aksararthalavalesa Do 669 670 671 672 Uttaradhyayanasutradipika 673 Do Do Do vrtti Do dipika Do Do PAGE 1-14 14, IS 15,16 16,17 17-33 34-37 37,38 38-40 40,41 42,43 I Under this head are given six works and not four. See the Preface (p. xviii) 2 The works having the same title are here separately noted, when the identity of their authorship remains to be settled. 43,44 45,46 46-50 50-52 52,53 53,54

Page #7
Contents No. Page 54.56 675 DO 56-58 58-60 60,61 678 62,63 63,64 64,65 66,67 68,69 70-72 Uttaradhyayana sutra with balavabodha Do Do tabba 676 Do Do and katha 677 Do Do aksararthalavalesa Do Do balavabodha and katha Do ( XVIII-XXI ) with tabba 680 Mahanirgranthiyadhyayana (Uttarao XX) with tabba 681 Uttaradhyayanasutraniryukti 682 Do with tika 683 Sisyahita ( Uttaradhyayanasutrabshadvrtti) ... 684 Uttaradhyayanasutrabehadvittigatakatha pratisamsksta 685-687 Uttaradhyayanasutrabihadvrttiparyaya anasutravacurni 689 Uttaradhyayanasutravacuri 690 Do Do 692 Citra-Sambhutiyadhayana(Uttarao XIII)vyakhya 693 Uttaradhyayanasutrakatha 694 Do 695,696 Uttaradhyayanasuirakathasamksepa 697 Uttaradhyayanasutra (I-IX ) with kathas 698 Pratyekabuddhacatustayacaritra 699 Do 700,701 Manusyabhavadurlabhatasucakadasadrstanta 72-74 74,75 76 77 69" 77,78 78,79 79,80 80,81 81,82 83,84 85,86 86,87 87,88 88-90 The Second Mulasutra 702 Dasavaikalikasutra (I-IV) 703 Do (I) ... Do with Culikayugala ... 709 Do Do Do , niryukti and tika 710,711 Dasavaikalikasutraniryukti 712 Dasavaikalikasutradibihadvittyavacuri ... 91,92 92,93 93-102 704-708 103-107 107-111 111, 112

Page #8
Contents vii No. PAGE 713-715 Dasavaikalikasutrabehadvsttiparyaya 113,114 716,717 Dasavaikalikasutra, Culikayugala and tika ... 114-118 718,719 Dasavaikalikasutratika ... 118, 119 720 Dasavaikalikasutra, Culikayugala and avacuri : ... 120, 121 721 , Culikayugala and avacuri 2 121, 122 722 , Culikayugala and avacuris ... 122, 123 723 , Culikayugala and avacuri + 124, 125 724 Do Culikayugala and tabba. 125-127 725 Dharmopadesa (?) with vyakhya 127, 128 726 Dasavaikalikasutra-Culikayugalavacurni s 128, 129 727 Do 6 728 Dasavaikalikasutra-Culikayugalavacuri 7 729 131 Do I 29 130 Do 8 Do Do Do The Third Mulasutra 730-733 Sadavasyakasutra 132-147 734-740 Namaskaramantra ( Navakarmantra ) 148-164 741 with balavabodha ... 164, 165 742 Do ... 165, 166 743 Do Do Do ... 166 744, 745 Namaskaramantravivarana ... 166-168 746-748 Prabodhacaityavandana ( Jagacintamaniceiyavandana) ... 169, 170 749-752 Tirthavandanasutra ( Jarn kinci) ... 171, 172 753-758 Sakrastava ( Namutthu nam) 173-175 759-762 Sarvacaityavandana ( Javanti ceiyain ) 176, 177 763-766 Sarvasadhuvandana ( Javanta ke vi sahu) ... 178, 179 1-4 The author of the avacuri seems to be different, in each case. 5-6 These avacurnis do not seem to have been written by one and the same author. 7-8 These two differ so far as the author is is concerned. . . 9 This and the following works up to 883 are mostly arranged as on p. 134.

Page #9
viii Contents No. Do Do 782 Do PAGE 767-774 Upasargaharastotra ( Uvasaggaharathotta ) ... 180-184 775 with laghuvstti 184,185 776-779 Do Do Arthakalpalata 185-188 780 | Do vrtti 188, 189 781 Do Do tika 189, 190 Do Do vrtti 190, 191 783 Do avacuri 191, 192 784, 785 Upasargaharastotravstti 192, 193 786-789 Prarthanasutra ( Jaya riyaraya ) 194-196 790-794 Tryapathikisutra (Iriyavahiyasutta ) 197-199 795-799 Uttarikaranasutra ( Tassa uttari) 200-202 800-805 Kayotsargasutra ( Annattha ) 203-205 806-813 Kayotsargasutrapratika 206-208 814-818 Namastava ( Logassasutta ) 209-211 819-825 Caityastava ( Arihantaceiyanam) 212-214 826-829 Caityastava pratika 215, 216 830-834 Srutastava (Pukkharavara ) 216-218 835-839 Siddhastava ( Siddlanam buddhanam ) 219-221 840 Caityavandanasutra with tabba 222, 223 841-844 Lalitavistara ( Caityavandanasutravyakhya) ... 224-228 845, 846 Lalitavistarapanjika 228-231 847, 848 Caityavandanasutravstti 232, 233 849-851 Samsaradavanalastuti 234-236 - 852 Do with vyakhya 236, 237 853-856 Vandanakasutra (Vandanayasutta ) 238, 239 857,858 Vandanakasutravivarana 239, 240 859-864 Daivasikalocanasutra ( Devasiyaloyanasutta ) ... 241-243 865,866 Ratrisamstarakagatha (Raisantharagagaha) ... 244, 245 867-870. Guruksamanasutra ( Abbhusthio ) ... 246, 247 871-874 Samayikasutra ( Karemi bhante) 248, 249 875, 876 Jaya mahayasah ( Jaya mahayasa ) ... 250 877-879 Acaryadiksamanaka (Ayariya uvajjhaye ) ... 251, 252 880, 881 Sri-Stambhanaka-Parsvanathastuti ( SiriThambhasaya-Pasanahathui) ... 253, 254 882,883 Samayika-pausadhaparanagatha ( Samaiyaposahaparanagaha) ... 255,256 : :

Page #10
Contents ... 282, 283 ... 284-289 Do 931 No. PAGE 884-887 Pranipatasutra ( Kbamasamanasutta ) ... 257, 258 888 Bharatesvara-Bahubalisvadhyaya ( Bharahesara-Bahubalisajjhaya) with kathakosa and tabba ... 259-265 889-894 Do with kathakosa 265-272 895,896 Mahavirasvamistuti ( Snatasyastuti ) ... 273-275 897-900 Namorhat ... 276, 277 901-905 Srutasya bhagavatah (Suyassa bhagavao) 278, 279 906-910 Vaiyavstyakarasutra ( Veyavaccagarasutta ) ... 280, 281 911-915 Sarvasyapisutra (Savvassavisutta ) 916 Munivandanasutra ( Addhaijjesusutta, .... 284 917-923 sramanopasakapratikramanasutra ( Samano vasagapadikkamanasutta ) 924, 925 with curni 290-293 926-930 Do Do Arthadipika 294-302 Do Do vivarana 302, 303 932 Sramanopasaka pratikramanasutravivarana ... 303, 304 933 Sramanopasakapratikramanasutrabalavabodha ... 304 Trividhaharopavasapratyakhyana ( Tiviharauvavasapaccakkhana ) ... 305 935 Granthisahita pratyakhyana ( Ganthisahiya paccakkhana ) ... 305, Vikrtipratyakhyana ( Vigaipaccakkhana ) ... 937 Ekasanadipratyakhyana ( Egasanaipaccak khana ) Dvivihaharaikasanapralyakhyana ( Duvihara egasanapaccakkhana ) ... 307, 939 Dvividharaikasthanapratyakhyana ( Duvihara egatshanapaccakkhana) 940 Abhaktarthapratyakhyana ( Abhattarthapaccakkhana ) .... 308, 309 Divasacarimapratyakhyana ( Divasacariyapaccakkhana ) ... 309, 310 Caturvidhaharadivasacarimadipratyakhyana ( Cauvviharadivasacariyaipaccakkhana ) ... 934 936 306 ... 306, 938 308 941 942 310

Page #11
X No. 943 944 945 948 949 946, 947 Namaskarasahita pratyakhyana (Namukkarasahiyapaccakkhana ) 950 951 952 953-960 Contents Sakarabhavacarimapratyakhyana ( Sagarabhavacariyapaccakkhana ) Sakarapratyakhyana ( Sagarapaccakkhana ) Anakarabhavacarimapratyakhyana (Anagarabhavacariyapaccakkhana ) 986 987 988 989 990 Paurusipratyakhyana (Porisipaccakkbana) Purimardha pratyakhyana (Purimaddha paccakkhana) Acamlapratyakhyana (Ayambilapaccakkhana) ... Pratyakhyanasutra with tabba Pratyakhyana (?) Do Do Paksikaksamanasutra (Pakkhiyakhamana sutta) Paksikaksamanasutravacurni 969 970 971, 972 Yatipratikramanasutravyakhyana Yatipratikramanasutravrtti 973 974 961 962 Paksikastuti 963 Namo'stu Varddhamanaya (Vardhamanastuti)... 964-968 Sramapasutra (Samanasutta) Do with balavabodha Do 975 976-983 Sadavasyakasutra with Anusthanavidhi 984, 985 Do Do Do Sadavasyakasutra ( Sadavassayasutta) with laghuvitti Sadavasyakasutralaghuvrtti ... *** ... ... *** ... and tabba ... Anusthanavidhi ( Vandaruvrtti) Sadavasyakasutra with Vandaruvrttyavacurni. Sadavasyakasutra with vrtti Do Do avacuri ... ... ... PAGE ... 310, 311 311 311 312, 313 313, 314 314 314, 315 315, 316 316,317 317-320 320-321 321 322, 323 323-328 328, 329 329 330, 331 331, 332 332-334 334 335-344 Sadavasyakasutravacuri 354, 355 1 Really speaking this ought to have been assigned a place prior to No. 969, and the latter after this. 344-347 347, 348 348, 349 349-352 352-354

Page #12
Contents 358 360 361 Do Do ... 30 ... 386-388 Page Salavasyakasutra with avacurni 356, 357 992 Do Do avacuri 993 Do Do do 359 994 Do (?) Do do 995 Do balavabodha 996 Do tabba 362, 393 997 Do Do balavabodha ... 363, 364 998 Do Do tabba ... 365-367 999 Do (?) Do balavabodha ... 367, 368 1000 Salavasyakasutravrtti (?) 368, 369 1001 Salavasyakasutrabalavabodha - 370 1002-1010 Avasyakasutraniryukti (Avassaganijjutii) ... 371-384 1011 Sthaviravali ( Theravali ) 384-386 1012, 1013 Pithika (Pedhiya ) 1014,1015 Pithikabalavabodha 388-390 1016 Prathamavaravarika ( Padhamavaravariya ) 390, 391 1017 Prathamavaravarikabalavabodha 391 1018,1019 Dvitiyavaravarika ( Biiyavaravariya) ... 392, 393 1020 Dvitiyavaravarikadipika 394 1021,1022 Upasarga ( Uvasagga ) 395 1023 Upasargavyakhya 396 1024, 1025 Ganadharavali ( Ganaharavali) 396,397 1026 Ganadharavalyavacuri 397, 398 1027 Samavasarana ( Samosarana ) 1028 Do with avacuri 399 1029, 1030 Samacari ( Samayari) 399,400 1031 Do with Dipika 401 1032-1034 Upodghataniryukti ( Uvagghayanijjutti) 402-404 1035 Do with vyakhya 404,405 1036-1038 Namaskaraniryukti ( Namokkaranijjutti ) 405,406 1039 Namaskaraniryuktivyakhya. 406, 407 1040-1042 Samayikaniryukti ( Samaiyanijjutti) 407, 408 1043 Samayikaniryuktyavacuri 409 1044-1046 Caturvimsatistavaniryukti ( Cauvisatthayanijjutti) ... 409-411 1047 Caturvinsatistavaniryuktidipika 398 411

Page #13
Contents No. PAGE 1048-1050 Vandananiryukti (Vandananijjutti ) ... 412,413 1051 Vandananiryuktidipika ... 413 1052-1054 Pratikramananiryukti ( Palikkamananijjutti ) ... 414, 415 1055-1057 Dhyanasataka (. Jhanasayaga ) 415-417 1058, 1059 Paristhapanikaniryukti ( Paritihavaniyanijjutti ) ... 417, 418 1060, 1061 Pratikramanasamgrahani ( Palikkamanasamgahani) ... 418,419 1062, 1063 Yogasamgraha ( Jogasamgaha) ... 419, 420 1064, 1065 Asatana ( Asayana ) ... 421,422 1066, 1067 Asvadhyayaniryukti ( Asajjhayanijjutti) ... 422, 423 1068, 1069 Kayotasarganiryukti ( Kaussagganijjutti) ... 423,424 1070-1072 Pratyakhyananiryukti (Paccakkhananijjutti)... 424-429 1073, 1074 Avasyakasutraniryukti ( Avassaganijjutti) with Sisyahita ... 429-432 1075-1077 Sisyahita ( Avasyakasutraniryuktivivrti) ... 432-435 1078 Sisyahitantargata-Kumaranandikatha ... 435,436 1079 Avasyakasutrabuhadvrttitippanakagatasayyatarasvarupa ... 436,437 1080 Avasyakasutraniryukti with vivsti 1081-1086 Do laghuvstti ... 439-446 Do Do tika ... 446,447 1088 Do Do avacuri ... 447,448 1089-1091 Avasyakasutraniryukticurni 449-452 1092 Avasyakasutraniryuktyavacuri 452,453 1093 Avasyakasutraniryuktyavacurni ... 453,454 1094 . Do 454,455 1095 Avasyakasutraniryuktibalavabodha 455,456 1096 Avasyakasutraniryuktidipika ... 456,457 1097 Avasyakasutraniryuktilaghuvstti 1098 Avasyaksutraniryuktyavacurni 459 1099, 1100 Avasyakasutravsttipradesavyakhyatippanaka 460-462 1101, 1102 Avasyakasutravsttivisamapadaparyaya ... 462,463 ... 437,438 Do 1087 458

Page #14
No. 1106 1103-1105 Visesavasyakabhasya ( Visesavassayabhasa) Do with vyakhyana Do vrtti 1112 Sisyahita (Visesavasyakabhasyabrhadvrtti) .. 1107-IIII Do *** The Fourth Mulasutra1 1113, 1114 Pindaniryukti IJIS 1116 1117 Pindaniryuktyavacuri 1118-1120 Pindaniryuktivisamapadaparyaya 1121-1123 Pindaniryuktivisamagathavivarana ( II ) 1124-1128 Oghaniryukti 1129-1132 Contents 1143-1149 Paksikasutra Do with tika 1133 Oghaniryuktitika 1134 Oghaniryukti with avacurni 1135-1137 Oghaniryuktyavacurni 1138 Oghaniryuktyavacuri Do 1139 1140-1142 Oghaniryuktiparyaya 1157 1158 (I) Do with Sisyahita (vrtti ) Do Do vivecana 1159 1160 1150 1151-156 Paksikasutravrtti Paksikasutravacuri (III) Do with vrtti Paksikasutra with avacuri Paksikasutravacurni Paksikasutravacuri ... ... ... ... ... 493-498 498-503 503,504 505,506 .. 506-508 ... xiii PAGE 464-467 467-469 470-476 476-480 ... 481,482 483-485 485,486 489,490 490, 491 491, 492 509 509,510 510,511 512-518 518,519 520-527 527, 528 528,529 1 Under this head, three works are given as any one of them is looked upon as the 4th Mulasutra. 529 530

Page #15

Page #16
PREFACE At the very outset it may be mentioned that since the publication of Part II of Volume XVII of Descriptive Catalogue of the Government Collections of Manuscripts, it has been decided that my work on Jaina Mss. is to be issued in three Volumes XVII, XVIII and XIX instead of two (XVII and XVIII) as settled in 1930 by Rao Bahadur Dr. S. K. Belvalkar, M.A., Ph.D., the then Hon. Superintendent of the Manuscript Department and the then Hon. Secretary of the Bhandarkar Oriental Research Institute. This is due to the fact that the original idea of publishing in one volume, all the descriptive sheets dealing with the Mss. of both the Agamika Literature and the Darsanika Literature could no longer be entertained owing to the material pertaining to the Agamika Literature alone, requiring practically an entire Volume to be devoted to it. This means a further change viz. that No. XIX originally assigned to a section styled as "Prakrit and Vernacular " henceforth represents Vol. XIX of "Jaina Literature and Philosophy", and that Vol. XX will deal with "Prakrit and Vernacular ". It is a matter of great pleasure to mention that the publication of this Part III enables me to place in the hands of the scholars a further section pertaining to the Agamika Literature, some of the Mss. of which were described by me as far back as 1930 and of which the press-copy was handed over in 1933. It is thus after about nine years and a half since I commenced the work and seven years after the press-copy of the Agamika Literature (Ritualism included) was handed over to the press, that this Part III of Volume XVII comprising 530 pages, gets published. Now a word about the procedure adopted here. As already stated in the Preface (pp. xiii-xiv) of Part I of this Volume XVII, the headings of description, the inter-arrangement of descriptive sheets having a bearing on the same text and the matter to be included in this Volume were decided by Dr. Belvalkar in 1933. I may note that the for bhale () was specially prepared when type 1 Vide "Bhandarkar Oriental Research Institute Poona Report of 1935-36" (p. 14).

Page #17
xvi Preface Part II of Vol. XVII was in press. As I then happened to be in Poona, I could include when required, the corresponding symbol, in my galley-proofs by consulting the necessary Ms. But this has not been throughout possible so far as this part is concerned; for, it has been printed during my stay mostly in Bombay and partly in Surat. Hence the discrepancy pertaining to this bhale may have remained unattended to, as I had no access to the required. Mss. I may therefore crave indulgence of the learned reader in this connection. As regards the general outlines it may be mentioned that as in the case of Parts I and II, here, too, all textual matter which appeared to me to be superfluous is enclosed within rectangular brackets [ ], while additions and alterations are enclosed within paranthesis ( ). Furthermore, the system of transliteration followed here is identical with that adopted in Parts I and II as will be seen from page xxxiv. There is, however, one change introduced here, and it is in connection with the method of giving a Serial No. for the Ms. in rectangular bracket in the top-line of a page. As already suggested in the Preface (p. xiii) of Part II, the usual method is followed here. With these remarks about the procedure I may now deal with the contents of this Part III. To begin with, it may be mentioned that as adumbrated in the Preface of Part II (p. xiv), all the Mulasutras, miscellanea, some of the Svetambara works on Ritualism and nine Appendices were to be given in this Part III. But, on finding that it was not possible to include this entire material in this very part and waiting any longer till it is completely printed off, meant exhausting the patience of the persons interested in this work, I proposed to Dr. V. S. Sukthankar, M.A., Ph.D., the then Hon. Secretary of the Bhandarkar O. R. Institute, to publish as much portion as given here. I am glad to say that he kindly agreed to my proposal, and the result is that this Pt. III gets published. Herein are treated Mss. pertaining to Uttaradhyayanasutra and Dasavaikalikasutra along with those dealing with their exegetical literature in Prakrit, Sanskrit and Gujarati. Then follows the description of the Mss. of Sadavasyakasutra and its component factors along with that of the Mss. elucidating this literature. It may

Page #18
Preface xvii be mentioned en passant that the main object of separately treating these component factors of Sadavasyakasutra and their explanatory literature has been to give due importance to these jactors--the sutras most of which constitute Avasyakasutra as visualized by Haribhadra Suri, who is well-known as Yakini-mahattaradharmasunu. Thi Sadavasyaka literature is followed by Pindaniryukti, Oghaniryukti and Paksikasutra' which are somehow looked upon as Mulasutras. This completes the treatment of all the Mnlasutras concerned. But before proceeding further, I may say a few words about the number and order of the Mulasutras. .. As is well-known to the student of Jaina literature, the traditional number for the Malasutras is either three or four; but, on his going through this Part III, he will find that six works are dealt with under this heading. This is however due to the option an individual has as to which work out of Pindanijjutti, Ohanijjutri and Pakkhiyasutta should be looked upon as the fourth Mulasutra, the other three works being, of course, Ultarajjhayanasutta, Dasaveyaliyasutta and Avassayasutta. It may be mentioned in this connection that there seems to be no hard and fast rule laid down regarding the sequence of the Mulasutras. For, different scholars have indicated different sequences. For instance Prof. A. Weber 2 in his Verzeiclmiss der Sanskrit-und Prakrit-handschriften der Koniglichen Bibliothek zul. Berlin 3 ( Vol. II, pt. II, p. x) has mentioned Uttarajjhayanasutta, Avassayasutta and Dasaveyaliya as the first three Mulasutras. He appears to believe that these are the only works that deserve to be As implied in the Preface (p. xiv ) of Part II, this was not to be included as a Mulasutra and was to be given in " Miscellanea". But, on finding that some look upon this as a Mulasatru, I thought it desirable to modify the original plan. 2 He has exhaustively discussed in Indischen Studien (vol. XVI, p. 211ff, and vol. XVII, p. IfT. ), the scriptures belonging to the canon of the Svelambura Jainas. For the English translation of these papers by Dr. H. W. Smyth sco "Indian Antiquary" (vols. XVII-XXI). 3 Catalogue of the Sanskrit and Prakrit Mss. in the State Library at Berlin. 4. The list for the arrangement of the canonical scriptures adopted by Prof. Weber was originally drawn up by Dr. Georg Buhler. Vide Prof. Hermann Jacobi's Kalpasutra (p. 14, foot-note )..

Page #19
xviii Preface styled as Mulasatras, and that is probably the reason why he has referred to Onanijjutti and Pakkhiyasutta under the heading "Anderzum weit Siddhanta gerechnete Texte". Prof. M. Winternitz, too, has followed the same order for the 3 Mulusutras, but he differs from Prof. Weber, when, in his Geschichte der Indischen Litteratur (vol. II, p. 292 ) he mentions four Malasutras instead of three, Findanijjutti being the fourth.' Dr. A. Guerinot agrees with Prof. Winternitz, both regarding the order and the number of the Miilasutras. This will be evident from La Religion Djaina (p. 79) where he has mentioned four Malasutras as under : L' Outtaraddj hayana (Outtaradhyayana ), L' Avacyaka-soutra, Le Daca-vaikalik., and Pinda-niryoukti. In Prof. Arthur Berriedale Keith's Catalogue of the Sanskrit and Prakrit Manuscripts in the Library of the India Office ( vol. II, pt. II, pp. 1262-1272 ), the Mss. of Ultarajjhayanasutta are given the first place, those of Sadavassayasutta (Avassayasutta) the second, and those of Dasaveyaliyasutla, the third. This is in accordance with Dr. Georg Buhler's list of canonical treatisies given in this Prof. Keith's Catalogue on pp. 1274-1275 and designated as "Sarvasutradhyayanoddesanirnaya". Prof. Walther Schubring in his Die Lehre der Jainas nach der alter Quellen dargestellt (p. 57 ) has noted Uttarajjhaya, Avassayanijjutti, Dasaveyaliya, Pindanijjutli and Ohanijjntti as Malasutras. Thus it will be seen that the line of procedure adopted by me differs from that followed by one and all of those occidental scholars, in two respects viz. (i) the number? of works to be included under Malasatra and (ii) their sequence. 3 I may add that it is possible to reduce the traditional number four for the Malasatras to three by bracketing Pindanijjuttt with Dasaveyaliyasutta and Ohanijjutii with Avassayasutta on the ground 1 Jarl Charpentier in his introduction (p. :o) to Uttaradhyayanasutra has done the same. He has there given a list of the scriptures as adopted by Prof. Weber and has looked upon it as the most authoritative of all. 2 My number is six and not three, four or five. 3 I have arranged the six works as under : (1) Uttarajjbayarasulla, ( 2 ) Dasaveyaliyasutta, (3) Avassayasutta, (4) Pindanijjulli, (5) Obanijiulti and (6) Pakkhiyasutta.

Page #20
Preface xix that Pindanijjutti is after all a supplement to-an off-shoot of Dasaveyaliyasuttanijjutti, and that similar is the case with Ohanijjutti. On this understanding I had a desire to deal wihh PindanijjuttiMss. just after those for Dasaveyaliyasutta, and to deal with Ohanijjutli-Mss. after those for Avassayasutta; but, as it was considered rather inconvenient to follow this line of arrangement in this Catalogue, I have not acted up to it. The late Muni Catura vijayaji, a disciple of Pravartaka Srimat Kantivijayaji had outlined this plan to some extent as can be seen from p. 25 of Appendix III of his Catalogue of Mss. of the Jaina jnana-bhandara of Limbdi ("fiaet jaina jJAnabhaMDAranI hastalikhita prationa sUcIpatra"). Consideration of space does not permit me to discuss why a particular sequence for the Malasatras, is more scientific than the rest. Consequently it thus gets reserved for being dealt with on some other occasion.' So I may now say a few words about the contents of Part IV. These will include ( 1 ) miscellanea, (2) ritualistic works and (3) appendices. Therein "miscellanea" will consist of works which can be, broadly speaking, divided into two categories as under : (i) Appendages of the Avassayasutta. (ii) Works, though not a part and parcel of any of the six well-known groups 2 of the Agamas, are more or less closely related to them. These works will be followed by "ritualistic works". This title is self-explanatory. Yet it seems necessary to point out that it will not include each and every work of the Svetambara School. much less any ritualistic work of the Digambara School. The works thus left out here will be separately treated in Vol. XIX, along with those of hymnology, narrative literature etc. Under the third ( last ) head " Appendices" there will be given nine Appendices already referred to in the Preface (p. xv ) of Part 1 Some discussion in this connection is carried on by me in my work entitled A Comprehensive History of the Canonical Literature of the Jainas (pp. 45-48). 2 They are: (1) anga, ( 2 ) uvanga, ( 3 ) paznyaga, ( 4 ) cheya, 15 ) mila and (6) culiva,

Page #21
XX Preface II. In this connection I may mention that Dr. Belvalkar had desired that I should give good many Appendices, over and above the three kinds of Appendices given by him in "Vol.I : Vedic Literature. Part I: Samhita and Brahmanas": As, in all other matters of detail I have, here, too, acted up to his desire and have been all along preparing during the course of printing of this part of Vol. XVII at least six Appendices, in addition to three pratically prepared in 1933. The complete list is as under: (1) Index of Authors.' ( II ) Index of Works. (III) Classification of Works according to languages. (IV) List of Works according to the date of their composition. (V) Correspondence table of Manuscripts. 2 (VI) Chronological order of dated Mss. (VII) Names of places where Mss. were written and works composed. (VIII) Names of scribes, presentees and others. (IX) Abbreviations occurring in Mss. Out of these nine Appendices, the first two are features common to almost all catalogues, especially the Descriptive ones, though the method followed here will be found to be differing in details. As for example, Prof. H. D. Velankar, M.A., has treated both these Appendices under one head - Index of Jaina Authors and Works" in his " Descriptive Catalogue of Samsksta and Praksta Mss. in the Library of the Bombay Branch of the Royal Asiatic Society'. Therein he has only mentioned the titles of works without indicating the names of the authors against nominuous works. Furthermore, against the name of an author, he has indicated his works by the Serial Nos. noted in his Cata 1. It will not be too mach to hope that a similar index of authors when published at the end of each of the Volumes XVIII and XIX, with the necessary information supplemented from other sources will form a pretty "Onomasticon of the Jaina Writers" dealt with, in these Volumes. 2 In Prof. Keith's Catalogue the word " concordance " is used. And I, too would have done the same, had it not been obligatory to maintain uniformity with the other Catalogues published by this Institute.

Page #22
Preface XXI logue. Thus his method of treatment differs from that of mine and the one employed in Vol. I published in 1916 by the Government of Bombay. For the sake of readyreference, I have followed the very method adopted by the late Prof. Weber in his monumental Catalogue of the State Library at Berlin. I find that Prof. A. B. Keith, too, has done the same. The third Appendix given thereafter will seem to be the special feature of Jaina Mss., if not, of Jaina works, dealing with compositions not only in Sanskrit and Prakrit but in several other languages. It is hoped that this Appendix will enable the reader to have at a glance, an idea of the works composed in different languages. Appendices IV and VI have been then given on account of their historical value. For instance, the fourth Appendix prepares a back-ground for Jaina chronology, and the sixth is help. ful in fixing the terminus ad quem for undated works. The fifth Appendix is what one generally meets with, in Descriptive Catalogues of Mss. belonging to big libraries like the State Library of Berlin, the Library of the India Office etc. In this connection I may mention that the letters and the numerical figures given in parenthesis after the (old ) Ms. No., when needed, do not belong to the original collections, but have been introduced by me in the case of composite codices. When a composite codex contained not more than 26 works, letters of the Roman alphabet have been used, whereas in the case of a composite codex having more than 26 works, numerical figures have been used instead of the Roman alphabet which could not have been of much help without suffixes or dashes--a process which would have unnecessarily become cumbrous, if followed. It is perhaps needless to add that certain numbers such as 736 (1) of 1875-76 not giren under old Ms. No. are not discrepancies as a layman is likely to think. They will be given in due course as they refer to works to be dealt with, in one of the subsequent volumes. 2 II do not remember to have seen any Catalogue where a list of works classified according to languages is separately given. 2 Such a state of affairs is due to the variety of subjects treated in one and the same Ms., and seems to be a special property of at least the Jaina Mss.

Page #23
Preface The seventh Appendix is given there with the hope that it will serve as a geographical index to some extent, useful for identifying old place-names. I may add that I do not remember to have come across any Catalogue where such an appendix is separately given. xxii The eighth Appendix is assigned a separate place by the late Prof. Weber, while Prof. Keith has dealt with it, under a general index wherein he has mentioned names of works and authors as well. Under the heading of this Appendix given there, I have mentioned presentees over and above the patrons of scribes with a view to bring into prominence, the speciality of the Jaina code of Ethics. The ninth and the last Appendix is perhaps a unique feature of this Catalogue inasmuch as it appears to be found nowhere else. In this Appendix abbreviations are recorded for the first time they and not for as many times as they do. For, the main object in giving this Appendix is to facilitate the reading of Mss., and that is why the full form is given against the corresponding abbreviation. occur, This finishes a rough survey of the contents of Parts III and IV, which when taken into account with the corresponding survey of the contents of Parts I and II, will show that the completion of this Volume XVII will cover up the description of Mss. pertaining to all the six groups under which the Svetambaras classify their 45 canonical treatises known as the Agamas. This fact goes to prove the richness of the Government Manuscripts Library deposited at the Bhandarkar Institute, and it, when taken into account with its collection of Jaina Mss. of non-canonical treatises, can make any one endorse at least the first part of the following statement made in the Preface (p. xxxvii) of Vol. I, Pt. I : I "That no library of Oriental Mss. possesses as valuable and numerous a stock of Mss. of Jaina literature as our library has, has been acknowledged by scholars from the very beginning and in fact it could even be said that there is hardly any edition of an I The II Angas, the 12 Upaugas and the 10 Prakirnakas along with 18 Supernumerary ones have been treated, together with their exegetical literature in Part I. The six Chedasutras and the two Culikasutras have been similarly dealt with in Part II, and all the Mulasutras, in this part,

Page #24
Preface xxiii important work brought in any part of the world which had not to use, in some way or other, Mss. of this library." In this connection I may add that I have already collected by this time data which can give a clue to the nature of the Jaina Mss.' at the Institute, regarding their material etc.; but I think it better to reserve this topic till the completion of the printing of Vol. XVII. In the meanwhile I may however draw the kind attention of the authorities concerned to the fact that it will immensely enhance the value of this magnificient library, if an attempt can be made to procure, if available, a Ms. or a transcription of each of the following works and the like forming the Agamika class : (1) Pancakappasutta. (2) Mahanisihasuttacunni. ( 3 ) Laksmikallola Gani's commentary on Ayarangasutta. (4) A commentary on Uttarajjhayanasutta, by Vinayahisa. (5) Danasekhara's commentary on Bhagavaisutta. (6) Malayagiri Suri's commentary on Pindanijjutti. Now a word about some of the discrepencies that have crept into this work. They are : (i) On p. 154 Avagahanadvara and Gatidvara are mentioned as separate works but really speaking they form a part and parcel of Sangrahaniratna. (ii) Nos. 954 and 959 deal with the same work, but even then this Ms. is somehow described twice ; so, one of the descriptions is to be discarded. (iii) No. 969 ought to have been assigned a place after No. 970 as it fits in with the plan of the inter-arrangement of Mss. dealing with the same work laid down by the Institute. A similar remark holds good in the case of Nos. 1099 and 1100. Vide foot-note I of p. 460. (iv) In some cases the subject-matter deserves to be reconsidered, and I may cite as an example the case of works having Serial Nos. 934 to 952 ; but this cannot be done now as it means rehandling the corresponding Mss. and carrying on a thorough investigation of the entire problem of the constituents of the 1 A general survey of the Jaina Manuscripts with casual references to these Mss. is made by me in my paper on The Jaina Manuscripts (pp. 98-127) published in "Journal of the University of Bombay" (vol. VII, pt. 2, September 1938).

Page #25
xxiv Preface Avasyakasutra--a problem not finally solved by any scholar up till now, so far as I know As regards the Reviews of this Jaina Catalogue (Pts. I and II) that I have seen, I find that on the whole my work is appreciated on all hands so much so that the late Prof. Winternitz did not only not find any fault whatsoever but fully approved of the plan followed there.' Prof. H. D. Velankar has however sounded a different note in his review. 2 He seems to suggest that too much attention has been paid to the objective side of the Ms. rather than the subjective one, and thus the question of providing materials "useful for the historical reconstruction of Jaina literature " is not sufficiently attended to. He holds me responsible for this attitude but I think this is owing to his not having paid due attention to what I have specifically mentioned in my Prefaces. This is again the reason why he finds fault with me so far as the inter-arrangement of Mss. dealing with the same work is concerned. This is neither the place to answer his criticisms nor is it incumbent upon me to do so as, after all, I have tried to carry out the instructions of the Institute. Prof. Walther Schubring has made the following suggestions by way of corrections in his Review published in Orientalalistische Literaturzeitung 1937 No. 3, pp. 186-187. They are as under : Pt. I, p. 373: Kavacadara = Arahanapadaga, dara 30 from V. 26. 398 : Divasagarapannattisamgahani to be connected with 199 foll., because the D. S. P. forms a part of Jivajivabhigamasutra. 399 : Pajjantarahana printed in Payannasamgrahm Bh. 1, Ahmedabad, Samvat 1962. 427 : See Peterson I, p. 53 and 91, Weber II, p. 919; a medical treatise appreciated by the Svetambars as well as by the Digambaras ; for, the latter see Puspadanta Bhutabali (as must be read ) and Pujyapada. 1 Vide his review published in Archiv Orientalni ( Prague ) VIII, 2, 1936. The pertinent lives are as under : "The Catalogue offers every thing that can be desired by the student of Jaina literature, both as regards details about the Mss. described, extracts from them, and references to editions, or accounts of the works in question ". . This has been published in " Journal of the Bombay Branch of the Royal Asiatic Society" (vol. XII, 1936, pp. 118-120).

Page #26
Preface 428 Yasobhadra is not the author of Vaggaculiya (this is the correct name), but Jasabhadda, the man who is introduced as the teller of the story. 246 Not a commentary to Jambuddivapannatti, but a treatise dealing with calculations concerning the Jambudvipa continent. The true title is Jambuddviva-karanacunni (vide the Berlin Ms.) and some scribes have only been misled to write J. D.-pannatli (or pannattikarana) cunni. Cf. Str. 3 of the text. 587 must not be called Pancakappasuttacunni, since a P. K. sutta never existed nor have curni and bhasya the word satra. In other cases, though there was a sutta or sutra, still the authors did not use that word, e. g. they never wrote Ayarangasuttacunni, Acarangasitratika, but only Avaracunni, Acaratika. Similarly Vuddhakappasutta seems to be a fiction, since the true name is Kappa. I do not intend to make here any comments on these suggestions. I shall therefore simply mention that on p. 58 we meet with Sri-Sthanangasutrartha. Now a word about the following entries printed in the Jaina Catalogue (pt. II, p. 299) : (1) In line to we have: "composed (?)". This should be replaced by "completed". (2) "Author.-Not mentioned. According to the tradition Jinadasa Gani Mahattara." The words "Not mentioned. According to the tradition" should be droped; for, the author has mentioned his name in a queer way in the verse noted on p. 299 and has probably given the clue, too. But before we can see it, the first carana requires an emendation as under : NireNaNAgattamahA sadA jinA These letters when properly re-arranged can be read as 'jiNadAsagANaNA mahAntareNa. " Thus this supplies us with the author's 66 cc XXV "" name. On p. 449 of this part III, the author is not mentioned, but he is said be Jinadasa Gani Mahattara. Before I conclude this Preface, I may mention that I have tried to make this Part III as up to date as possible by making necessary additions while going through the proof-sheets. This will explain why there is anachronism at times. 1 I use this word as the pertinent verse is incorrect. 4

Page #27
xxvi Preface In the end it remains for me to record gladly and respectfully, my indebtedness to Vidvadvallabha Muni Punyavijayaji, a disciple of the late Muniraja Sri Caturavijaya and a grand-disciple of Pravartaka Srimat Kantivijaya, who has for the third time quite willingly rendered to me valuable assistance by going through a duplicate copy of the page-proofs of the non-English portions up to 56 pages. I have also to thank Dr. V. S. Sukthankar, for having agreed to insert in this part, a photograph' of a fol. of Ms. No. 7123 of 1892-95 ( Serial No. 720 ), on my drawing his kind attention to the fact that this Ms. has been written in very small hand-writing, perhaps the smallest I remember to have seen at the Institute, and that this Ms. was selected for exhibit for that very reason and was very highly appreciated by the late His Excellency the Right Hon'ble Lord Brabourne, G.C.I.E. MC., the former Governor of Bengal when His Excellency paid a visit to the Institute as the Governor of Bombay on 22nd June 1935. Equally indebted I am to Dr. R. N. Dande kar, M.A., Ph.D., the Hon. Secretary - for his having complied with my request of inserting in this Part III a photograph" of the last fol. of the Ms. No. 286 of A. 1883-84 ( Serial No. 1139 ) on my drawing his kind attention that this is the oldest dated (Samvat 1333 ) paper Ms. in the Institute and perhaps elsewhere, too. 3 Dr. Sukthankar deserves to be once more thanked for having agreed to publish this part and thus given an early opportunity to the public in general and the Jaina community in particular, to know more about the Jaina Mss. dealt with in this part. Sankdi Sheri, Gopipura,) SURAT. 30th May, 1940 Hiralal R. Kapadia 1-2 These face pp. 120 and sto respectively. 3 The Ms. No. 57 of 1880-81 (Serial No. 1106 ) is the oldest dated palm-leaf Ms. I know of. Its date is Sarhvat 1138.

Page #28
REGULATIONS OF THE MANUSCRIPTS DEPARTMENT 1. "The Government Manuscripts Library" formed and maintained by the Government of Bombay, and formerly deposited at the Deccan College, Poona, is now, subject to the general control of the Department of Education, Bombay, placed under the direct charge of the Bhandarkar Oriental Research Institute, Poona. 2. The Department is administered by a Superintendent appointed by the Executive Board of the B. O. R. Institute subject to the approval of Government. 3. The Manuscripts are available at the Institute, during working hours, for purposes of bona fide study. 4. The Manuscripts in the Library, if, in good condition, and subject to the requirements of Department, are lent out to bona fide scholars on their applying for them in writing to the Superintendent of the Department or to the Secretary of the Institute. Such scholars shall, however, execute a bond for the value of the manuscripts required, this value being fixed by the officers in charge of the Library. 5. In the case of scholars from outside India, all requisitions for loans of manuscripts shall be made to the Secretary of State for India in Council, through whom also the transactions in manuscripts shall take place. Such scholars shall execute the necessary bond with the Secretary of State for India in Council, at his discretion. 6. In the case of scholars in India, the execution of the bond shall be necessary before the manuscripts are lent out. When the applicant is not sufficiently known to the Superintendent of the Department, this latter officer shall have the power to call upon the applicant to produce a certificate as to his interest in the study of Sanskrit Literature, and of his being a fit person to be entrusted with Government manuscripts. Such a certificate shall have to be signed

Page #29
xxviii Regulations of the Manuscripts Department by Orientalists of recognised position, or by Government officers of the Provincial or other highest service, not below the rank of a Deputy Collector or Extra Assistant Commissioner. The certificate should contain a reference to works or essays published by the applicant. N. B.- In the case of scholars residing within the jurisdiction of a Native State, the certificate may be signed either by the Chief Sahib or the Divan or the administrator of the State. 7. All applications for manuscripts shall state the reasons for which the manuscripts are required and the period for which the loan is sought. 8. If any manuscripts belonging to this Library have been used in the publication of an edition, or in any other learned disquisition, the authors should present to the Manuscripts Library a copy of the work or works so published. 9. The number of manuscripts to be lent out at a time to a scholar, and the period of loan, is determined by the officer in charge of the Library. Usually, however, in the case of Indian scholars, not more than five manuscripts are allowed to remain with them at a time, and the period of loan shall not normally exceed six months. 10. Immediately on receipt of manuscripts, the scholars are requested to examine them carefully before signing and returning the receipt-form accompanying the manuscripts, as no complaints will be entertained thereafter. II. When the manuscripts are returned to the Library they are duly examined, and if found in their original condition, the receipt formerly signed for them is returned and the bond cancelled. The liability of the borrowers ceases only after the return of this receipt.

Page #30
Regulations of the Manuscripts Department xxix 12. If scholars find that, owing to the work on the manuscripts not being completed within the stipulated period, they cannot return the manuscripts when due, they shall, sufficiently in advance, apply in writing to that effect to the Superintendent of the Department, or to the Secretary of State for India in Council, as the case may be. The period of loan will be extended at discretion. In no case, however, shall any manuscripts be allowed to remain with a scholar longer than two years in India, and five years outside India. 13. The Manuscripts Department reserves to itself the right of refusing to lend out any manuscript to any scholar at any time, and in the case of manuscripts lent out, of demanding their return before the expiry of the stipulated period, if the manuscripts be required for library or other purposes. 14. All postal charges shall be borne by the applicant. 15. The Department undertakes to procure on loan, for the members of the Institute, manuscripts from other lending Libraries. w

Page #31
A LIST OF PRINTED CATALOGUES AND REPORTS ABOUT MANUSCRIPTS The following is the list of works (Catalogues, Reports, etc.) already published embodying the results of the search and preservation of Sanskrit and Prakrit manuscripts in the Bombay Circle from 1868 to 1915. All lists published up to 1884 have been incorporated in our consolidated Catalogue prepared by Mr. S. R. Bhandarkar, M.A., in 1888. The lists for the subsequent years are to be found embodied in the various Reports published thereafter. These Reports are of considerable value, inasmuch as they give in many cases the history of individual manuscripts, personal details of authors, their chronology, and such other items. All these works are therefore here put together in one place for ready reference. Papers relating to the Collection and Preservation of the Reports of ancient Sanskrit Literature, edited by order of Government of India, Calcutta, 1878, by Mr. E. A. Gough. This is a useful work for the general history of the Search during the earlier period upto 1878 and contains, among other things, lists of manuscripts bought for Government during the years 1868-69, 1869-70, 1870-71, 1871-72, 1872-73 and 1874-75. All these lists, originally published at different times, were also included in our consolidated catalogue (to be mentioned below) published in 1888. Report on the results of the Search for Sanskrit Manuscripts in Gujarat during 1871-72, by G. Buhler, Surat, 1872, 11 pages in folio. Report on Sanskrit Manuscripts 1872-73, by G. Buhler, seven and seventeen pages. Bombay, 1874. Report on Sanskrit Manuscripts 1874-75, by G. Buhler, 21 pages. Girgaum, 1875. Detailed Report of a Search of Sanskrit Manuscripts made (in 1875-76), in Kashmir, Rajputana and Central India, by G. Buhler. Extra No. XXXIVA, Vol. XII of the Journal of the Bombay Branch of the Royal Asiatic Society, 1877, Bombay.

Page #32
A List of Printed Catalogues and Reports xxxi Lists of the Sanskrit Manuscripts purchased for Government during the years 1877-78, and 1869-78, and a list of the Manuscripts purchased from May to November 1881, by F. Kielhorn, Poona, 1881. A Report on 122 Manuscripts, by R. G. Bhandarkar, Bombay, 1880, 37 pages in folio. Report on the Search for Sanskrit Manuscripts in the Bombay Presidency during 1880-81, by. F. Kielhorn, Bombay, 1881. A Catalogue of the Sanskrit Manuscripts in the Library of the Deccan College ( being lists of the two Visramabag collections ). Part I prepared under the superintendence of F. Kielhorn ; Part II and Index prepared under the superintendence of R. G. Bhandarkar, 1884, 61 pages in folio. A Report on the Search of Sanskrit Manuscripts during 1881-82, by R. G. Bhandarkar, Bombay, 1882. A Report on the Search for Sanskrit Manuscripts in the Bombay Presidency during 1882-83, by R. G, Bhandarkar, Bombay, 1884. A Report on the Search for Sanskrit Manuscripts in the Bombay Presidency during 1883-84, by R. G. Bhandarkar, Bombay, 1887. A Report on the Search for Sanskrit Manuscripts in the Bombay Presidency during 1884-87, by R. G. Bhandarkar, Bombay, 1894. A Report on the Search for Sanskrit Manuscripts in the Bombay Presidency during 1887-91, by R. G. Bhandarkar, Bombay, 1897. A Consolidated Catalogue of the Collections of Manuscripts deposited in the Deccan College (from 1868-1884) with an Index, by S. R. Bhandarkar. A Report on the Search for Sanskrit Manuscripts in the Bombay Presidency during 1891-1895, by A. V. Kathawate, Bombay, 1901. Detailed Report of Operations in Search of Sanskrit Manuscripts in the Bombay Circle, August 1882 to March 1883, by P. Peterson. Extra No. XLI, Vol. XVI of the Journal of the Bombay Branch of the Royal Asiatic Society, 1883, Bombay.

Page #33
xxxii A List of Printed Catalogues and Reports A Second Report of Operations in Search of Sanskrit Manuscripts in the Bombay Circle, April 1883 to March 1884, by P. Peterson. Extra No. XLIV, Vol. XVII of the Journal of the Bombay Branch of the Royal Asiatic Society, 1884, Bombay. A Third Report of Operations in Search of Sanskrit Manuscripts in the Bombay Circle, April 1884 to March 1886, by P. Peterson. Extra No. XLV of Vol. XVII of the Journal of the Bombay Branch of the Royal Asiatic Society, 1887, Bombay. A Fourth Report of Operations in Search of Sanskrit Manuscripts in the Bombay Circle, April 1886 to March 1892, by P. Peterson. Extra No. XLIXA of Vol. XVIII of the Journal of the Bombay Branch of the Royal Asiatic Society, 1894, Bombay. A Fifth Report of Operations in Search of Sanskrit Manuscripts in the Bombay Circle, April 1892 to March 1895, by P. Peterson, Bombay, 1896. A Sixth Report of Operations in Search of Sanskrit Manuscripts in the Bombay Circle, April 1895 to March 1898, by P. Peterson. Bombay, 1899. This contains also a list of manuscripts purchased by Professor Peterson from 1898-99. Lists of Manuscripts Collected for the Government Manuscripts Library by the Professors of Sanskrit at the Deccan and Elphinstone Colleges containing the following Collections : (i) 1895-1902, (ii) 1899-1915, (iii) 1902-1907, (iv) 1907-1915, (v) 1916-1918, (vi) 1919-1924 and (vii) 1866-68.

Page #34
VOLUMES PUBLISHED Vol. I, Part I-Vedic Literature, Samhitas and Brahmanas pp. xlviii +420; Size:- 9 inches x 6 inches. 1916, Compiled by the Professors of Sanskrit, Deccan College, Poona. Price Rs. 4. 35 Vol. XVII. Part 1-Jaina Literature and Philosophy (Agamika Literature) pp. xxiv + 390; Size :--- 91 in. x 6 in. 1935. Compiled by Prof. H. R. Kapadia, M.A. Price Rs. 4. -(Agamika Literature contd.) pp. xxvi + 36324; Size:- 9 in. x 6 in. 1936. Compiled by Prof. H. R. Kapadia, M.A., Price Rs. 4. 91 Descriptive Catalogue of Manuscripts IN THE Government Manuscripts Library 19 - Part II Part III-(Agamika Literature contd.) pp. xxxv + 530; Size :- 9 in. x 6 in. 1940. Compiled by Prof. H. R. Kapadia, M.A. Price Rs. 5. Vol. XII-Alamkara, Samgita and Natya Mss. pp. xx + 486 Compiled by P. K. Institute, Poona. Size :- -91 in. x 6 in. 1936. Gode, M.A., Curator, B. O. R. Price Rs. 5. Vol. XIV- Nataka Mss. pp. (xviii + 302); Size:-9 in. x 6 in. 1937. Compiled by P. K. Gode, M.A., Curator, B. O. R. Institute, Poona. Price Rs. 4. Vol. II, Part 1-Grammar Mss (Vedic and Paniniya) 348; Size.-91 in. x 6 in. 1938. by S. K. Belvalkar, M.A. Ph.D. Size.-9 Vol. XVI, Part I- Vaidyaka Mss. pp. xxi + 418. in. x 6 in. 1939. Compiled by H. D. Sharma, M.A., Ph.D. Price Rs. 4. Other volumes in preparation. For copies apply to:- The Secretary, B. O. R. Institute, pp. xvi. + Compiled Price Rs. 4. POONA 4, (INDIA).

Page #35
SYSTEM OF TRANSLITERATION a a R r Ai i I i R lR ! eNe kU k c chU ch TraM t ThUM th t t th th pU p phUM ph kh g u u U ai ai o o o au ya y r r gh gh j j jhU jh J ddh dUddh ba b bha bh mU m lU 1 v v bU 8 s s b visarga h, anusvara m. N n nU n zU

Page #36
JAINA MANUSCRIPTS

Page #37

Page #38
JAINA LITERATURE AND PHILOSOPHY A. AGAMIKA LITERATURE V. 4 MULASUTRAS! THE FIRST MULASUTRA uttarAdhyayanasUtra (377TYTUTETI) Uttaradbyayanasutra (Uttarajjhayanasutta ) 159. 1871-72. No. 644 Size.-- 12 in. by 43 in. Extent.-- 73 folios; 11 lines to a page ; 46 letters to a line. Description.-- Country paper thin and white; Jaina Devanagari characters with occasional Tanas; big, fairly legible, uniform and elegant hand-writing ; borders ruled in two pairs of lines in black ink; the space between these pairs coloured red; numbers for foll. written in the right-hand margin ; foll. ja and 736 blank ; fol. rb decorated with a beautiful illustration of a samavasarana with a Tirthamkara in the centre ; unnumbered sides have a square in 1 For the interpretation of this word mulasutra and the question of the propriety of the word sutra according to Jarl Charpentier see his introduction (p. 32) to his edition of The Uttaradhvayanasutra ". 2. That the meaning of the word ullam occurring in this title cannot meaa "best" though so suggested in the commentary on Nandisutra, but it should mean " latter", is the opinion expressed by Charpentier in his introduction (Th. 33) to Utrayadhvavanasutta

Page #39
2 Jaina Literature and Philosophy [ 644 yellow colour in the centre; the numbered, in each of the two margins, too; all the foll. more or less worm-eaten ; but, fortunately the body is not affected to the same extent; condition tolerably fair; complete; the entire work is divided into 36 adhyayanas as under : Adhyayana dw dw "" rw "" 33 dr wr dr dw wr rw wd dr 35 dw >> 39 wr 13 "> "" "" "" "" "" 33 Verses I-48 prose +,, 1-46 I-20 1-13 I-32 1-18+ prose,, I II III IV V VI VII VIII IX X XI XII XIII XIV XV rw XIX XX XXI XXII XXIII XXIV XXV XXVI XXVII XXVIII " dr dw "" dw wr "3 rw "" dw 22 dw XVI prose +,, 1-17 XVII I-21 XVIII "" wr dw wr "3 22 dr dw dr dr "" I-30 I-20 I-62 I-37 I-32 I-46 I-35 dr 1-55 1-16 1-54 I-98 I-60 I-24 1-51 1-89 I-20 1-44 1-26 I-17 1-36 foll. 23 rw "" dw dr dw 37 wr dr rw 33 dr dw >> dw dw 2-ss-b "" dr dr 33 33 dr 23 16 to 3a 3a 5deg 6a 6a 60 7b 8b gb 21a 21b 236 24b 266 30a 32b "" 39a 39b wr 416 22 dr dr dr Iob 12b 12b 14a 15a 17a 18b "" dr " Ioa dr >> 14" 2 25 172 18b >> ,, 21a 21b 66 S toyma 45 ,, 23h 246 dr 7b 8b "26h dr dw >> 308 32 33h 33b 356 35b 39a 39b dr " rw wr dr 416 436 436 44deg, 45 ", 44a

Page #40
644.] I. 4 Malasatras Adhyayana XXIX prose+ Verses 1-73 foll. 45b XXX , 1-37 , SI ,, 53* XXXI , 1-20 , 53* ,, 530 XXXII , I-III ,, 53 ,, 59 XXXIII , I-25 , 59 ,, 6ok XXXIV 1-62 , 60 XXXV ,, I-21 , 62 ,, 631 XXXVI I-267 ,, 63 Age.-- Samvat 1651. Author.- Various authors are suggested by various persons. For instance some ascribe the authorship to Lord Mahavira, some to Bhadrabahu ? and some to Kapila and other saints. Subject.-- This Jaina canonical treatise mostly in verses in Prakrit is styled as "mulasutra". On the whole, it depicts the life which a Jaina saint ought to lead. The details can be inferred from the significant titles 3 of the 36 adhyayanas which are as under: ( 1 ) viNayasuya (vinayazruta), ( 2 ) parIsaha ( parISaha), (3) cAuraMgijja ( cAturaGgIya ), ( 4 ) asaMkhaya (asaMskRta ) or pamAyappamAya ( pramAdApramAda), (5) akAmamaraNijja (akAmamaraNIya ) or akAmamaraNa, (6) khuDDAgaNiyaMThijja ( kSullakaniyanthIya ) or niyaMThijja (nirgranthIya ), ( 7 ) elaya (elaka) or urabbha ( aurabhrIya ), (8) kAbilIya ( kApilIya ) or kavilijja (kapilIya), (9) namipanvajjA ( namipravrajyA ), (10) dumapattaya (drumapatraka ), (II ) bahussuyapUyA ( bahuzrutapUjA ), ( 12 ) hariesijja ( harikezIya ) or hariesa (harikeza), (I3) cittasaMbhUijja (cittasambhUtIya) or cittasaMbhUya ( cittasambhUta), (14) usuyArijja ( iSukArIya ), (15) sabhikkhu ( sabhikSu ) or sabhikkhuya ( sabhikSuka ), (16) baMbhaccerasamAhiTThANa ( brahmacaryasamAdhisthAna ) or samAhiTThANa ( samAdhisthAna), ( 17 ) pAvasamANijja (pApazramaNIya ), ( 18 ) saMjaijja ( saJjayIya ), ( 19 ) miyAputtIya (mRgAputrIya ) or miyacariyA (mRgacaryA), ( 20 ) mahA I Verses 79 to 87 are wrongly numbered as 49 to 57. 2 Sce p. 7. 3 For a set of these titles see Nos. 659 and 681.

Page #41
Jaina Literature and Philosophy 1644. niyaMThijja ( mahAniryanthIya) or niyaMThijja (nibandhIya), ( 21 ) samuddapA lijja or samuhapAlIya ( samudrapAlIya ), ( 22 ) rahanemijja ( sthanamIya), ( 23 ) kesigoyamijja (kezigautamIya ), ( 24 ) mamiIa ( samitIka , (25) jainnena or janna ijja (yajJIya), ( 26 ) sAmAyArI ( sAmAcArI), ( 27 ) khalaMkijja ( khalaGkIya ) or khaluka (khaluGka), ( 28) mokkhamaggagai ( mokSamArgagati) or mokkhagai (mokSagati), ( 29 ) saMmattaparakkama ( sAmantaparAkrama ) or appamAda (apramAda), ( 30 ) tavamaggaijja (tapomArgIya ) or tavamagga (tapomArga), ( 31 ) caraNavihi ( caraNavidhi ), ( 32 ) pamAyaTThANa (pramAdasthAna ) or samAhihANa ' ( samAdhisthAna ), (33) kammappayaDi or kampappagaDi (karmaprakRti), (34 ) lesA (lezyA ), ( 35 ) aNagAramagga ( anagAramArga) cr aNagAra (anagAra) and (36) jIvAjIvavibhatti (jIvAjIvavibhakti The names of the 36 adhyayanas inentionec in Samavayangasutra ( sutra 36, p. 64 ) and in the niryukti (1.1317') to Uttaradhyayanasutra differ at times from these. In this connection it may be added that the names of the adhyayanas 3, 4, 7, 10 and 26 can be mentioned as examples of a naman ( name ) by adanapada (one of the ten types ) noted in the 13oth sutra of Anuyogadvarasutra.3 The ninth adhyayana of this text can be compared with the Mahabharata ( XII, 178, 2 ) and the Buddhistic Jataka No. 539 g. I25 ( Fausboll's edn). The 12th adhyayana I This heading is due to a scribal error So says Charpentier in his introduction (p. 36, and foot-note) to Uttaradhyayanasutra. 2 These along with English translation are given by Charpentier in his introduction (pp 35-36 ) to Uttaradhyayanasutra, and they are given here, too. 3 C. Maladharin Hemacandra Suri's following observation in this connection: " AvaMtItyAcArasya paJcamAdhyayanaM......ityAdAnapadenaitannAma, cAuraMgijnaM ti etaduttarAdhyayaneSu tRtIyamadhyayanam, tatra cAdau cattAri paramaMgANi dullahANIha jaMtuNo' ityAdi vidyate, asaMkhayaM idamapyuttarAdhyayaneSveva caturthamadhyayanam , tatra cAdAveva 'asaMkhayaM jIviya mA pamAyae' ityetat padamasti, tatastenedaM nAma, ravamanyAnyapi kAniciduttarAdhyayanAntarvInyadhyayanAni kAnicit tu dazavakAlikasUyagaDAdyadhyayanAni svadhiyA bhaavniiyaani|" --- Anuyogadvarasutravrtti, p. 1416

Page #42
644] 1. Mulasulras has its counterpart in the Maianga-Jataka No. 497, and the 13th cau be coinpared with the Jataka No. 498. The 14th adhyayana can be compared with the Mahabharata (XII, 175, repeated XII, 277), Markandeya-Purana (X il.,) and the Jataka No. 509.' Begins... - fol. I" 5 6 7 // OM namaH // saMjogA vippamukkassa aNagArassa bhikkhuNo viNayaM pa(pA ukarimmAmi ANuendhi suNeha me // 1 // etc. Ends,-- fol. 734 ii pAukare buddhe nAyae parinivvue / hanIma uttarajjhAe bhavasiddhI( ya ) mammae / / ti bemi 267 cha jIvAjIvavibhattI // cha 36 uttarajjhayaNasayakvaMdho sammatto // maMvata 1651 varSe kArtikavadi 2 ravau // 'barkapallIvAstavyazrI zrImAlI'jAtIyamamaMgalabhAryA maMgayalAde tatsutasuzrAvakadharmakAraNIyakArakasAhagoMgAkena la(li )SA( vA pitaM / bhaTTArakazrIsaMyamaratnasUritatsi(cchiya - paMDitazrI (7 times ) jayaratnagaNitatzi cchiSyamunisiMghavimalasya puNyAthai jJAnavRddhayartha danaM zrIrastu dIrghAyuH zubhaM bhavatu: // Reference.-- Published along with Laksmivallabha's commentary and 1 Hindi gloss of Vijaya Sadhu in the Agamasangraha of Rai Bahadur Dhanapatisimha, Calcutta, in Samvat I936. The text together with the commentary of Jayakirti is published by Pandit Hiralal Hamsaraj, Jamnagar in A. D. I909; the text with the nirvukti and the commentary of Vadivetala Santi Suri, in the D. L. I. P. F. Series in three parts in A. D. 1916-17 ; the text with the commentary of Kamalasamyama is published in the Yasovijaya Jaina Granthamala, Bhavnagar in A. D. 1927; the text along with the commentary of Bhavavijaya Gani, by the Jaina Atmananda Sabha in Samvat 1974 and I See Indian Culture" vol. I, No. 2, pp. 146-147. 2 In the Ms. ya is written above maMgalAde,

Page #43
6 Jaina Literature and Philosophy 1644. the text along with Gujarati translation, by Jaina Dharma Prasaraka Sabha, Bhavnagar. The text is edited by Jarl Charpentier ( Archives d'etudes orientales vol. 18), Upasala in A. D. 1921-22. Herein the introduction' contains in short a history of the canonical literature of the Jainas. The text is translated into English by Hermann Jacobi and is published in the Sacred Books of the East as vol. XLV, in A. D. 1895. For quotations etc. see Weber II ( Nos. 1901-1906), pp. 719-730, Indian Antiquary vol. XXI, p. 310 ff., Winternitz, Geschichte (vol. II, pp. 292, 300, 312-315, 316, 318, 320322 and 367), La Religion Djaina (pp. 27, 49, 79, 80, 86, 91, 92, 96, 211, 218, 238, 249, 263, 269 and 303), A History of Indian Literature (vol. II, pp. 94n., 428n., 429, 431, 442, 446-471, 476n., 534f., 561 and 637) and Die Lehre der Jainas (p. 80 ). For comparison of Uttaradhyayanasutra with Jivavicara see A. Guerinot's "La doctrine des etres vivants dans la religion jaina" (Revue de l'Histoire des Religions, vol. XLVII, pp. 34-50), Paris, 1903. See A Barth's "Bulletin des Religions de l' Inde-Jainisme" (ibid.), vol. VII, 1902; H. Oldenburg's "Buddha, sein Leben, seine Lehre, seine Gemeinde", p.309, n.2 StuttgartBerlin, 1903; its translation in French by A. Foucher, p. 267, n. 1. Paris, 1903; A. Weber's "Ueber die heiligen schriften der Jaina" (Indische Studien, vol. XVI, Leipzig, 18831885); Indian Antiquary vol. XVII; and H. Jacobi's Ausgewahlte Erzahlungen in Maharashtri" (pp. 34-55), Leipzig, 1886, and his article " Ueber den cloka in Pali und Prakrit (Kuhn's Zeitschrift fur vergleichende Sprachforschung ( vol. XXIV, pp. 610-614), Berlin, 1879. 33 66 I Based upon the remark made by Weber (Indische Studien vol. XVI passin) Charpentier mentions on p. 34 that Uttaradhyayanasutra is identified with Isibhasiya in many canonical and other passages. But as he further observes it is not so as Isibhasiya contains 50 or 54 chapters. Uttaradhyayanasutra is also identified with Devendatthaya which was probably obsolete already in the time of Haribhadra Suri (Cf. Weber Ind. Stud XVII, 43).

Page #44
544.] I. 4. Mulasutras E. Leumann's "Die Lejende von Citta und Sambuta (Wiener Zeitschrift fur die Kunde des Morgenlandes, 5f.), Wien and "Weld in Bild und Wort " (Strassburg 1890) may be also consulted. 7 In Ardha-Magadhi Reader there are given as extracts from Uttaradhyayana, the 5th chapter on pp. 55-57 and the 13th and the 14th on pp. 63-67 and 67-74. The English translation of these chapters is therein reproduced from S. B. E. on pp. 142-146, 154-158 and 158-166 respectively. On P. LI Banarsi Das Jain remarks that this work "was composed by Bhadrabahu. "......" Several of the legends' given here " are common to Brahmanic and Buddhist literatures. Many verses are a mere translation of the Mahabharata slokas and a few others correspond in wording to those of the Dhammapada and Jatakas ". " In the collection of Manuscripts of Sarabhai Nawab there is an illustrated Ms. of Uttaradhyayanasutra. It contains 46 illustrations. Out of them 8 are given in Jaina Citrakalpadruma in plates LXXXIV and LXXXV. Each of these plates contains 4 illustrations. The illustrations of the first plate respectively deal with the topics treated in adhyayana XI, verses 16 to 30; XII, 19-30; XIX; and XIX. The second plate has illustrations connected with XX, 19-31; XXI, 4-10; XXII, 33; and XXIII. All these 8 illustrations are preceded by one given from the collection of the late Muniraja Hamsavijayaji. For additional Mss. of the text see B. B. R. A. S. vols. III-IV, p. 382, Keith's Catalogue Nos. 7485, 74862 and 74915 and Limbdi Catalogue Nos. 275-278, 279 and 286. For a suvarnaksari Ms. see the Jaina jnana bhandara of Devasa pada, Ahmedabad. I This Reader is published by the "University of the Panjab ", Lahore, 1923. 2-3 These contain a fragment in chapters XXX and XXXI and one of chapter XXXVI respectively. 4 This Ms. is referred to on p. 75 (foot-note) of Jaina Citrakalpadruma.

Page #45
8 uttarAdhyayana sUtra No. 645 Jaina Literature and Philosophy Age. Samvat 1332. Begins. leaf roll Ends: leaf 175" Size. 143 in. by 17 in. Extent. 175 10 = 165 leaves; 3 to 5 lines to a leaf; 45 to 55 letters to a line. Uttaradhyayanasutra Description. Palm-leaf; Jaina Devanagari characters with pRSTamAtrA) quite bold, big, uniform, legible and very beautiful handwriting; this Ms. presents an appearance of the work having been written into two separate columns; but, really it is not so, since lines of the first column extend to the second; borders of each of the columns ruled in three lines in black ink; numbers for leaves written in different margins but on one and the same side of the leaf; in the right-hand margin, as ?, R etc., as usual in numerical characters, whereas in the left-hand one, in letter-numerals such as a ) 1 2 ) numbered sides decorated with a small disc in red colour in the centre; the numbered, in each of the two margins, too; leaves 73 to 83 partly worm-caten; the body of the leaves 174 and 175 partly worn out; edges of almost all leaves worn out to a smaller or greater extent; condition on the whole very fair; leaves placed between two wooden boards; the Ms. well-preserved in the card-board box lined with oil cloth: extent 2300 slokas; leaves 127 to 136 missing; otherwise complete. sti / zrI / etc.: red chalk used; un 2 > A etc., as in No. 644. [645. (Da) (Da) pAMukara buddhe nAyae parini / chatI ) uttarajjhAe bhavasiddhIya saMbuDa 3. 1880-81. tti bemi / / 266

Page #46
646.] 1. 4 Mulasutras chattIsaima uttarajjhayaNaM sammattaM // 36 // cha // uttarajjhayaNaUTETUT Final(#1) ll ll jua: sa ...ai sana aufastical(s) pi zatAni // 2300 saMvat 1332 varSe vaizAkhavadi 3 zanau. Reference.-- Regarding this Ms. Charpentier says in his introduc lion ( p. 63 ) to Uttaradhyayanasutra that this is " wellwritten but lacks the last ten leaves". F. Kielhorn has described it on pp. 3-4 of his " Report on Ancient palm-leaf Mss. lately acquired for the Government of Bombay. Bombay, 188r". See Indian Antiquary vol. X, p. 100. N. B. For other particulars see No. 614. uttarAdhyayanasUtra Uttaradhyayauasutra No. 646 1880-81. Size.-- 324 in. by 18 in. Extent. 64 leaves ; 4 to s lines to a leaf; 125 to 130 letters to a line. Description.--Palm-leaf durable and brownish; Jaina Devanagari characters with ATES; big, legible, uniform and good handwriting; his Ms. presents an appearance of the work having been written into three separate columns; but, really speaking, it is not so, since the lines of the first column extend to the remaing ones ; borders of each of the columns ruled in three lines in black ink ; leaves numbered in both the margins ; in the right-hand one as 3, 2, $ etc., and in the left-hand one as a tal soft l etc., i. e. to say in letter-numerals ; complete; some leaves slightly wormeaten ; condition tolerably good ; leaves placed between two I Letters are gone.

Page #47
Jaina Literature and Philosophy [646. wooden boards; the Ms. well-preserved in a card-board box lined with oil cloth ; leaf 1. blank; so is the leaf 64b; red chalk used. Age.-- Reported as Samvat 1340 (circa), on the ground that this has been written by the same scribe who wrote work No. 663 in Samvat 1342. Begins.- leaf ab illo 7:FAITTII Ffair @cagare etc., as in No. 644. Ends. --- leaf 64" iti pAukare buddha etc. up to bhavasiddhIya saMvuDe ti bemi as in No. 644. This is followed by the lines as under: chattIsaM[sa]imaM sammattaM // cha // 257 uttarajjhayaNasuyakvaMdho smmno|| jogavihIe vihittAe jo lihai sutta atthaM / vA bhAseI ya bhaviyajaNo so pAvai NijjarA viulA jammo dattAe ekaha vi // samagghaMti viggharahiyassa / so lakkhijjai bhanyo puvarisI eva bhAsaMti // Reference. This Ms. was utilized by Charpentier for editing the text of Uttaradhyayanasutra. In his introduction (p. 63) to this work he observes : "I have made use for the text of the Ms. no. 2 of coll. 1880-81, which is from sanv. 1340 (= 1284 A. D.), and written apparently by the same hand which wrote no. 5 of the same collection mentioned above. It contains 64 leaves, is quite complete and is very well and clearly written. There are apparently very few mistakes in it, although the orthography is sometimes not quite correct. But this is a fault to be found frequently even in the most excellent manuscripts". N. B.- For other details see No. 644 and F. Kielhorn's Report for 1880-81, p. 3.

Page #48
647.) 1. 4 Malasatras uttarAdhyayanasUtra Uttaradhyayanasutra 86. No. 647 1872-73. Size.--- 104 in. by 48 in. Extent.-- 28 folios ; 17 lines to a page ; 66 letters to a line. Description. Country paper thin and greyish ; Jaina Devanagari characters with qualats; small, legible, uniform and good hand-writing; borders carefully and neatly ruled in two pairs of lines in black ink; fol. 18 has marginal notes written on it; those in the right-hand margin have slightly faded; strips of paper are pasted to foll. 2 to 25, and the missing letters written on them ; condition very good; complete; yellow pigment rarely used. Age. - Fairly old. Subject... The usual text plus the four verses of its niryukti which point out the importance of this text. Begins.-- fol. 10 & 011 FA: BfAl P aral:] Il spt 11 HTTPeragata etc., as in No. 644. Ends.--- fol. 286 2 413 g etc., up to guru as in No. 644. This is followed by the lines as under : ilgll far #KT GA-HTETETATE !311g Il eft ll still je kira bhavasiddhIA / parittasaMsAriA ya je bha(na)za(rA) te kira par3hati ee| chattIsaM uttarajjhAe / 1 / / This goes up to punvarisI eva bhAsaMti // 4 // (the last line of the 160 4th verse which is the same as in No. Reference.-- This Ms. is referred to by Charpentier in his in troduction (p. 63 ) to Uttaradhyayanasutra. There, while comparing this Ms. with No. 644 he observesi "The first' is dated samv 1651 (= 1595 A. D.), the other has no date ; the first has been rather ill used 1871-72) sft. 1-2 By the first he means the Ms. here se rially numbered as 644, and by the orher, this very Ms.

Page #49
Jaina Literature and Philosophy 1647: and has numerous worm-holes, the other is well-preserved and clearly written". N. B.-- For other particulars see No. 644. uttarAdhyayanasUtra Uttaradhyayanasutra No. 648 733. 1899-1915. Size.-- 104 in. by 44 in. Extent.--- 77 - 1 = 76 folios ; 12 lines to a page ; 40 letters to a line. Description.- Country paper rough and grey ; Jaina Devanagari characters; sufficiently big, clear and fair hand-writing; borders ruled in four lines in black ink; red chalk used; yellow pigment, too; most of the foll. numbered in the right-hand margin only; a piece of paper of the size of a fol. pasted :o fol. 77'; condition very good; fol. 77" blank; the Ist fol. is inissing; otherwise complete; extent 2100 slokas; fol. 12 seems to have been kept blank ; for, fol. 2deg starts with a portion of the 12th verse of the ist adhya yana ; the last two lines seem to be laterly added. Age. Not later than Samvat 1686. Begins.-- fol. 2a (CP09 A goiti guTO OT) * TEGAT qrasi(si) CITATAT I 38 etc. Ends. -- fol. 778 ge org* etc., up to stac as in No. 644. This is followed by the lines as under:-- // 70 jIvAjIvavibhattI sammattA 36 chattIsa uttarajjhayaNANi **Tret ( 1 ) faristot vigastatizzatoriaISTST TOJHTATO 7800 (1) Then in a later hand we have :---

Page #50
649.1 I. 4. Malasutras saMvat 1686 phAguNasudi 14 zrI vikrama'nagare A parati samArI hai mahaM urajai / paMDitazrIkamala(vija)yagaNivAcanArtha / cuka mUla duvA tihAM paMDita samArajyojI // iti bhadraM / zubhaM bhavatu // N. B.- For further particulars see No. 644. uttarAdhyayanasUtra Uttaradhyayanasutra No. 649 1880-81. Size.-- 134 in. by 2l in. Extent.-- 134 + 1 = 135 leaves ; s lines to a leaf ; 45 to 56 letters to a line. Description. -- Palni-leaf; Jaina Devanagari characters with EATITS; small, quite legible and good hand-writing ; this Ms. presents an appearance of the work having been written into two separate columns; but, really speaking, it is not so, since the lines of the first column extend to the second ; borders of each of the columns ruled in two pairs of lines in black ink ; the space between these pairs coloured red; leaf 1. blank ; leaves numbered in both the margins; in the right-hand margin as ?, ?, etc., and in the left-hand one as * ) 1, 2, 3, GTFetc., i. e. to say in letter-numerals ; leaf 101 repeated ; leaves 47, 63, 75, 79, 83, 120(?) and 121(2) seem to be subsequently added; some portion of leaves 108 to 118 worn out; even the numbering and a part of the text gone ; several leaves more or less worm-eaten ; the last three leaves are awfully damaged; condition on the whole unsatisfactory ; the work is incomplete so far as the 36th adhyayana is concerned; otherwise complete. Age.-- Fairly old. Begins -- leaf i' & OI PATC#:) **ST 11 Hola facaga etc. as in No. 644.

Page #51
Jaina Literature and Philosophy (649. Ends. --- leaf 134b at afbl...... Afort heart glagt at ...... Reference.-- Charpentier remarks in his introduction (p. 63) to Uttaradhyayanasutra that this Ms." has no date and is very incomplete". Kielhorn has described it on p. 4 of his Report for 1880-81. N. B. - For further particulars see No. 644. asaMskRtAdhyayana Asamskrtadhyayana (seau) (Asamkhayajjhayana ) No. 650 39 (b). 1877-78. Extent. ---- fol. 28* to fol. 28b i. c. to say i folio. Description.-- Complete so far as it goes. For the title see p. 4. 39 (a). For additional particulars see Mrgavatirasa No. 2914 "1877-78. Age.- Samvat 1751; this is the date mentioned for No.-. 1877-78. * Subject.--- This is a work in Prakrit in 13 gathas and it forms the 4th adhyayana out of the 36 of the Uttaradhyayanasutra. It advises the aspirants for liberation to shake off carelessness and to see that anger, pride etc., are overcome by them. Begins.- fol. 28a asaMkhayaM jIviya mA pmaaye| jarovaNIyassa hunasthi taannN| evaM viyANAhi jaNe pmtte| 77(-a) faith 999 a 3 etc. 1-2 These are respectively the 203th and 208th verses of the 36th (last) chapter of Uttaradhyayanasutra.

Page #52
651.) 1. 4 Malasatras IS Ends.-a fol. 28h je( 5 )saMkhayA tucchprppvaaii| te pijjadosANugayA prbbhaa| eya(e) ahammu tti dugaMchamANo / kakhe guNe jAya sarIrabheu iti asaMkhyA(skRtAdhyayanaM caturthe / Reference. - For description of an additional Ms. having this adhyayana see Keith's Catalogue No. 7492. N. B.- For further particulars see No. 644. namipravrajyAdhyayana Namipravrajyadhyayana (araza put) (Namipavvajjajjhayana ) No. 651 579 (c). 1895-98. Extent.- fol. 122 Description.-- Incomplete as it contains 9 verses and a part of the 10th. All of them belong to the ninth adhyayana and are the opening verses of the same. For other details see No. 423 (D. C. J. M. vol. XVII, pt. I, p. 380 ) where this work is styled as Navasloki through oversight. Subject. --The ninth chapter deals with the life of king Nami. Char pentier observes that it belongs to a vast cycle of legends concerning the four pratyekabuddhas, the four kingly saints very famous amongst the Jainas and the Bauddhas, and to some degree known even to the Vaidika Brahmanas.' He looks upon this chapter as a legendary one.? I See p. 44 of his introduction. 2 Chapters XII-XIV, XVIII-XXIII and XXV are placed in the same category by him. Ibid., p. 44

Page #53
Jaina Literature and Philosophy [6fi. Begins.-- fol. 122 caI(i)UNa devalogA( o) ubavanno mANusaMmi loyani / uvasaMtamohaNijjo saraI porANiyaM jAI // 1 // etc. Ends,-fol, 120 'mihilAe' ceie patthe(cche ) sIyachA(cchA) maNorame pattapupphaphalovee bahaNaM bahuguNe sayA // 9 // bAeNa hIramANaMmi ca(ce iyaMmi ma // // This work ends thus. N. B.---For other details see No. 644. mokSamArgagatyadhyayana Moksamargagatyadhyayana (mokkhamaggagaiajjhayaNa) (Mokkhamaggagaiajjhayana) No. 652 768 (6) . 1892-95.. Size.- 98 in. by 44 in. Extent.--- 29 folios ; [2 lines to a page ; 38 letters to a line. Description.- Country paper thin and grey; Jaina Devanagari characters; bold, big, clear and good hand-writing ; borders ruled in four lines in black ink ; foll. numbered in the right-hand margin ; in the centre of the numbered and unnumbered sides as well, there is some space kept blank so that it forms a design ; edges of almost every fol. slightly worn out; condition tolerably fair ; complete ; this Ms. contains the following additional works : (1) AgamikavastuvicAraprakaraNa fol. 4 to 64 (2) bandhazataka (3) bhaktapratijJA (No. 301 )' , 10deg , I7 (4) saMstAraka (, 314) (5) dvAdazabhAvanA , 22 , 27 (6) pratyAkhyAnabhASya ____, 27 , 29. 1-2 For description see D, C. J. M. vol. XVII. pt. I, pp. 283 and 289 respectively.

Page #54
653.1 Age.-- Old. Subject. Begins.-- fol. 1a || This forms the 28th chapter of Uttaradhyayanasutra, and it deals with Jaina philosophy. This seems to have served as a basis for Tattvarthadhigamasastra. For, it deals with dogmatical questions or matters of doctrines and gives us philosophical information as is mostly the case with chapters XXIV, XXVI, XXIX--XXXI, XXXIII, XXXIV and XXXVI and with introductory portions to chapters II and XVI. Ends. fol. 2a I. 4 Mulasatras mukkhamaggagaiM taccaM suNeha jiNabhAsiyaM / cakAraNa saMjuttaM nANadaMsaNalakkhaNA ( NaM ) // 1 // etc. khavittA kammAI saMjameNa taveNa ya / savvadukkha paNatyA pakkamaMti mahesiNo // 36 // iti makkhamagga ( ga ) I nAmajjhayaNaM sammattaM // chu // N. B. For other details see No. 644. uttarAdhyayanasUtra sukhabodhAsahita No. 653 17 Uttaradhyayanasutra with Sukhabodha Size.- 10 in. by 4 in. Extent. 329 folios; 15 lines to a page; 46 letters to a line. Description. Country paper thin, rough and greyish; Jaina Devanagari characters with years; bold, big, clear, uniform and good hand-writing; borders ruled in four lines in black ink; red chalk and yellow pigment used; numbers for foll. entered in both the margins; some foll. have stuck together probably due to the presence of gum in the ink used; some of them torn though slightly owing to 1098. 1887-91.

Page #55
Jaina Literature and Philosophy [653. ignorant and careless attempts made by some one to separate them ; condition on the whole very fair ; this Ms. contains the text and the commentary ( vstti ) Sukhabodha by name; both complete; extent of the commentary 14000 slokas; Sukhabodha composed in Samvat 1129 on the advice of the fellow-disciple, Municandra Suri; the text is divided into 36 adhyayanas; the extent of each of them together with the corresponding portion of the commentary is as under: Adhyayana T w ith com. foll. pb to 14a II ,, ,, 142 >> 512 III ,, ,, 51a , 719 IV ,, ,, ,, 718 >> 892 V ,, ,, ,, 89a ,, 976 >> >> >> 976 , 1024 VII 102a ,, 109h VIII >> >> 1178 , 1368 1362 , 1472 XI 1472 ,, 1510 XII ,, ,, ,, 1516 ,, 1626 XIII >> >> ,, 1626 , 1816 XIV 1816 , 1906 XV 1906 , 1936 XVI 1936 ,, 1976 XVII 1976 , 2001 XVIII 2002 ,, 233a XIX , , , 2334 ,, 228b XX 2386 ,, 2422 XXI ,, ,, ,, 2429 ,, 244" XXII 2446 ,, 2532 XXIII XXIV >> >> >> 1096 ,, 117 2689 >> 2703

Page #56
653.) 1. 4 Mulasutras * 19 1, 2774 Adhyayana XXV with com. foll. ,, 2725 XXVI XXVII ,, 279 XXVIII >> : >> 2796 ,, 283b XXIX 2836 ,, 2936 XXX .., 2936 ,, 298a XXXI ,, ,, ,, 298a .. 304a XXXII , 304a ,, 3115 XXXIII , 3916 ,, 3138 XXXIV 3134 ,, 3166 XXXV ,, ,, ,, 3166 ,, 3180 XXXVI ,, ,, ,, 3186 ., 329*. Ag.-- Samvat 1491 (?). Author of the commentary.- Devendra Gani', pupil of Amradeva? Upadhyaya, pupil of Uddyotana Suri of the BIhad gaccha. It seems that this Devendra Gani was designated as Nemicandra Suri, on his being raised to the status of 'acarya'. This is what can be inferred from Mss. Nos. 659-661. Probably this is the reason why he is referred to as "Devendra Gani, alias Nemicandra Suri" in Keith's Catalogue in No. 7489. P. Peterson, too, is of the same opinion as can be seen from p. VII of his Report for 1884-86. But his entry viz. "By Nemichandra afterwards called Devandragani" is wrong; for, it should be rather just the reverse, 3 From p. 80% of the Appendix I to this third He belongs to Tapa' gaccha according to Klatt. See Indian Antiquary vol. IX. 2 In B. B. R. A. S. vols. III-IV, p. 421, the name of the guru of Devendra Gani is mentioned as Amradeva, It ought to be Amradeva unless there is a variant like a 35 CET in v. to given on p. 21. 3. This mistake is corrected by him in his fourtl Report and there on pp. LIX-LX, he has given detailed information about him. "zrInemicaMdramariya: karnA prastutaprakaraNastha sarvajJAgamaparamArthavadinAmagraNIH kRtinA // 9 anyAM ca sukhAvagamAM yaH kRtavAnuttarAdhyayanavRttiM / gerigrafi a rta aha: 11 "

Page #57
20 Jaina Literature and Philosophy [653. Report ( 1884-86), it follows that Nemicandra Suri, the author of Sukhavagama (Uttaradhyayanavrtti) is the author of Akhyayanamanikosaprakarana, Laguviracarita and Ratnacudacarita'. Subject. The text along with its explanation in Sanskrit. Thus this Sukhabodha of Devendra Gani differs from Sisyahita, the commentary by Vadivetala santi Suri, who has explained the niryukti, too ; but it agrees with it so far as the n irratives are concerned. For, Devendra Gani, too, has given them in Prakrit as was done by santi Suri, his predecessor, just on the lines followed by Haribhadra Suri. This points out an instance which somewhat contradicts the remarks made by E. Leumann about the evolution of Jaina commentaries in Z. D. M. G. vol. XLVI, p. 581ff. For an account of Sukhabodha also known as laguvrtti see Charpentier's introduction (pp. 55-59) to Uttaradhyayanasutra. Begins.- ( text ) fol. I' saMyo(jogA vippamukkassa etc. as in No. 644. , - ( com. ) fol. I" 5 6 // // namaH pravacanAya / praNamya vighnasaMghAtaghAtinastIrthanAyakAn / siddhAMzca sarvasAdhUMzca stutvA ca zrutadevatAM // 1 // AtmasmRtaye vakSye jaDamatisaMkSeparucihitArtha ca / ekaikArthAnabaddhAM vRttiM sUtrasya sukhbodhaa(dhaaN)||2|| bahvarthAdRddhakRtAnaMbhIrAdvivaraNAtsamuddhRtya / adhyayanAnAmuttarapUrvANAmekapAThagataM // 3 // arthAtarANi pAThAMtarANi sUtre ca vRddhaTIkAtaH / boddhavyAni yato(5)yaM prAraMbho gamanikAmAtraM // 4 // etc. Ends.-~~ ( text ) fol. 3284 ii pAukare etc., up to bhavasiddhIya sa(saM)mae // 74 // ,, - ( com.) fol. 328 yoga upadhAnAdivyApArA( rastadanatikramaNa yathAyogamityuttarAdhyayanaTIkAyAM sukhabodhAyAM SaD(da )triMzamadhyayana samAptaM / / ch|| // .. I This is the same work as Tilakamajari-Ritnacusakatha noted in Peterson, Reports III.p.660 2 uttarAdhyayanAnAm ' ityarthaH /

Page #58
6533 I. 4 Mulasutras ityuttarAdhyayanaTIkAyAM Sad( T)triMzamadhyayanaM samAptaM // 36 // asti vistAravAnAmuruzAkhAsamanvitaH / Asevyo bhavyasArthAnAM zrI koTika gaNanumaH // 1 // taduttha vair'shaakhaayaambhuudaaytishaalinii|| vizAlA pratizAkheva zrI caMdra'kulasaMtatiH // 2 tasyAzcotpadyamAnacchadanicayasadRtkA(klA)cakarNAnvayottha zrI thArApadra'gacchaprasavabharala saddharmakiMjalkapAnAt / zrIzAMtyAcAra(rya bhaMgapravaramadhusamAmuttarAdhyAyattiM vidvallokasya dattapramudamudAmuda]girayAM gabhIrArthasArAM // 3 // tasyA(:) samuddhatA ve( caiSA sUtramAvasya vRttikA / ekapAThagatA maMdabuddhInAM hitakAmyayA // 4 // AtmasaMsmaraNArthAya tathA maMdadhiyA myaa|| ato( 5 )parAdhamenaM me kSamaMtu zrutazAlinaH // 5 AsI'ccaMdra kulodbhUto vikhyAto jagatItale / akSamArAjito'pyuccairyaH kSamArAjitaH sadA // 6' dharmo nu mUrtimAneva saumyamUrtiH zazAMkavat / varjitazcAzubhairbhAve(vai) rAgadveSamadAdibhiH // 7 // muninirmalaguNairnityaprazAMtaiH zrutA(ta)zAlibhiH pradyumnamAnadevAdisUribhiH pravirAjitaH / 8 vizrutasya mahApIThe 'bRhad gacchasya maMDanaM / zrImAna vihAruka : pR(pra)STaH(TaH) mUrisa(rudrodyoca(ta)nAbhidhaH // 9 tasya ziSyo'mradevo( )bhUdupAdhyAyaH satAM mataH / yatraikAMtaguNApUrve dopaileMbhe padaM na tu // 10 // deveMdragaNizcevRttavAna vRttikA tadvineyaH / gurusaudaryazrImanmunicaMdrAcAryavacanena // (11) zodhayatu bRhadanugrahabuddhiM mayi vidhAya vijJajanaH / tatra ca mithyAduH(pa)kRtamastu kRtamasaMgataM yadiha // 11 (12 I This and the following one and a liali verses tre found in Sinvaliitit. 2. The substance of this and the verses 8-11 are given in English by Charpentier in his introduction (pp. 56-57) to Uttaradhyay:ithastitral

Page #59
22 Jaina Literature and Philosophy [653. 'aNahillAla pATaka nagare dohaTTizreSThisatkavasatau ca / satiSThatA kRneyaM navakarahara( 1129 )vatsare ce(cai )va // 12 (13) // paTTikAmo(to')likhaJcemA sarvadevAbhidho gaNiH / AtmakarmakSayAyAtha paropakAtahetave / / 13 (14) // dohAddazreSThinA cAsyA lekhitA pathamA zatiH / jinavAkyAnuraktena (bhaktena) guNavajane // (15) anuSTa( STu)pA( bhAM) sahasrANi gaNitaprakriyA bhavet / caturdaza graMthamAnaM tu vRtterasya(syA) vinizcitaM // (16) zrI // zrIrastu // kalyANamastu paM. 14916 (?) zubhaM bhavatu // cha / cha / shrii|| N. B.-- For further particulars see No. 644. Reference.-- Sukhabodha is not published so far as I knows, For extracts etc. from Sukhabodha see No. 5 (pp. 4-5) of F. Kielhorn's " Report on the search for Sanskrit Mss. in the Bombay Presidency during the year 1880-81.Bombay, 1881". For a notice of Sukhabodha and extracts from it see pp. 441-442 of R. G. Bhandarkar's "Report on the search for Sanskrit Mss. in the Bombay Presidency during the year 1883-84.-Bombay, 1887." For tales etc, see the appendix to Sthaviravali--charitra or Parisistaparvan (pp. I-28 ) by Hemacandra Suri edited by H. Jacobi ( Bibliotheca Indica ), Calcutta, 1891. See also his article " Ausgewahlte Erzahlungen in Maharastri" 4 which contains ten of the longest and most interesting stories. This is translated into English by J. J. Meyer in his " Hindu Tales", London, I909. 2. D. M. G. vol. LXIV, p. 397ff., vol. LXVI, p. 38ff., and vol. LXVII, p. 668ff., as well as "Paccekabuddhageschichten", Upsala, I908 may be also referred to as these contributions come from the learned pen of Charpentier. 1-3 These three verses are respectively quoted on pp. 105, 32 and 94 by Muni Punyavijavaji in liis article "Bharatiya Jaina Samskrti ane Lekhanakala" published in Jaina Citrakalpadruma. There he says on these pages that they belong to laghu vytti of Ncmicandra. Furthermore, in his quotations, there is mention of Dohadi and not of Dohati. 4 See p.6.

Page #60
6541) 1. 4 Mulasatras 23 R. Fick's "Eine jainistiche Bearbeitung der Sagara-Sage", Kiel, 1888, H. Jacobi's "Die Jaina Legende von den Untergange Dvaravati's und von dem Tode Ktishna's (2. D. M. G. vol. XLII, p. 493 ff.), Leipzig, 1888, P. E. Pavolini's La novella di Brahmadatta tradotta ed annotata" (Giornale della societa asiatica italiana, vol. VI:), Roma, 1882, his article "Vicende del tipo di Muladeva "(G. S. A. I, vol. IX, ), Firenze, 1896, and H. Jacobi's article "Ueber die Entstehung der Cvetambara und Digambara Sekten (Z. D. M. G. vol. XXXVIII ), Leipzig, 1884 may be also consulted. For an additional Ms. see Limbdi Catalogue Nos. 290, and for description of a Ms. having only the ending portion of this Sukhabodha see Keith's Catalogue No. 7489. N. B.- Though Devendra Gani and Nemicandra are not different individuals, yet for the sake of convenience, references where Nemicandra Suri's name is specifically mentioned as the vrttikara of Uttaradhyayanasutra, are given in No. 659. The reader is therefore requested to refer for them to the " Reference " of this No. ( pp. 30-31). uttarAdhyayanasUtra sukhabodhAsahita Uttaradhyayanasutra with Sukhabodha 3. No. 654 1881-82. Size.-- 334 in. by 18 in. Extent.-- 425 + 2 + 3 - 20 = 410 leaves; 3 to 5 lines to a leaf; 115 to 120 letters to a line. Description.-- Palm-leaf durable and brownish ; Jaina Devanagari characters with qualas ; sufficiently big; legible, and good hand-writing; the first two leaves written in slightly

Page #61
24 "" Jaina Literature and Philosophy 1 654. smaller hand-writing; this Ms. presents an appearance of the work having been written into three separate columns ; but, really speaking, it is not so; for, the lines of the first column extend to the remaining ones; borders of each of the columns ruled in four lines in black ink; red chalk used; there are two extra blank leaves; leaves 79, 407 and 423 repeated; the following sets of leaves are numbered together: Age.- Fairly old. Begins. 93 +94 +95 + 96 + 97 +98; 342 + 343 + 344 + 345 ; 355 +356 + 357 + 358; 370 +371; 387 + 388; 399 + 400 + 401 +402 + 403; 409 + 410; and 415-416; both the text and the commentary complete; some leaves appear to be more modern than the rest; leaves mostly numbered in both the margins; in the right-hand one as 2, R, etc., and in the left-hand one as after about 99 as in other cases, in letter-numerals; condition good; leaves placed between two wooden boards; the Ms. well preserved in a card-board box lined with oil cloth; the last leaf 425th wrongly strung together; extent 14200 slokas. sva }, and then "" (text) leaf rb fag etc., as in No. 644. afIEGIE/ q faga etc., as in No. 653. - (com.) & D leaf Ends.- (text) fol. 425 3 etc., up to as in No. 653. ( com. ) fol. 4254 yoga upadhAnAdivyApAra etc, up to vRtterastha vinizvitaM as in No. 653 followed by // 16 // cha // graMthAgraM 14200 cha / N. B. For further particulars see No. 653.

Page #62
655.] 1. 4 Mulasutras 25 uttarAdhyayanasUtra sukhabodhAsAhita Uttaradhyayanasutra with Sukhabodha 87. No. 655 1872-73. Size.- 109 in. by 43 in. Extent.--- 272 - 1 = 271 folios ; 15 lines to a page; 55 letters to a line. Description.- Country paper rough and white; Jaina Devanagari characters with quaTTIS; small, quite legible and elegant hand-writing; only in the case of foll. 81 to 85 ; borders are ruled in three lines and edges in one, in red ink; in the case of the rest of the foll. they are unruled ; red chalk and yellow pigment used; this Ms. contains the text as well as the commentary styled as Sukhabodha; foll. are numbered twice as usual ; fol. 112 appears to be missing ; but really speaking foll. 112 and 113 are numbered together ; (see the 54 gatha of the 9th adhyayana); fol. 182 appears to be wrongly numbered as 183 ; if so, fol. 183 should be looked upon as repeated; practically edges of the first fol. slightly worn out; a small portion of fol. 272 gone; condition on the whole good; complete ; lacking in colophon; extent 14000 slokas. Age. - Pretty old. Begins.- ( text ) fol. 1b #ta faragata etc. as in No. 644. ,, - (com. ) fol. rby & Q 11 347 ) TA: TEXT #A: 11 sat vItarAgAya namaH / zrIsAradAi(2) namaH // STOFU faghu etc. as in No. 653. Ends. -- ( text ) fol. 2725 ET 1997 etc., up to afh as in No. 644. ,, - (com.), ,, A IT etc. g(9) "TATTOTTAIraga:(7) faexAO etc., up to sukhabodhAyAM patriMzamadhyayanaM samAptaM as in No. 653. This is followed by the lines as under :

Page #63
26 Jaina Literature and Philosophy yadi akSarapada (daiH ) (bhraSTaM svaravyaMjanavajjitaM tU sarva kSama (myatAM devi prasAdaH paramesva ( zva) rI chaH // zrIH graMthA 14000 saMpUrNaH // zubhaM bhUyAt // kalyANaM (Na) mastu (:, // zrIrastu [:] || akSara kUTa AsAtanA huI hUi te ma (micchAmi dukkaDa: ( 7 ) zubhaM bhavatu |: ] || zrIrastu [ ] // cha // // // N. B. For additional information see No. 653. uttarAdhyayana sUtra gedurenka No. 656 Age.-- Fairly old. Begins. [655. Uttaradhyayanasutra with Sukhabodha Size. 10 in. by 4 in. Extent. 262 + 2 = 264 folios; 15 lines to a page; 56 letters to a line. Description. Country paper thin, tough and white; Jaina Devanagari characters; small, legible and elegant hand-writing; borders ruled in four lines in black ink; red chalk and yellow pigment used; numbers for foll. entered twice as usual; a piece of paper of the size of a fol. pasted to fol. 1a; strips of paper pasted to the edges of fol. 262b; condition on the whole very good; fol. 1 blank; foll. 51 and 78 repeated; this Ms. contains the text as well as the commentary Sukhabodha; both complete except that the latter is lacking in colophon; extent 14000 slokas, (text) fol. Ib fag etc. as in No. 644. - ( com. ) fol. 1 960 // namaH zrIpravacanAya // Te fase etc. as in No. 653. 260. 1833-84.

Page #64
637.1 Ends. --- ( text ) fol. 2620 ii pAukare etc., up to bhavasiddhIya samae // 74 // ( com.) fol. 262deg yoga upadhAnAdi etc, up to suSa ( kha ) bodhAyAM SaD ( TU ) triMzamadhyayanaM samAptaM as in No. 655. "" "" - Age.- Pretty old. Begins. N. B. For other details see No. 653. 1 I. 4 Malisatras uttarAdhyayana sUtra geaturaiza No. 657 Size. 11 in. by 43 in. I Extent. 256 folios; 15 lines to a page; 56 letters to a line. Description. Country paper thin and greyish; Jaina Devanagari characters with gears; small, quite legible and good handwriting; borders ruled in four lines in black ink; red chalk and yellow pigment profusely used; a part of fol. 1 kept blank probably with a view to decorate it with an illustration of a Tirthamkara; fol. 1a blank; a piece of paper of the size of a fol. pasted to fol. 1a; margins of some of the foll. slightly worn out; condition tolerably good; this Ms. contains the text as well as the commentary; both complete but the latter is lacking in the colophon to be found in No. 653. (text) fol. 1b ( com. ) fol. r. e 60 // OM namaH sarvajJAya // Uttaradhyayanasutra with Sukhabodha saMjoge (gA ) [ saMyogA ] vippamukkassa etc. as in No. 653. 27 1186. 1886-92. qa fara etc., as in No. 653. Ends. (text) fol. 256b faq etc., up to a as in No. 655.

Page #65
Jaina Literature and philosophy (657. Ends. (com. ) fol. 2560 FIT Jurante etc., up to afaetui as in No. 653 followed by colorariaardi gel fagated FATA I J 11 38 11 Then in a different hand we have :'rAjalakSmIgA(ga)Ni zrI kharataragacche zrIjinacaMdrasUvijayarAjyapra.. rAjalakSmIgaNinyA ziSyaNyA prapuNyazobhAgaNinyA zrIuttarAdhya yanakA puNyArtha pradattA pUnAIpaThanArtha N. B.-- For additional information see No. 653. uttarAdhyayanasUtra sukhabodhAsahita Uttaradhyayanasutra with Sukhabodha 164. No. 658 1871-72. Size.--104 in. by 48 in. Extent.285 - 5 = 280 folios; 15 lines to a page ; 55 letters to a line. Description.- Country paper tough and white ; Jaina Devanagari characters with occasional rahats; sufficiently big, legible and good hand-writing; borders ruled in four lines in black ink; numbers for foll. entered twice as usual; red chalk used ; this Ms. contains the text as well as the commentary ; foll. 265 to 270 missing ; otherwise both complete.; of course, there is no colophon; extent 14452 slokas; fol. 1a blank; a few foll. slightly worm-eaten ; the last fol. ( 285th ) partly worn out; condition very fair ; in the lefthand margins, the title is written as zrIuttadeg ladeg vRtti and 3FF TO Age. - Old. Begins. - ( text ) fol. 1b HAITI acquif etc. as in No. 644. ,, -- ( com. ) fol. roy & Oil qatar ##: 11 TORT FESTa etc., as in No. 653. Ends.- (text ) fol. 285 7 913FT etc., up to ath as in No. 655 followed by 65

Page #66
659. 1 1. Mulasutras End.-- (com. ) fol. 185" to geuraile etc., up io Fratari - FESTAETTA FAIR as in No. 65; followed by gl J FATNE !? TS T Torso ?8842 il sofrera (:) 113 ll TH HIL 11:11? N. B.- lor further particulars sce No. 653. uttarAdhyayanasUtra sukhabodhAsahita Uttaradll ya yanasutra with Sukhabodha 88. No. 659 1872-73. Size.--- 13. in. by sfin. Extent.-- 214 +1+2=217 folios; 15 lines to a page ; 70 letters to a line. Description. Country paper thin and greyish ; Jaina Devanagari characters; sufficiently big, legible and good hand-writing; borders ruled in two pairs of lines in black ink; the space between these pairs coloured yellow ; numbers for foli, entered only once ; unnumbered sides have so to say it Square in the centre only and the numbered, in each of the two margins, tov; this Ms. contains the text as well as the commentary; both completo : names of the 36 adhyayanas along with the Nos. of the foll. where each ends, are given on fol. 2140; red chalk used; a piece of paper of the size of a fol. pasted to fol. 1a; fol. 1* blank; fol. 82 repeated ; fol 86 repeated twice ; almost all foll. more or less worm eaten ; condition very fair. Age.--- Pretty old. Author of the commentary, Nemicandra Suri alias Devendra (rani. Subject. -- 'The text in Prakrit along with its explanation in Sanskrit. begnes -- ( text ) toi !" in faqaat etc. as in No. 6.14 1 - (com. ) fol. 1 & 01 TA ETA 11 praNamya vighnasaMghAta etc. ! This is tuled lah ti too. S. N. 661.. 33.

Page #67
Jaina Literature and Philosophy [659. Ends.--- ( text ) fol. 2144 iti pAukare buddhe etc., up to bhavasiddhIya saMbuDe as in No. 645. 30 " - ( com. ) fol. 214 * yoga upadhAnAdi etc., up to padaM na tu // 6 // This is, however, No. 1o according to No. 653; for, here the fifth verse is numbered as I ). This is followed by the lines as under :-. zrInemicaMdrasUriruddhRtavAn vRttikAM tadvineyaH guruso (sau)daryazrImanmunicaMdrA (cA) vacanena / 7 zodhayatu bRhadanugrahabuddhiM mayi saMvidhyA (dhA) ya vijJajanaH / tatra ca mithyAduH kRtamastu kRtamasaMgataM yadiha // 8 zubhaM bhavatu // cha // kalyANaM (Na) mastu || || cha / zrI // // 3 // This is followed by the following lines different hand :-- zrIuttarAdhyayanavRrtti ( tti ) pustikaM likhitaM / cha | paripUrNamiti // cha // zrI // cha // written in a 1 vinayAdhyayanaM 2 parISAdhyayana 3 caturiMgiyA 4 asaMkhayaM 5 akAmamaraNaM 6 kSullakana ( 7 urabhI (zrI) yAdhya 8 kapilIyaM 9 namirAjapratyeka patra 9 (,,) 31 44 56 61 patra patra (",) (,, ) (,, ) 64 69 73 86 93 97 (,, ) (,,) (,, ) (,, patra 103 (,, ) 115 10 gautamacaritraM 11 bahuzrutaM (?) 12 harikesiya 13 citrasaMbhUti 14 iNu (bu) kAraM patra 120 15 siddha ( ? ) adhyayanaM (,, ) 122 16 brahmacarye 17 pApazramaNaM / 18 saMyatarAja / patra 124 (,, ) 126 (,, ) 146 19 mRgAputraM // 20 mahAnigraM ( ) thaM 21 samudrapA 22 rahane mi 23 kezigotamaM 24 pravacanamAtA 25 vijayaghoSaM 26 sAmAcArI 27 bu (pa)laM (laM) kI yAdhya 28 mokSamArga 29 samyaktvapa 30 tapomArga | 31 caraNavidhi 32 apramAda 33 karmaprakRti 34 lezA (zyA) 35 anagAraguNaM 36 jIvAjIvaM patra 150 (,, ) 153 (,, ) 155 (,, ) (,, ) (,, ) (,, ) (,, ) (,, ) (,, ) 160 170 (,, ) (,, ) 172 174 177 179 182 189 192 196 (,, ) 202 (,, ) 203 (,, ) 205 (,, ) 207 (,, ) 214 Reference. For description of an additional Ms. having both the text and Sukhabodha see B. B. R. A. S. vols. III-IV,

Page #68
660. p. 383. Here it is said that the author may be Nemicandra". Moreover, there is a query as under: 1. 4 Malasatras 2) "Is it an Avacuri extracted from Santi Suri's Sisyahita?" uttarAdhyayana sUtra sukhabodhAsahita For description of a Ms. having the text and laghuvrtti by Nemicandra Suri, see Keith's Catalogue No. 7488. No. 660 For description of a palm-leaf Ms. at Cambay, which contains the text and Subodha (this commentary) see Peterson, Reports III, p. 71 On pp. 71-72 extracts are given. For an additional Ms. having the text and laghuvrtti corrected by Tejoraja in Samvat 1550 see Limbdi Catalogue No. 288. N. B. For other details see No. 653 (p. CC 31 #m faqat etc. as in No. 644. - ( com. ) fol. 1 zrIsarasvatyai namaH // To farenim etc. as in No. 653. ). Uttaradhyayanasutra with Sukhabodha Size.-97 in. by 4 in. Extent. 345 folios; 15 lines to a page; 40 letters to a line. Description. Country paper rough and white; Jaina Devanagari characters; big, clear and good hand-writing: borders ruled in four lines in black ink; red chalk and yellow pigment used; a part of the first fol. torn; several foll. more or less worm-eaten; condition unsatisfactory; this Ms. contains the text and the commentary; both complete. Age.- Fairly old. Begins. (text) fol. 1b 690. 1899-1915.

Page #69
32 Jaina Literature and Philosophy [ 661. clc., up to af as in No. 644. This is followed by || 265 // The mAhAtmya pointed out in verses by the nirvuktikara is also given here. com.) fol. 1 3 ctc., up to as in No. 659. The number of the last verse is mentiond as 12. Then we find the following lines :-- anuSTubhyAM (bhAM) sahasrANi gaNita (pra) kriyAbhavana (tU) dvAdaza graMthamAnaM tu / vRtterasyA vinizvitaM // 13 // iti zrauittarAdhyayanavRtti ( : ) samAptaH (tA) | zrI / cArukIrttirAH maNinidhibhiH sakalavAcakonasaiH zrI... pratiriyaM muktA // 2 // iti zreyaH // N. B. For other details see No. 659. Ends.(text) fol. 345" afa m Age. uttarAdhyayana sUtra goaiuraika No. 661 Size. 10 in. by 4 in. Extent. 360-2+1=359 folios: 13 lines to a page; 46 letters to a line. Description. 1-2 khyAta FEREST Uttaradhyayanasutra with Sukhabodha 635. 1892-95. ; Country paper thin and greyish; Jaina Devanagari characters with gears; small, clear and very fair handwriting; borders ruled in two to three lines in black ink red chalk and yellow pigment used; numbers for foll. entered only once; fol. 58 repeated; foll. 1 and 360 blank; foll. 110 and III numbered as 1010 and 101; foll. 136 to. 359 also numbered as 1, 2 etc. in the same (right-hand) margin; a piece of paper of the size of a fol. pasted to fol. 360b; edges of the first fol. slightly worn out; several foll. more or less worm-eaten; some even very badly: condition very fair; this Ms. contains the text and the commentary as well; both almost complete; for, only foll. 49 and 241 missing; extent 14427 slokas. Samvat 1479. These letters are illegible owing to their being blurred ont

Page #70
661.] Begins. ( text ) fol.rb "" " 1. saMjogA vippamukkarasa etc. as in No. 644. -- ( com. ) fol. 1o u C/ 0 11 3 (?) ami fraqiniq ax: 11 praNamya vighnasaMghAta etc., as in No. 653. Ends.- ( text ) fol. 3594 iti pAukare up to saMbuDe as in No. 644. 4 Mulasitras - ( com.) fol. 359deg yoga upadhAnAdi etc., practically up to yadiha // mas in No. 653. This is followed by the lines as under :-- saM (sa)mAptA // saMvat 1479 varSe jyeSTharAdi SaSTayAM ravau zrIzrI ' upakezagacche zrIsiddhAcArya saMtAne kaH pUjyo vibudha budhaiH kimaparaM dhe (dhyeyaM sabhAM (bhA) saMmata kaH sarvatra gati [ ] jaine vada paraM kasmAcca tattvaM bhuvi kasmina zAsati jAyate gatabhayA pRthvI prakAmonvatA vizvaM kastimiraiH karoti rahitaM zrIbhUpateH kena vA ? // 1 // eteSAM kila zabdAnAmAyaMtAkSaralopanAt saMjAyate ( 5 ) bhidhA yasya sA ( so ) 'yaM sUriH zriye ( 7 ) stu vaH // 2 // S prakAza (pra) bhAva pracaMDa pratApaM prazastaM praNaumi prabhAtapraveze prabhuM taM prakRSTaM prasiddhaM pradhAnaM 33 prarUDhagrahapuNyaprarohaM prasUriM // 3 // evaMvidhaguNopeta bhaTTArakazrIzrI devaguptasUrINAmAdezena ziSyANurU (ru)pAdhyAyazrIvinayaprabheNa AtmapaThanArtha zrInemicaMdrasUriviracitA zrIuttarAdhyayana laghuvRtti (ni) nijasaMca (?) pustake nijagurvAjJayA liSApitA leSakena likhitA zrI uttarAdhyayanavRtti ( : ) saMpUrNA // graMthAgra 14227 etc. Reference.--- This Ms. appears to be the same as numbered 135 of 1892-95 and referred to by Charpentier in his introduction (p. 64 ) to Uttaradhyayanasutra; for, in the Government Collections there is no Ms. numbered as 135 of coll. 1892-95 containing Sukhabodha. N. B.-- For additional information see No. 653.

Page #71
Jaina Literature and Philosophy 1.662, sukhabodhA (37TETA Sukhabodha ( Uttaradhyayanasutravrtti ) ) No. 662 1881-82. Size.- 26 in. by 18 in. Extent. 345 - I = 344 leaves ; 3 to 5 lines to a leaf ; 115 to 120 letters to a line. Description.-- Palm-leaf durable and brownish ; Jaina Devanagari characters with TAIS; sufficiently big, legible, uniform and good hand-writing ; this Ms. presents an appearance of the work having been written into three separate columns ; but, really it is not so ; for, the lines of the first column are continued to the rest; borders of each of the columns mostly ruled in two lines in black ink ; leaves numbered in both the margins : in the right-hand one as 2, etc., and in the left-hand one mostly in letter-numerals e. g. the ist as'}, the 2nd as, the 3rd as, the 4th as of etc., leaves 128 and 129 bracketted ; this Ms. contains gares of the text; complete ; condition good; well-preserved in a cardboard box lined with oil cloth; leaves placed between two wooden boards ; leaves 218, 269 and 345 have artistic designs ; leaves 18 and 3455 blank. Age.-- Sauvat 1164 i. e. to say 35 years after its composition. Author.. Devendra Gani. Subject.- Urtaradhyayanasutra explained in Sanskrit. Begins.-- Icaf 1 QATA: TITAN! TOPFT E Empana etc., as in No. 653. Ends.- leaf 34' IT G rate etc., up to faraisaa as in No. 653 This is followed by the lines as under :

Page #72
663. ] 1. 4 Malasutras saMvat 1164 mArgazudi 10 budhadine azvinInakSatre parighayoge 'Amalezvara'grAmAvasthitena paMDitamAdhavena uttarAdhyayanavRttipustakaM jarabara il 31 akSaramAtrapadasvarahIna vyaMjanasaMdhivivarjitarapha / sAdhubhi'...ma kSamitavyaM ko(s)tra na muhyati zAstrasamudre // ? T 11 ATS AETATI Il z 1 Reference. --- Amongst the 6 Mss. written on palm-leaf and 23 on paper regarding Uttaradhyayanasutra and its commentaries seen by Charpentier, he looks upon this as the best. See his introduction (p. 62 ) to Uttaradhyayanasutra. See also Z. D. M. G. vol. LXVII, p. 665H., where it has been described by him. A facsimile is also given there. According to Jacobi, the date given at the end here corresponds to Wednesday, November 27, 1107 A. D. N. B.- For other details see Nos. 644 and 653. sukhabodhA Sukhabodha No. 663 1880-81. Size - 324 in. by 21 in. Extent.-- 393 + 1 + 1 - 2 = 393 leaves ; 3 to 6 lines to a leaf; 125 to 130 letters to a line. Description.-- Palm leaf durable and greyish ; Jaina Devanagari characters with AFTS ; big, legible, uniform and good hand-writing; this Ms. presents an appearance of the work having been written into three separate columns; but, really it is not so, since the lines of the first column extend to the remaining ones; borders of each of the columns mostly ruled in three lines in black ink ; leaf ra blank; an extra 1 Letters are gone. They ought to be TA.

Page #73
Jasna Literature and Philosophy [663. leaf at the end practically blank ; leaves numbered in both the margins ; in the right-hand one as 1, 2, 3 etc., and in the left-hand one as zrI) zrI) zrI) - / , 1 2 .36, parka, etc.; condition good ; well-preserved ' in a card-board box lined with oil cloth ; leaves placed between two wooden boards ; leaf 109 repeated; leaves 197, 198 and 199 numbered together, that is to say leaf 197 also numbered as 198 and 199 ; this Ms. contains gares of the text; it is lacking in prasasti ; otherwise complete'; bought in Samvat I40I and presented to a Jaina saint Jinalabdhi by name; extent 12000 slokas. Age.-- Samvat I342. Begins.-- fol. 1deg 5 0 // namaH srvjnyaay| praNamya vighnasaMghAta etc. , as in No. 653. Ends.--- fol. 393 jo( yo )ga upadhAnAdi etc., up to sukhabodhAyAM patriMzada dhyayana samAtaM and then from anuSTubhAM sahasrANi up to vinizcitaM / / as in No. 653. This is followed by the lines as under : graMthAna 12000||ch // sadanati........... uttarAdhyayanaTIkAyAM sukhabodhAyAM etc. up to vinizcitaM as above repeated followed by graMthAnaM 12000 cha saMvat 1342 kA varSe vaizASavadi 7 mai(?) dine uttarAdhyayanapusta ............! likhitaM / .........'cha Then we have on an additional leaf the following lines which are on the whole written in a different hand : saMvat 1401 varSe mAghamAse zuklatrayodazIdine sA0 dhIMdhAsatasA0mohaNasuzrAvakeNa svamAturdhAdhaladavisuzrAvikApuNyAthai zrIuttarAdhyayanasUtraratipustakaM mUlyena gRhItvA zrI kharataragacche zrIjinapadmasUripaTTAlaMkArazrIjinalabdhisUrisugurubhyaH prAdAyi / pratidinaM ca vAcyamAnaM munibhizciraM naMdatAt // gotrA(?) kAMkarikA bhidhe bhuvi babhUvodAbhidhAnaH zu( su )dhIH zrAddhaM(ddhaH) zuddhanayastadIyatanayo dhaMdhAbhidhaH zrIlayaH 1-2 Charpentier says the same thing in his introduction (p. 63 ) to Uttaradhyayanasutra. 3-5 Letters are gone.

Page #74
664.] 1.4 Milasitras 37 kAMtA dhAMdhaladevikA( 5 )sya tanujAratatkA jayaMti trayaH puNyAmohaNakRSNakAMkSaNa iti khyAtAH sutA muktikA // 1 // mohaNena nijamAtRsupuNyazrInimittamidamuttamapustaM zra(zu)cyuttarAdhyayanasUtrasuvRtyoH saMpragRhya ghanamUlyadhaNena // zrIjinalabdhiyatIzvaragurave prAdAyi vAcanA( nAM ) vidhAya / yAvajjinamatametandatu munivAcyamAnAmaha // 3 yugmaM // cha / N. B.---- For other details see No. 662. uttarAdhyayanasUtra Uttaradhyayanasutra avacUrisahita with avacuri 633. No. 664 1892-95. Size.-- 101 in. by 4; in. Extent.---- ( text) so folios ; 16 lines to a page; 46 letters to a line. ,, -( com.) ,, , , 34 , ,, ,, ,; I4 ,, ,, ,, ,, " ,. Description.- Country paper thin and greyish ; Jaina Devanagari characters with pRSThamAtrAs; this is a pazcapATI Ms. , the text written in a bigger hand as compared with that of avacuri; small, legible and good hand-writing; ink faded at times ; the central portion as well the margins decorated with nice small pictures ; borders ruled ; numbers for foll. entered only once, and that too, in the right-hand margin ; edges of the foll. slightly worn out ; this Ms. contains both the text and the commentary ; fol. 1b decorated with mangalas like svastika, nandyavarta, etc.; condition very fair; com plete. Age.- Samvat 1485. Author of the avacuri.-- Not mentioned. Subject.-- The text along with a small commentary in Sanskrit. Begins.- ( text ) fol. I aha // saMjogA vippamukkassa etc. 1-2 These numbers refer to a column,

Page #75
Jaina Literature and Philosophy [ 664. Begins.- ( com. ) fol. 12 RETA: saMyogAnmAtrAdi kaSAyAdi bAhyAbhyaMtarabhedAt vividhi:( ? dhaiH ) prakAraiH Tranraaiera: stanietua laatque etc. Ends.-- (text ) fol. 5ob GIF etc., up to ata as in No 644. This is followed by Il FV Il siatsiaIHTT HETTON HATI I ll far gifs FIT CASATEIFFTANTI I PET etc., up to gaafat ga urafa ( 8 ) 11 as in No. 675. Then we have: -- saM0 1485 varSa AsA likhitaM >> -- (com. ) fol. 5ob o gara... TIT Fifa una etc. This portion is not sufficiently legible. Reference. For a Ms. having this text and notes see the " Cata logue of newly discovered, rare and old Mss. in the Lahore Division ", Lahore, 1881. uttarAdhyayanasUtra Uttaradhyayanasutra vRttisahita with vrtti 1187. No. 665 1886-92. Size.- 104 in. by 43 in. Extent.-- 284 folios; 13 lines to a page ; 40 letters to a line. Description.- Country paper rough and white; Jaina Devanagari characters with ears; big, clear and good hand-writing; borders ruled in four lines in black ink ; yellow pigment used; numbers for foll. entered only once; fol. 1a blank except that the title of this work is written on it; this Ms. contains the text and the commentary as well; both complete ; condition excellent; extent 8260 slokas; the com mentary composed in Samvat 1525. Age.-- Not later than Samvat 1710. Author of the commentary.- Kirtivallabha Gani, pupil of Jaya kesarin Suri.

Page #76
665.] Subject. Begins. -- ( text ) fol. r' namaH zrIsarvvajJAya namaH // saMjogA vimukkassa etc. - ( com. ) fol. 1 ahaM bhikSorvinayaM prAduHkariSyAmi prakaTIkariSyAmi AnupUrvyA krameNa me mama etc. " " I. 4 Mnlasutras The text along with a commentary in Sanskrit. " Ends. -- ( text ) fol. 284 2 iti pAukare etc., up to bemi as in No 646. samaMtAna iSTAn bhavasiddhikasaMmatAn // 272 iti (:) samAptau bravImi sudharmasvAmI jaMbUsvAminaM prati Aha // iti uke triMzAdhyayanaM jIvAjIvavibhaktyAkhyaM / / 36 iti zrIuttarAdhyayana vRttiH saMpUrNA // AsIta zrIvarapaTTe pravaragaNadhara ( : ) zrIsudharmAbhidhAnastatpaTTe svAmijaMbUprabhavamukha mahAsurirAjo babhUvuH 1 sarveSA.... sphuTapaTupadavI bhAradharttA maheMdraH sUrIMdrANAmazeSa kSititalAvedito merutuMgo munIMdraH // 1 tatpaTTAMbujarAjahaMsasadra (dR) zo vidyAvatAmIzvaraH zrImatzrI jayakIrtimUriprabhugurustatpaTTacUDAmaNiH / sUrizrIjayakesariprabhu (su) gurustatpaTTaghasre ( ? )zvaraH siddhAMtAnusAgaro vijayate sUrIzvaraH sAMprataM // 2 ccho nanu kIrtivallabhagaNirmugdhAgramI ( ? NI ) mahato pRSTavyAkaraNoktivRttimAlikhya ( kha ) mugdhaprabodhapradAM pUrvairnirmitadIpikAdikamahAgraMthAnusArAtsvaka - ( com ) " prajJAvedanazva savaguruprauDhaprasakteH punaH // 3 saMvat paMcadaze dvipaMca (1525 ) gaNita (te) varSe ca harSaprade 'vAda' nAmna nagare dIpotsave nirmitA yAvacchrIjinazAsanaM vijayate sarvotsavaiH sarvata stAvannaMdatu vRttikA kavijanairvAvacyamAnA sanA // 4 kAkyatayA mayA punariyaM saMzodhitA nAsti bho vidvadbhistu paropakAranirataiH zodhyA visu ( zu ) ddhAtmabhiH / buddhestucchatayA yadatra kimapi nyUnaM tathA vA(s) dhikaM tatsarva kSamatAma ( ba ) baddhaM viruddhaM ca yat // 5 // 39

Page #77
40 uttarAdhyayana sUtra akSarArthasahita dr ------ Jaina Literature and Philosophy aSTau sahasrA dizatI ca SaSTiH zlokAstatazvopari paMca varNAH / pratyekavarNa parimANametad get fa3/4P$?AP3/4iaT: 11 & 11 graMthAgraM 8260 / / iti zrIuttarAdhyayanavRttiH saMpUrNA etc. No. 666 Size. 101 in. by 4 in. Extent.(text) 111 folios; 12 to 19 lines to a page; 70 letters to a line. (com.) III folios; 21' lines to a page; 192 letters to a line. Age. Samvat 1701. Author of the aksarartha. Subject. [665. Uttaradhyayanasitra with aksarartha 1171. 1884-1887. Description.- Country paper thin and white; Jaina Devanagari characters with gas; this is a qq Ms.; the text written in the centre in a sufficiently big hand-writing; legible, uniform and very good hand-writing; borders ruled in four lines and edges in one, 'in black ink; red chalk used; white pigment, too; unnumbered sides have in red colour a disc in the centre only; the numbered, in each of the two margins, too; this Ms. contains the text and its commentary as well; fol. 1a blank; numbers for foll. entered only once in the right-hand margin; corners of some of the last foll. slightly worn out; edges of the fol. 111th partly gone; condition on the whole very good; complete. Not mentioned. The text along with a small commentary in Sanskrit containing narratives. 1-2 These numbers refer to a column.

Page #78
666.] I. 4. Malasatras Begins.- ( text ) fol. I" e saMjogA viSpamukkassa etc. ,, - (com. ) fol. 1 hai namo vItarAgAya // arhatsiddhAcAryopAdhyAyamunIn praNamya vivRNomi smRtyarthamuttarAdhyayanAnAM gAthAkSarArtha( 2 ) kathaM // 1 // saMjo0 saMyogAnmAtrAdi bAhyAbhyaMtarabhedAt vividhaiH prakArairjJAnabhAvanAdibhiH / avidyamAnaM dravyabhAvabhedabhinnama'gAramasyetya'nagArastasya / etc. kUlavAlakazramaNavat dRSTAMto / yathA // ekasyAcAryasya durvinItaH ziSyaH etc. Ends.--- ( text ) fol. III ia pAukare etc., up to bemi as in No. 644. This is followed by the lines as under : jIvAjIvavibhattinAma ajjhayaNaM 36 uttarajjhayaNasuyakvaMdho sammatto niyuktikAramAhAtmya je kira etc., up to puvarisI eva bhAsaMti // 71 // zubhaM bhavatu // 36 // iti zrIuttarAdhyayA(yanA)ni likhApitAni 'DIsAvAla' jJAtIyasaMgoiMdabhAryAsutasaMjogAkena bhAryAbhrAtRbhogAdikuTuMbayugena paMDitaprakAMDapaM0 merurAjagANiziSyavibudhamaMDalIspRhaNIyazIlapaM0jJAnazIlagaNivAcanArtha saMvat 1527 varSe // ||ch // etc. saMvat 17010 (?) varSe zrI kRSNagaDha nagare pratilAbhitA pratiriyaM bhazrIvijayadevamUriziSyapaM0kapUravijayagaNInAM // muM0 zrIrAyacaMdakena zrIrUpasiMghajI rAjye -- ( com. ) fol. III guruprasAdAd gurucittaprasannatArUpAddhayetAH / adhIyeta paThenna tu pramAdaM kuryAditi bhAvaH // guruprasAdAditi adhyayanArthinA'vazyaM guravastoSyAstadadhInatvAttasyeti // 3 / 4 / 5 / zivamastu naH // cha / followed by the following lines in a very big hand: liSItaM paM0zrIpaM jayavijayagaNidi(dI)pavije(ja)yagaNIni(nI) A parata che 'devasu(sUraM gacche - 6 | I. L. P.1

Page #79
42 Jaina Literature and Philosophy [667. 261. uttarAdhyayanasUtra Uttaradhyayanasutra akSarArthalavalezasahita with aksararthala valesa No.667 1883-84. Size.- 104 in. by 44 in. Extent.- 143 folios; 16 lines to a page ; 44 letters to a line. Description.- Country paper thin, rough and white; Jaina Deva nagari characters; small, legible and very fair hand-writing; borders ruled in four lines in black ink; red chalk used; numbers for foll. entered only once ; fol. ra blank ; a bit of paper pasted to fol. 4"; condition very good; this Ms. contains the text as well as its explanation in Sanskrit which is further elucidated in Gujarati; complete : extent 6598 slokas. Agc.- Sainvat I592. Author of the aksarathalavales'a.-- Not mentioned. Subject.-- The text along with a commentary in Sanskrit and its explanation in Gujarati. Begins.- (text) fol. 1 OM namaH zrIvarddhamAnAya svAhA // saMjogA vippamukkassa etc. , - (com.) fol. I arthaH / bhikSovinayaM prAduHkariSyAmi / AnupUrtyA meM mama kathayata / zRNuta / AnupUrvI anukramaI kahitAM sAMbhali etc. Ends.-- ( text ) fol. 143" iya ( pAu )kare buddhe etc., up to bemi as in No. 666. This is followed by // 82 // --- ( com. ) fol. 143deg iti etAn SaTtriMzat uttarAdhyena yena uttarAdhya yanAni prAduskRtya kAMzcit arthataH / sUtrataH prakAzya buddhakevalI jJAtayo jJAtaputraH zrIvarddhamAnasvAmI parinidRta (:) nirvANaM praaptH| kiMdhiziSTAna uttarAdhyAyAna bhavasiddhikA bhavyajIvAsteSAM samatAn iSTAn // 82 iti SaDrotriMzana(t) zrIuttarAdhyayanAkSarArthalavaleza(H) smaaptH| saMvat15920 varSe AsaujamAse zuklapakSe dvAdazyAM tithau shukrvaasre| zrI caitra'gacche gacchanAyakazrIharSarAjasUrIsva(zva)rANAM / tatza(cchi)jyaza( ziSyAnaza(zi )dhya

Page #80
668.] I. 4 Malasatras munimuniratnena lililiSitaM // zrIrastu // rANAzrIvikramAdityarAjye 'kaThADa'grAmamadhye liSitA etc. kalA yasyaikaiva vibhuvanagurormeDanamabhUt ___ sudhA sarve yasya tridazavaravandAnyatithayaH / kRto'sau yeneduH sakalajanavastrAMcaladazA [so yaM] pratigrAhI kAlaH sakalanahi kiM kiM na kurute // 1 graMthAyaM 6598 uttarAdhyayanasUtra akSarArthalavalezasahita Uttaradhyayanasutra with aksararthalavalesa No. 668 1320. 1891-95. Size.-- IO! in. by 41 in. Extent.-- 138 folios; 15 lines to a page; 48 letters to a line. Description. - Country paper rough and greyish ; Jaina Devanagari characters with occasional TAES ; small, legible and good hand-writing ; borders ruled in two pairs of lines in black ink; the space between these pairs coloured red; foll. num. bered in the right-hand margin only; small discs in red colour to be found in the centre and the margins as well, both in the case of the numbered and unnumbered sides; this Ms. contains the text as well as the commentary ; a piece of paper of the size of a fol. pasted to foll, ja and 138b; each of them decorated with designs in red colour ; this Ms. seems to be exposed to rain ; perhaps that is why a few foll. in the beginning are not quite legible; red chalk and yellow pigment used; some of the foll. somewhat torn; strips of paper pasted to fol. 138b; condition very fair ; both the text and the commentaries complete except that the Gujarati commentary does not seem to go up to the end

Page #81
44 Jaina Literature and Philosophy [668. Age.-- Samvat 1621. Author of the aksararthalavalesa. -- Not mentioned. Subject.- A Jaina agama with its explanation in Sanskrit and Gujarati as well. Begins.--- ( text ) fol. rdeg 0 namaH sarvajJAya / / saMjogA vippamukkassa etc. ,, -- ( com. ) fol. I bhikSoH vinayaM prAduHkariSyAmi / AnupUrvyA me mama kathayataH shRnnut| ,, -- (Guj. com.) fol. 1deg bhikSu mahAtmyanai vinayamArga prakaTa karisu Anu __ pUrvyA anukramiiM mujanai kahatAM etc. Ends.-- ( text ) fol. 137' iti pAukare etc., up to bemi // as in No. 646. * -- (com.) ,, ,, iti etAn SaTtriMzataM uttarAdhyAyAn etc. samatAna iSTAn / 270 / iti jIvAjIvavibhaktinAmA patriMzat uttraadhyynaakssraarthlvleshH| je kira bhavasiddhiyA etc., up to guruppasAyA ahijijjA / 2 / Then we have as under : saMvat 1621 varSe vaizASazudi 15 ravau zrI aMcalaM gacche zrIzrImarutuMgamUrizA( ? )dhyeya( ? )ziSyaupAdhyAyazrI3dhamanaMdanatatsa(cchi)SyapaM0zrIdharmavardhanagaNitatsa( cchi vyapaM zrIvinayazIlagaNitatsa( cchi )Syi( Sya )paM zrIvidyAzIlagaNiza( zi )dhyamunivivekameruza(ziSyasahijA svayameva vAcyamAnArtha liSApitaM / yAdRzaM etc. ,, - ( Guj. com. ) fol. 84 kezakumAra gautama pratii boliuM pAza kehA kahyA etc.

Page #82
669. 1 uttarAdhyayana sUtra akSarArthalavalezasahita Begins. (text) fol. 1a: far 33 33 No. 669 Size. 11 in. by 47 in. Extent. 132 folios; 15 lines to a page; 54 letters to a line. Description.-Country paper thin, rough and greyish; Jaina Devanagari characters with gears; small, legible and good hand-writing; borders ruled in two pairs of lines in black ink; the space between these pairs coloured red; red chalk used; yellow pigment, too; foll. numbered in the right-hand margin only; unnumbered sides have a small disc in red colour, in the centre only; the numbered, in each of the two margins, too; fol. ra blank; each of the foll. 1 and 2a has an illustration of a Jina in various colours; edges of of the first two foll. slightly damaged; several foll. more or less worm-eaten; some very badly; a strip of paper pasted to fol. 132b; condition on the whole fair; both the text and the commentaries complete. Age.- Pretty old. Author of the aksararthalavalesa.- Not mentioned. Subject. The text in Prakrit together with its elucidation in Sanskrit and Gujarati as well. Ends. (text) fol. 132 :) 1. 4 Mulasutras faca etc., as in No. 644. - ( com. ) fol. 1" bhikSAH vinayaM prAduH kariSyAmi etc. -(Guj. com. ) fol. 1 fg ag etc. Uttaradhyayanasutra with aksararthalavalesa wr 45 etc., up to a as in No. 668. w - (com.),, iti etAn patriMzataM up to saMmatAn iSTAna // 69 etc., practically as in No. 667 followed by the lines as under : 847. 1895-1902.

Page #83
Jaina Literature and Philosophy 1669. iti patriMzatauttarAdhyayanAkSarArthalavalezaH // cha // je kira bhavaHITTAT etc., TECHITT EIGHFHT 11 11 as in No. 668. Then we have : iti zubhaM bhavatu leSakavAcakazca / kalyANamastu zrIzramaNasaMghAya bhadraM // // Then some letters are not legible owing to the paper being pasted over them. devagaNita ( letters scratched ) vyapaM vAcaka(?)maMdiramuni leSayitA // zubhaM bhavatu // -- (Guj. com.) fol. 113a Fiat FA AUT O (S ET TATO TAU TAA is ctc. This is just about the end of the 33rd chapter. uttarAdhyayanasUtra Uttaradhyayanasutra vRttisahita with vrtti 1097 No. 670 1887-91. Size.- 10. in. by 42 in. Extent.-- 346 - 1 + 1 - 14 = 332 folios; 17 lines to a page ; 42 letters to a line. Description. --- Country paper tough and white; Jaina Devanagari characters; small, quite legible and good hand-writing; borders ruled in three lines and edges in one, in red ink; the ist fol. lacking ; foll. 2 to 20 more modern than the rest ; fol. 297 repeated ; red chalk and yellow pigment used ; numbers for only foll. i to 20 entered twice as usual ; these foll. are followed by older foll. starting with the 15th number ; so that foll. I to 14 missing ; condition very good; the text and the commentary almost complete; the latter composed in Samvat 1689; extent of the text 2000 slokas, that of the vstti 14255 and that of both 16255. Age.-- Not modern. Author of the commentary. Upadhyaya Bhavavijaya Gani, pupil of Mahopadhyaya Munivimala Gani of the Tapa gaccha.

Page #84
670.] 1, 4 Malasutras 47 Subject.-- The text in Prakrit together with its elucidation in Sanskrit. Begins.--- ( text ) fol. 24 ANANI(ni)de( de )sayare gurUNamuvavAyakArae iMgiAgArasaMpanne se viNIe tti vuccai' ,, -- (com.) fol. 2" sakAzAt zaNuta zravaNaM prati sAvadhAnA bhavaMtu anena vAkyena dharmamabhidhAtukAmena dhIdhanena pUrva zrotA'bhimukhaH kartavya iti sUcitaM etc. ,, -- (com.) fol. IS4 zrIvimalaharSagaNimahopAdhyAyazrImunivimala[harSa] gaNiziSyopAdhyAyazrIbhAvavijayagaNi etc. -- ( text ) fol. 345" ii pAukare buddhe etc., up to bemi as in No. 644. -- (com. ) fol. 345deg uttarAH pradhAnA adhyAyA adhyayanAni uttarAdhyAyAstAn bhavasiddhikAnAM bhanyAnAM saMmatAnabhipretAn itiH parisamAptau bravImIti prAgvaditi sUtrArthaH // 266 // ____ iti zrI tapA'gacchIyamahopAdhyAyazrIvimalaharSagaNimahopAdhyAyazrImunivimalagaNiziSyAzravo( ? )pAdhyAyazrIbhAvavijayagaNisamarthitAyAM zrIuttarAdhyayanasUtravRttau SaTtriMzamadhyayanaM saMpUrNam // 36 // dharmakalpadrumaskaMdhasyAsya zrutaskaMdhasya niyuktikAro( 5 )pyevaM mAhAtmyamAha je kira bhavasiddhIA etc. iti saMpUrNA zrIuttarAdhyayanasUtravRttiH // cha / arha // anaMtakalyANaniketanaM taM namAmi zaMkhezvarapArzvanAthaM / yasya prabhAvAvarasiddhisaudha madhyAsta nirvighnamasau prayatnaH // 1 // zriyA jayAMta dyutamaiMdavIM dvAra mudA( 5 )bhivaMde zrutadevatAM taaN| prasAdamAsAdya yadIyameSA vRttirmayA maMdadhiyA(5)pi tene // 2 // satkIrtilakSmIparivarddhamAnaM zrIvarddhamAnaM jinarAjamIDe / I This is the second verse.

Page #85
Jaina Literature and Philosophy [ 670. punAti lokaM surasArthazAlI yadAgamo 'gAMga' iva pravAhaH // 3 // tAcha(nchi)SyamukhyaH sakaladdhipAtraM zrIgautamo me zivatAtirastu / gaNI sudharmA ca satAM sudharmA vaho(s)stu viirprbhudttpttttH||4|| 'jaMbUdvIpe 'suragiri riva 'caMdra'kulaM vibhAti tdvNshe| 'merauM' 'naMdana'vanamiva tasminnaMdati 'tpaagcchH|| 5 // satra manoramasumanorAjivirAjI rarAja munirAjaH // zrIANaMdavimalagururamaratarunaMdana' ivoccaiH||6|| zuddhAM kriyAM dadhau yaH sudhAvratavratatimiva mrudvkssH| kalpataroH saurabhamiva yasya yazo vyAnaze vizvaM // 7 // tatpadRgaganadinamaNirajaniSTa janeSTadAnadevamANiH / zrIvijayadAnamunimaNiranaNuguNAdharitarajAnamANaH // 8 // zrImAna jagadgururiti prathitastadIya. paTTe sa hIravijayAhvayamUrirAsIt / yo'STaga(TA?)pi siddhilalanAH samamAliliMga tasya(? spa) yeva digibhAMzca yadIyakIrtiH // 9 / / zramiAna(5)kabbaranRpAMbudharo(s)dhigamya zrIsUrinirjarapateriha yasya vAcaM / jaMtuvrajAnabhayadAnajalairanalyai rapINayat paTahavAdanagArja pUrva // 10 // tatpadRbhUSaNamaNigaNilakSmikAMtaH mUrirbabhau vijayasena iti pratItaH yo'kabbarAdhipasabhedvijapairyadIya gobhirjitairgururapi dyutimAnamAni // 11 // vijayatilakaH sUriH paDheM tadIyamadIdipad dinakara iva vyomastomaharaMstamasA kSaNAt / prasRmaramahAH padmolAsAghaho jaDatApaho vidAlatamahAdoSa kaptodayaH sudinazriyAM // 12 dhiSaNAdhiSaNAdezyAprekSA giraH zravasoha) sudhA adharitadharaM dhairya yasya kssmaa(s)nukRtkssmaa|

Page #86
670.] 1.4Malasatras jagati mahimA hemakSoNIdharadvayaso yazaH zazijayakara nAbhUtkasyAdbha(dbhu)tAya muniprabhoH // 13 // tIye paTTe sadguNagaNamaNizreNinidhayaH kSamApIrAMbho dhI)nidhaya ucitAcAravidhayaH / svabhaktecchApUrtitridazataravo buddhiguravo jayaMti zrImaMto vijayivijayANaMdaguravaH // 14 // teSAM 'tapA'gaNapayonidhizItabhAsAM vizvatrayojanamanoramakIrtibhAsAM vAgvaibhavAdharitasAdhusudhAsavAnAM rAjye ciraM vijayini vrativAsavAnAM // 15 // itshv| ziSyAH zrIvijayAdidAnasuguroH siddhAMtavArAnidheH zrIkAMtAH paratIrthikavrajarajaHpuMjaikapAthodharAH / pUrva zrIvimalAdiharSaguravaH zrIvAcakA jajJire yairvairAgyarati virtAya viratiM cakre mamopakriyA // 16 // vineyAsteSAM ca prasRmarayazaHpUritAdizaH zrutaM dattvA maadRgjddjnmhaanugrhkRtH| mahopAdhyAyazrImunivimalapAdAH samabhavan bhavodanvanmajjajjananivahabohitthasadRzaH // 17 // vairaMgikANAmupakArakANAM vacAsvanAM kIrtimatAM kviinaaN| adhyApakAnAM sudhiyAM ca madhye dadhuH sadA ye prathamatvameva // 18 // teSAM ziSyANurimAM bhAvavijayavAcako(3)likhad vRtti svaparAdhabodhavidhaye svalpadhiyAmapi sukhAvagamAM // 19 // nidhivasurasavasudhA 1689 mite(ta)varSe zrI rohiNI'mahApuryo / so'syAH prathamAdarza svayameva prApayatsiddhiM // 20 // guNagaNasuratarusuragirikalpaistasyAgrajaH satI,yazca / zrIvijayaharSakRtibhirvidadhe sAhAyyamiha samyak / 21 // anusRtya pUrvavRtti(tI)likhitAyAmapi yadatra duSTaM syAt / tacchodhyaM mayi kRtvA kRpAM kRtIMdreH prakRtisaralaiH // 22 // zrIzaMkhezvarapArzvaprabhuprabhAvAtprabhUtazubhabhAvAt / AcaMdrAke( ka ) naMdatu vRttirasau modayaMtI jJAna // 23 / / TA.S. NI

Page #87
Jaina Literature and Philosophy [670. zAMtiM tuSTiM puSTiM zreyaHsaMtAnasAkhyakamalAzca / vyAkhyAtRzrotRRNAM vRttirasau dizatu maMgalaikagRha // 24 // prazastiH // sasUtrAyAmiha zlokasaMkhyA saMkhyAya nirmitA paMcapaMcA~ze zate dve sahasrANi ca SoDaza // 25 // zrIsUtragraMthAnaM 2000 // vRttigraMthAgraM 14255 // ubhayaM 16255 // zrIrastu etc. __paMDinazrIzrIzrIbhakticaMdragaNI tazi(cchi )vyapaMDitazrImayAcaMdagaNI tatAza( cchi )SyaparaMgacaMdagaNili. AtmArtha svavAcana // Reference.-- Charpentier makes the following remark regarding this Ms. in his introduction to Uttaradhyayanasutra (p.64):-- ___ " one of the best written Mss. I ever saw." For description of additional Mss. having both the text and this commentary see B. B. R. A. S. vols. III-IV, p. 383 ( Nos. 1414-1415). From the first four introductary verses given here we learn that this commentary is styled as vyakhya by Bhavavijaya, and there were several commentaries composed prior to this. uttarAdhyayanasUtra Uttaradhyayanasutra dIpikAsahita with dipika 1095. No. 671 1887-91. Size.- To in. by 5 in. Extent. -- 389+2+10 I + I-I =492 folios; I3 lines to a page ; 44 letters to a line. Description.-- Country paper rough, tough and white ; Jaina Deva nagari characters; big, quite legible and very good handwriting; borders ruled in two lines and edges in one, in red ink ; numbers for foll. I to 247 entered twice as usual; the rest numbered only once ; foll. 228 and 282 repeated

Page #88
671. 1 I. 4 Malasatras separate foliation for adhyayanas 30 to 36; fol. 38th repeated ; fol. 72 missing; fol. 46th wrongly numbered as 45 ; red chalk used ; this Ms. contains the text as well as its commentary; practically complete; condition excellent; a portion not required blurred out with black ink (vide fol. 58a); yellow pigment used at times (see fol. 2514 ) ; foll. 368 to 389 also numbered as 1, 2 etc.; foll. 1 and 389b blank. Age. -- Sarvat 1907. Author of the commentary. dhyaya Laksmikirti Gani. Subject. The text along with its explanation in Sanskrit. W Begins.- ( text ) fol. r " saMyo(jo )gA vippamukkassa etc. - (com) fol. 1 zrIgurubhyo (bhyo ) namaH // arhato jJAnabhAjaH suravaramahitAH siddhisaudhasthasiddhAH paMcAcArapravINAH praguNagaNadharAH pAThakAzvAgamAnAM loke lokezavaMdyAH sakalayativarAH sAdhudharmAbhilInAH paMcApyete sadA (ss) tAH vidadhatu kuzalaM vighnanAzaM vidhAya 1 aari kSIrasiMdhudakArvimalaguNaM manmathAripraghAtaM zrIpArzva vighnavallI vanadalanavidhau visphuratkAMtidhAraM sAnaMda caMdrabhUtyAdRtavacanarasaM dattadRkkarNabodha Laksmivallabha Gani, pupil of Upa vaMde (S) bhUribhaktyA tribhuvanamahitaM vAGmanaH kAyayogaiH 2 uttarAdhyayanasUtravRttayaH saMti yadyapi jagatyanekazaH mugdhahRtsadanabodhadIpikAM dIpikAmiva tanomyahaM punaH 3 prAptacAruvibhavo girAM giraH zrIgurozva vizadaprabhAvataH bakti lakSmyupapadastu vallabhaH sajjanA mayi bhavaMtu sAdarAH 4 yugmaM etc. zrIsudharmA ( ma ) svAmI jaMbUsvAminaM vakti etc. Sr

Page #89
sa wd Jaina Literature and Philosophy Ends. (text) fol. 100 etc., up to af as in No. 644. - (com.),, bhAgyavataH puruSasyaita (va) nirvighnaM ete adhyAyAH saMpUrNA vafa qa: "Avifa agiawania xafa #garmfq" zya: 8 iti zrImaduttarAdhyayana sUtrArthadIpikAyAM upAdhyAyazrIlakSmIkIrttigaNiziSyalakSmIvallabhagaNiviracitAyAM jIvAjIvavibhaktinAma padatriMzamadhyayanaM saMpUrNa // saM. 1907 varSe // ww Reference. Charpentier says on p. 64 of his introduction to Uttaradhyayanasutra that "this is very recent Ms. dated samv. 1907 1851 A. D. ), but very well written ". uttarAdhyayana sUtradIpikA No. 672 [ 671. For a notice of the Ms. having the text and this dipika see No. 1534 of Rajendralala Mitra's "A Catalogue of Sanskrit Mss. in the library of His Highness the Maharaja of Bikaner", Calcutta, 1880. P. E. Pavolini's Appunti di novellistica indiana (G. S. A. I. vol. XII), Firenze, may be also consulted. Uttaradhyayanasutradipika Size. 10g in. by 3 in. Extent. 190 folios; 14 lines to a page; 60 letters to a line. Description.- Country paper thin, rough and greyish; Jaina Devanagari characters with gears; small, legible and good hand-writing; borders ruled in four lines in black ink; red chalk used; numbers for foll. written twice, but in one and the same margin; unnumbered sides have a disc in red colour, in the centre; the numbered, in each of the two margins, too; strips of paper pasted to the corners of foll. 126 to 174; some of the last foll. seem to be new; some of the foll. slightly worm-eaten; condition good; complete; this Ms. contains only the fs of the Uttaradhyayanasutra. 89. 1872-73.

Page #90
673.] I. 4 Malasatras Age.--. Fairly old. Author..- Not mentioned. Subject.-- A commentary to Uttaradhyayanasutra, containing kathas. Begins.--- fol. I / / ahaM / / zrIuttarAdhyayanasya kiMcidarthaH kathAzca likhyante / iha 'uttarAdhyayana'zabdArthaH / uttarANi pradhAnAni pUrva zrIzavyaMbhavaM yAvaccaturdazapUvi(vi)kAlo(le) AcArAMgAdatu paThyamAnatvena tato dazakAliko paJyamAnatvena zreSThAni adhyayanAni uttarAdhyayanAni / etc. Ends.-- fol. I90 zrutajinAdibhiH prajJaptAna prarUpitAn anaMtaiga(ga )mairarthabhedaiH paryavaiH zabdArthaparyAye(yai): saMyuktAna adhyAyAn yathAyoga( gaM) upadhAnAyucitakriyA tadanatikrameNa uttarAdhyAyAn gurUNAM prasAdA(t)dhyAyeta uttarAdhyayanayogyatAyAM pAThadaH(1) pramattaH / etadadhyayanArthinA'vazyaM guravaH prasAdyA ityrthH|| cha // iti samAptA zrIuttarAdhyayanadIpikA samAptamitiH etc. uttarAdhyayanasUtradIpikA Uttaradhyayanasutradipika 634. No. 673 1892-95. Size.-- 10 in. by 4; in. Extent.-- 266 folios ; 13 lines to a page ; 40 letters to a line. Description -- Country paper thin and white; Jaina Devanagari characters with pRSThamAtrA ; big, quite legible and good handwriting ; borders ruled in four lines in black ink ; foll. 1 to 152 numbered only once; most of the rest twice as usual ; fol. 104 to 114 also numbered as 1, 2 etc. ; fol. 1* blank; edges of the first and the last foll. slightly worn out; yellow pigment used; complete ; extent 8600 slokas ; con dition good. Age.-- Samvat 1683. Author.- Not mentioned. Subject.- A commentary to Uttaradhyayanasutra.

Page #91
$4 Begins. - fol. r" ahana (arhama) Ends. Jaina Literature and Philosophy zrIuttarAdhyayanasya kiMcidartha (:) kathAzrva likhyaMte (1) iha 'uttarAdhyazabdArthaH uttarANi pradhAnAni pUrva zrIzayyaMbhavaM yAvaccaturdazapUrvikAle AcArAMgAdanu paThyamAnatvena tato dazakAlikordhva paTayamAnatvena zreSThAni adhyayanAni uttarAdhyayanA (ni) nirvANakAle etc. fol. 2664 yathAyogaM yoga upadhAnAdyucitakriyA tadanatikrameNa uttarAdhyayAn gurUNAM prasAdAdadhIyet (ta) uttarAdhyayanayogyatAyAM paThedapramatto yenArthinA ( 5 ) - vazyaM gurava ( : ) prasAyA ityarthaH / iti samAptA zrIuttarAdhyayanadIpikA // cha // jogavihIe etc. and jassA dar3hatA etc, up to evaM bhAsati. This is followed by the lines as under :--- 2 zrIrastu / uttarAdhyayana sUtra bAlAvabodhasahita No. 674 saMzayAMdhatamaso (S) pahAriNI satprakAzaparamopakAriNI u ( ta ) rAdhyayanadIpikA ciraM prayatAM munijanaini (? zvi )raM // 1 / gacchAdhipazrI jayakIrttisUrI zvaropadezazravaNena dU(ha) STA: malIlikhata pustakaratnametat 2 SaDazIti zatAnyA (nya )trAnuSTupAM saptatistathA pratyakSaraM nirIkSyaivaM graMthamAnaM vinizvitaM // 3 graMthAgraM 8670 // zrI saMvat 1683 varSe bhAdrapadravadi 4 dine vRdhe // zrIrastu etc. sadbhAvasArAH paramArthahetu [673. Size. -- 1o in. by 42 in. Uttaradhyayanasutra with balavabodha 259. 1883-84.

Page #92
674. I. 4 Malasatras 55 Extent. - 233 - 3 = 230 folios ; 11 lines to a page; 38 letters to a line. Description. Country paper thin and grey; Jaina Devanagari characters with pRSThamAtrAs; quite bold, big, clear, uniform and good hand-writing; borders ruled in four lines in black ink ; foll. I, II and 212 missing; edges of the first and the last few foll. slightly damaged; dandas or vertical lines in red ink; numbers for the adhyayanas marked in the left-hand margin, whereas those for foll, as usual in the right-hand margin ; red chalk used; foll. 215 to 225 more or less worm-eaten ; condition on the woole good ; this Ms contains the text and its balavabodha as well; the text practically from the second hemistich of the fourth verse of the first chapter and the balavabodha from the 4th. Age. Samvat 1575. Begins. -- ( text ) fol. 2 "" 39 vaso / evaM dussI pADe (Da) NIe muharI nikkAsejjaI | 4 kaNakuMDagaM caittANaM viTTaM bhuMjai sUpare / evaM sIlaM caittANaM dussIle ramaI mie / 5 etc. ( bala ) fol 2a Ends.- ( text ) fol. 233b jima...... jihAM jAi tihAM thakI kADhIi / eNa dRSTAMti ima dusIla anAcArI // etc. iti (ya) pAukare buddhe NAyae pArina / chattIsaM uttarajjhAe bhavasiddhIya samae tti bemi / 73 (273 ) / ( balao ) fol. 233deg e chatrIsa zrIuttarAdhyayana vimala nirmala guNi karI jayavaMtA / je mAhaMta sakalazAsana mAhi AcArya upAdhyAya kRta bAlAvibodha | tehanai anasAriMha e bAlAvibodha sAdhu sAdhvI e vAcyamAna hu~tu suSa zreya kalyANa heti hui / chaH // graMthAgraM 6250 // chaH || || saMvata (va) 1575 varSe pauSavadi 9 ravau likhitaM zrIgaMdhAsAMdiresAdasiMgha 2 / (? rA ) jasatapaMcAyaNapaThanArtha[ ] // //

Page #93
56 Jaina Literature and Philosophy 674. Reference.- For Mss. having the text and anonymous balavabodhas see Limbdi Catalogue Nos, 276, 280 and 281. No. 280 records only one Ms., and that is dated as Sarivat 1792, where as No. 281, three, out of which two are dated as 1594 and 1764 respectively. uttarAdhyayanasUtra TabbAsahita Uttaradhyayanasutra with tabba No. 675 160. 1871-72. Size.-- 10 in. by 4 in. Extent.- (text) 263 folios ; 4 to 17 lines to a page : 30 letters to a line. ,, - (tabba ) 263 folios ; 6 lines to a page ; 59 letters to a line. Description. Country paper sufficiently thick and white ; Jaina Devanagari characters with occasional gehiats ; bold, clear, and elegant hand-writing ; this Ms. contains both the text and its explanation in Gujarati; four lines of the text written on each side in big hand: over each line, there is the corresponding explanation written comparatively in much smaller hand-writing: there is only text on foll. 6 to 65; the space left blank for the corresponding explanation; borders ruled in three lines in red ink ; foll. ja and 263b blank ; from the 66th fol. onwards the hand-writing for the text is still bigger than before and the paper grey; numbers for foll. entered in two different margins on one and the same side; over and the above the text, this Ms. contains 4 verses of the faglite wherein the importance of this work is pointed out; condition very good; both the text and the explanation complete. Age.- Samyat 1695.

Page #94
675.. I. 4 Mulasatras Author.-- A pupil of Parsvacandra and a devotee of Ajitacandra. Subject.-- The text along with its explanation in Gujarati. Begins.- ( tex1 ) fol. 1 aiM namaH ___ saMjogA vippamukkassa etc., as in No. 644. , - (com. ) fol. 10 varddhamAna jinaM natvA pArzvacaMdra ca madguruM AjitacaMdramunIMdraM ca TabArtho likhyate mayA 1 pUrva saMyoga mAtAdikano pazcAt saMyoga sva(zva)surAdikano athavA bAhya saMyoga dravyAdikano abhyaMtara saMyoga viSayAdikano etc. Ends.-- ( text ) fol. 2620 ii pAukare buddhe nAyae parinivvue chattIsaM uttarajjhAe bhavasiddhIya sa(saM)mae tti bemi 270 36 iti jIvAjIvavibhattiajjhayaNaM 36 atha niyuktikAra etabaMthamAhAtmyamAha je kira bhavasiddhIyA parittasaMsAriyA ya je bhavvA ti(te) kira paDhaMti ee chattIsaM uttarajjhAe ? tamhA jipaNNate aNaMtagamapajjavehiM saMja(jutte ajjhAe jaha(hA)jogaM guruSpasAyA ahijjijjA 2 jogavihIi va(vi)hittAe ehiM jo lahai suttaM(ta) atthaM vA bhAsei bhaviyajaNo so pAvai nijjaraM viulaM 3 jassADhattA ee kahA vi samapaMti vidhe(ggha)rahiyassa so lakkhijai bhanyo puvArasI eva bhAsaMti 4' cUliyA sammattA iti zrIuttarAdhyayana 36 samApta viNayapasihacauraMgijjhaM saMkhaakAmakhuDaniggaMthaM urabbhI kAvaliyaM namipavajjA dumapattaM 1 bahussuyahariesijjaM cittasaMbhUijha(jjha)yaNa usuyAraM sabhikkhU baMbhaguttI pAvasamaNijja saMjjaijjaM 2 miyAputtaM niyaMThaM samuddapAlIyaM nAma rahanemI kesIgoyamapavaNasAyara janaijjA samAyArI 3 I See pp. 10 and 11: 8 IIPI

Page #95
Jaina Literature and Philosophy 1675. SP khalukiyaM sivamaMggaMgaisammattaparakkama sugamaM taM(ta)vamaggaM caraNavihI pamAyaThANaM ca kamayapaTTI 4 lesANagAramaggaM jIvAjAvAvibhatti chattIsaM / jiNagahaharamuNivutte uttarajjhayaNe paNivayAmi 5 // cha / saMvat 1695 varSe mAgaseramAse kRSNapakSe 11 dine laSitaM. Ends.-- ( com. ) fol. 2624 chatrIsa uttara pradhAna vinayazrutAdika adhyayana bhavya jIva jeha chai tehanai eha 36 uttarAdhyayana samata vAlhA hui eha vacana satya jANichau ehavau sudharmasvAmI jaMbU pratii kahai 270 jIvAjIvavibhattI adhyayana atha kahyau chai mii lezamAtra thakI etc., up to eha uttarAdhyayananI cUlikAnau artha kAuM miI iti zrIuttarAdhyayana sUtraTabArtha 36 samAptaH / cha / graMthA0 sarvato(5)pi 9000 zubhaM bhavatu. Reference.--- For Mss. having the text and an anonymous tabba see Limbdi Catalogue No. 291. Its Nos. 292, 293 and 283 refer to Mss. having the text and the tabbas by Megharaja Vacaka, Ajicandra Suri and Dharmamandira Upadhyaya respectively. The tabba in the last case is styled as Makaranda. uttarAdhyayanasUtra TabbA tathA kathA sahita Uttaradhyayanasutra with tabba and kathas No.676 161. 1871-72. Size.- 94 in. by 4 in. Extent.- 316 + I = 317 folios; I4 lines to a page ; 38 letters to a line. ,, - (tabba ) 317 iolios ; 17 lines to a page; 48 letters to a line.. Description.- Country paper thin and white; Jaina Devanagari characters with occasional pRSThamAtrAs; the text written in a bigger hand as compared with the tabba ; legible and good

Page #96
676.] Age.- Samvat 1761. Author of the tabba. - Pasacanda ( Sk. Parsvacandra ). kathas.-- Padmasagara. Subject. The text together with its explanation in Gujarati and stories in Sanskrit. Begins.-- ( text ) fol. rb " " Ends. 1. 4 Malasatras 59 hand-writing; borders ruled in three lines and edges in one, in red ink; numbers for foll. entered twice as usual; fol. 6th repeated; fol. 1a blank; so is the fol. 316b; yellow pigment used; condition very good; both the text and the tabba complete ; extent of the text 2000 slokas, that of the tabba 7000, that of the kathas 5000 and total extent 14000 slokas. "" dr 29 saMjogA vippamukkassa etc. (tabba ) fol. rb natvA zrI ahaM namaH // prathama zrIuttarAdhyayana graMthanuM zabdArthaH kahIi chi // zrImahAvAriniM ThA ( ? ) prathama zrIAcArAMga bhaNIniM pachi / uttarAdhyayana bhaNatA etc. saMjoganu vipramukta je sAdhu te saMyoga bihuM prakAre eka dhana dhAnyAdika bIju rAgAdika kaSAyAdika etc. - ( kathas ) fol. 24 zrIsadgurubhyo namaH // praNamya zrImahAvIraM namrAkhaMDalamaMDalaM / AramyaMte kathAH kartumuttarAdhyayanasthitA ( : ) // 1 // uttarAdhyayanatra (bRha (drava ) ttigatA: kathA ( : ) saMskRtAH kartumArabhyate // etc. ( text ) fol. 315b ii pAukare etc., up to bemi as in No. 644. This is followed by jIvAjIvavibhatti ajjhayaNaM sammattaM // 36 // cha iti zrIuttarAdhyayanazrutaskaMdha saMpUrNa // cha // yAdRzaM etc. saMvat 1761 varSe kArtika vadi 14 bhome laSitaM || lekhakapAThakayoH zubhaM bhavatu // graMthAgra sUtra 2000 // cha // etc. - ( kathas ) fol. 2240 paMcaviMzAdhyayane vijayaghoSacaritaM lezato likhyate / ' vANArasyAM ' nagaryA dvau viprau bhrAtarau jayaghoSavijayaghoSau

Page #97
dr Jaina Literature and Philosophy abhUtAM etc. paMcaviMzAdhyayane kathA 98 samAptAH / etAvatA uttarAdhyabRhadvRttigatAH prAkRtakathAH sarvA ( a ) pi saMskRtA ( : ) kRtAH paMDitazrI - padmasAgaragaNinA kRtAH // Size. - ( tabba ) fol. 3162 etalI jIvAjIvavibhatti nAmA adhyayana chatrIsamAnuM Tabu iti zrI arthavivaraNa saMpUrNa havai 36 // iti zrIuttarAdhyayanazrutaskaMdhaH samAptaH // mUtrasaMkhyAgAthAsaMdhyA zloka 2000 pAsacaMdasUrikRta Tabu tena (nI) zlokasaMkhyA 7000 kathA padmasAgarI zloka 5000 evaM miline (te) sarvazloka saMkhyA 14000 jehavuM pustaka etc. uttarAdhyayanasUtra akSarArthalavalezasahita No. 677 saMvata 1761 varSe zAke 1626 pravarttamAne mArgaziSa mAse zukapakSe caturthI 4 ravivAsare lipIkRtaM / laSanArAni bhaNanArAni sAMbhalanArAni zreya kalyANa hayo || jJAnasAgarajInI parati cheM sahI 3 - 92 in. by 44 in. 676 Uttaradhyayanasutra with aksararthalavalesa Extent. - 192 folios; 12 lines to a page; 34 letters to a line. Description.-- Country paper thin, smooth and white : Jaina Devanagari characters with pRSThamAtrAs; bold, big, clear, uniform and good hand-writing; borders ruled in three lines in red ink; red chalk and yellow pigment used; foll. 1a and 192b blank; every fol. numbered twice, on one and the same side but in different margins; this Ms. contains both the text and its explanation mostly in Gujarati; complete; a small strip of paper pasted to the first fol.; condition very good. Age.-- Not very old. Author of the balavabodha. - Not mentioned. 1096. 1877-91.

Page #98
677:] 1.4 Malasatras ___ Subject.-- The text along with its explanation styled here as balavabodha, too. Begins.-- (text ) fol. 1b saMjogA vippamukkassa etc., as in No. 644. ,, - ( balavabodha ) fol. I bhikSorahaM vinayaM prAduHkariSyAmi / AnupUrvyA meva me ma(ma) kathayataH zRNuta bhikSu mahAtmAnai vinayamA mArga pragaTa karisuH AnupUrvI anukrami majhanai kahitAM iMtAM sAMbhalu etc. Ends.- ( text ) fol. 1924 iti(i) (pA)ukare budhe(ddhe ) NAyae parinicuDe(e) chattIsaM uttarajjhAe / bhavasiddhi(ddhI )ya saMbu(bu)De tti 82 (282) bemi // - ( balan ) fol. 192" iti etAn padvatriMzat uttarAdhyAyAn / uttarAdhyAyanAni prAduska(ka)tya kAMzcit arthataH kAMzcit sUtrataH prakAzya budhaH kevalI jJAtajo jJAtaputraH zrIvarddhamAnasvAmI parinirvataH nirvANaM prAptaH // kiMviziSTAna uttarAdhyAyAn bhavisiddhikA bhavyajIvAsteSAM saMmatAn iSTAn // 82 // iti patriMzata / zrIuttarAdhyayanAkSarArtha(tha)lavalezaH // cha // iti zrIuttarAdhyayanabAlAvibodha saMpUrNaH // cha / yAdRzaM pustake etc. This is followed by two verses, one in Gujarati and one in Sanskrit as under : re prANI suNi bappaDA / jima nArInUM dhyAMna / tima kari paramezvara tnnuuN| jima lAbhai svargavimAna // 1 // kalyANamastuH // gItazAstravinodena / kAlo gacha( ccha )ti dhiimtaa(m)| visanneneha mUrSANAM / nI(ni)drAyA kulaheni ca // 2 // ch|| zrIH // shru|| cha /

Page #99
Jaina Literature and Philosophy 1 678. uttarAdhyayanasUtra Uttaradhyayanasutra bAlAvabodha tathA kathA sahita with balavabodha and kathas No. 678 8. 1869-70. Size.- 1o, in. by 4; in. Extent.- 254-3=251 folios; Is lines to a page; 31 to 50 letters to a line. Description. - Country paper rough, white and not very thin Jaina Devanagari characters; bold, big, uniform, legible and elegant hand-writing ; borders ruled in four lines in red ink, and edges, in two; this Ms. contains the text, its explanation in Gujarati and narrations in Sanskrit illustrating the prescribed rules; this Ms. seems to be incomplete ; for, the text contains only 22 adhyayanas and the illustrations up to the 23rd ; the 24th adhyayana requires no illustrations and the 25th has only one small illustration needed ; later on, no stories are to be found so far as the remaining adhyayanas are concerned ; that may be the reason why this work ends here ; numbers for foll, written in two different margins on one and the same side ; foll. 113 to ris missing; fol. 1276 kept blank; fol. 6 slightly torn; fol. 245 torn; condition fair. Age.- Not quite modern. Subject.-- Stories illustrating the gathas of Uttaradhyayanasutra along with a Gujarati explanation of these gathas. Begins.- ( text ) fol. 24 THT atacante : 11 TTT Pacque as in No. 644. >> - (balavabodha ) fol. 15 TEHT FA: 11 FORT stagrali etc., as in No. 684. This first verse is followed by the lines as under : uttarAdhyayana kahatAM syo artha zrImahAvIranaiM dhArai // AcAraMga Hufe E TRTET Huat etc.

Page #100
679.] I. 4 Malasutras 63 Begins-- ( kathas ) fol. 2h trIjI gAthAyAM kUlavAlakakathA // 1 // yathA ekasya AcAryasya kSullako'vinItaH / tasya AcAryaH zikSArthe tADayati etc. ( text ) fol. 249b Ends.. evaM karaMti saMbuddhA / paMDiyA paripakkhagA || "" " ti (ti) bemi // 51 // ( ) ti bhoge || jahA se ( so ) purisottamo rahanemijjhaM samattaM // - (balavabodha ) fol. 249deg iti zrIrahaneminAmAdhyayana bAvIsamAno artha TabA mAtra graMthaprakAriM ihAM likhyo saMpUrNa 22 fol. 254deg ( kathas ) zakrAdibhistatraiva hita iti / evaM prasaMgataH / zrIpArzvacaritrava(1ma) bhidhAyatatprAziSyazrIkesicaritrasaMbaddhamidamadhyayanamiti / trayoviMzatitamadhyayanakathA samAptAH // zrI // zrI // zrI // uttarAdhyayana sUtra ( adhyayana 18 - 21 ) carsahita No. 679 " Size.-10 in. by 4 in. Extent.--- (text) 15 folios ; 6 lines to a page ; 48 letters to a line. --(tabba),, ; 13 to 16 lines to a page ; 65 to 70 letters to a line. Uttaradhyayanasutra ( Adhyayanas XVIII-XXI ) with tabba " 463. 1882-83. Description.-- Country paper thick, rough and white; Jaina Devanagari characters with occasional gears; the text written in a bigger hand as compared with the tabba which is written in a very small hand; legible and good hand-writing; borders ruled in two lines and edges in one, in red ink; this Ms. contains the text of chapters 18 to 21 and the corresponding tabba ; foll numbered in the left-hand margin only; red chalk used; both the text and

Page #101
Jaina Literature and Philosophy (679. the tabba. complete so far as I8 to 21 adhyayanas are con cerned ; condition very good. Age. -- Old. Author of the tabba.-- Not mentioned. Subject. The text along with its explanation in Gujarati. The former deals with the life of Samjaya, that of Mrgaputra, characteristics of a true saint and the life of Samudrapala. Each of these topics occupies one adhyayana, Begins.-- ( text ) fol. I aiM 'kaMpille' nayare rAyA udinnabalavAhaNe nAmeNa saMjae nAma migavaM uvaniggae 1 etc. , -(tabba ) fol. I 'kaMpilya'nAmA nagaranai viSai rAjA desAdhipati udaya Avyau bala caturaMga sainya athavA zarIranau bala vAhana etc. Ends.- (text) fol. 15* duviha( haM ) khaveUNa ya punnapAvaM niraMgaNe sabao vippmukke| tarittA samudaM ca mahAbhavohaM samuddapAle apuNAgamaM gai(?e ) // tti bemi 24 iti zrIsamuddapAliyajjhayaNaM samattaM 21 -(rabba ) fol. IF eha hu kahuM sudharmasvAmi jaMbU prataiM ima kahai 24 // iti zrIsamudrapAlIya adhyayananau artha lezamAtra thako jANivau saMpUrNa kaauN21|| Reference.-- See No. 644. mahAnirgranthIyAdhyayana (mahAniyaMThijjajjhayaNa) TabbAsahita No. 680 Mahanirgranthiyadhyayana ( Mahaniyanthijjajjhayana ) with tabba 676. 1899-1915. Size.- 10. in. by 4 in.

Page #102
680.] 14 Malasntras Extent.-- 9 folios; s lines to a page; 32 letters to a line. Description.-- Country paper thin and greyish ; Jaina Devanagari characters ; bold, clear and good hand-writing ; borders ruled in three lines in red ink; cdges of the first fol. slightly damaged ; condition tolerably good; yellow pig ment used : fol. gb blank ; this Ms. contains the text and its explanation in Gujarati known as tabba; both complete. Agc.-- Samvat 1761. Author of the tabba.--Not mentioned. Subject.-- This twentieth chapter of Uttaradhyayanasutra along with its explanation in Gujarati deals with the life of Anathi muni, with whom Srenika discussed why he had renounced the world. This chapter throws much light on the rules and regulations meant for a Jaina saint. So it is named as Mahaniyanthijja ( Mahanirgranthiya). Begins.-- (text) fol. Ib siddhANaM namo kiccA saMjayANaM ca bhaavo| atthadhammagai(I) tacaM aNusaTTi(TTi ) suNeha me / 1 // etc. ",, - ( tabba ) fol. I" siya arihaMta / siddhanaiM na namaskAra ki0 karInaiM saM0 saMyatI AcArya upAdhyAya sarva sAdhunaiM bhAvathI etc. Ends.- ( text ) fol. 9a iyaro vi guNasamiddho tiguttigutto tidaMDavirao ya / vihaga iva vippamukko viharai vasuhaM vigayamoho / tti bemi // 60 // iti zrIanAthi / saM0 1761 pauSa zu0 5 budha paM0zrIjJAnavijayatacchiSyapaM0zrIvRddhivijayazi mAhimAvijayabhrAtA deveMdravijaya lipiirutaa|

Page #103
66 uttarAdhyayana sUtraniryukti (uttarajjhayaNasuttanijjutti ) No. 681 Jaina Literature and Philosophy I Uttaradhyayanasutraniryukti (Uttarajjha yanasuttanijjutti) 1094. 1887-91, Size. 10 in. by 41 in. Extent. 13 folios; 17 lines to a page; 52 letters to a line. Description. Country paper thin, rough and greyish; Jaina Devanagari characters; small, legible and fair hand-writing; borders ruled in two lines; yellow pigment and red chalk used; numbers for foll. entered only once, and that, too, in the right-hand margin; some of the foll. slightly wormeaten; condition good; complete; 600+4= 604 verses in all, Age. Pretty old. Author. [681. Bhadrabahusvamin according to the vrtti on Dharmaghosa's Rsimandalastotra etc. Jarl Charpentier does not endorse this opinion especially because he says that in v. 110 Sthulabhadra, the successor of Bhadrabahusvamin is styled as bhagavam-Thulabhaddo and such a thing cannot have been said by his far older predecessor Bhadrabahusvamin. For other objections raised by him see pp. 48 and 49 of the introduction to Uttaradhyayanasutra. Subject. A commentary in verses in Prakrit, elucidating Uttaradhyayanasutra. From the two verses of Avasyakasutraniryukti we learn that this is the 3rd niryukti out of ten. 1 For the meaning of the word nijjutti' see my article "The Jaina Commentaries" (pp. 295-296) published in the "Annals of the Bhandarkar Oriental Research Institute" (vol XVI, pts. III-IV). 2 See p. 67. 3 They are as under :-- 66 Avasyassa dasakAliyassa taha uttarajjhamAyAre / sUyagaDe nijjuttiM vocchAmi tahA dasANaM ca // 82 // kapparasa ya nijjuttiM vavahArasseva paramaniuNassa / sUriyapaNNattI va isibhA siyANaM ca // 83 // "

Page #104
68t.] Begins. fol. ra N namaH wr T Ends.- fol. 13b 1. aayaNapaNAmo bo( vo )cchaM dhammANuogasaMgahiaM / uttarajjhayaNaNuogaM guruvaesAnusAreNaM // 1 / etc. viNayasuaM ca parIsaha / cauraMgijjaM asaMkhayaM cetra / akAmamaraNaM NiaMThijjaM / urabbhaM kAvilijjaM ca / 15 / 4 mipavvajjA dumapattayaM ca / bahusuabu (pu) jjaM taheba hariesaM / cittasaMbhUi usuArijjaM sabhikkhu samAhiThANaM ca / 16 / pAvasamaNijja taha saMjaijja / miacAriA niaMThijjaM / samuddapAliajjaM rahanemiyaM / kesigoabhijjaM ca / 17 / samiIo jannaijjaM sAmAyArI tahA khaluMkijjaM / mokhagai (I) appamAo tava caraNa pamAyaThANaM ca / 18 / kammapagaDI lesA bodha (Da) ve khalu aNagAramagge a / jIvAjIvavihattI / chattIsaM uttarajjhayaNA / 19 / - fol. ra Mulasutras bhapi thUlabhaddo kviM ca kammiUNa puNa chinno aggisihAe tyo cAumA se na puNa daTTo (Do) / 12 etc. bhAvami vibhattI khalu NAyavvA chavvihaMmi bhAvami / ahigAro etthaM puNa vavibhattIe ajjhayaNe / 1 (601 ) / / jIvAjIvavibhattInijjuttI sammattA // 36 // etc. tamhA jiNapannatte aNatagamapajjavehiM saMjutte / ajjhAya jahAjogaM guruppasAyA ahijjijjA // 4 // iti zrIuttarAdhyayanAniryuktiH saMpUrNA // See p. 57. Reference. For a survey of the niryukti see Jail Charpentier's introduction to the Uttaradhyanasutra (p. 48 ) and the following. In connection with this Ms. there it is said on p. 63 by him that "the hand-writing reminds me slightly of that in the Berlin Ms. No. 1341. 67

Page #105
Jaina Literature and Philosophy 1682. uttarAdhyayanasUtra Uttarav nyayaljasutra(adhyayana 3). (Adhyayana III )niyukti miryukti TIkAsahita with tika No. 682 1337. 1891-95. Size.- 104 in. by 4 in. Extent.- 29 - I = 28 folios ; II lines to a page; 3 | 10 40 letters _to a line. Description.-- Country paper thin, rough and greyish; Jaina Deva nagari characters with occasional pRSTamAtrAs; sulliciently big, clear and good hand-witing ; borders ruled in four lines in black ink; red chalk used; fol. 29b blank; a strip of paper pasted to fol. 29b; condition on the whole good; fol. 19th missing ; otherwise completc. Age.- Old Subject.- Ten typical narratives in verses in Sanskrit pointing out the difficulty of attaining birth as a human being. These are based upon the 16th gatha or the 19th of the 3rd adhyayana of Uttaradhyayanasutra. Begins.- ( text ) fol. I e cullaga 1 pAsaga 2 dhanne 3 jue 4 rayaNe ya 5 sumiNa 6 cake ya 7 camma 8 juge 9 parimANa 10 dasa diTuMtA maNuyalaMbhe // 1 // tatra cullagazabdena dezabhASayA bhojanamucyate // tatra dRSTAMte zrIbrahmadattakrikathA / tathAhi / sAketazvAmicaMdrAvataMsasya tanayo vrata / purA' 5 )dAnmunicaMdrAkhyo muneH sAgaracaMdrataH // 1ctc. - com.) fol. 14deg api nAma ma jIyeta kadAcidaparairnaraiH / manuSyakAtparibhraSTo mAnuSyaM labhate nanu // 86 For this verse with variants sec D. C. J. M.; vol. XVII, pt. I, p. 102 (No. 108).

Page #106
682.1 1. 4 Malasatras iti pAzakadRSTAMtaH // cha / adhunA dhAnyadRSTAMta // etc. Bagils -- fol. IFA rAjyaM labheta mAnuSyaM na mAnuSabhavacyutaH // iti tdRssttaaNtH|| cha / atha ratnadRSTAMtaH // etc. ratnAni na punaH prApuH / prApnuvaMtyapi tAnito devatAdiprasAdena mAnuSyaM tu suda(durlabhaM // 7 // atha svapnadRSTAMtaH // etc. , - fol. 25 kadApi prekSate svapnaM so'pi devaniyogataH / na tu jaMturmanuSyatvabhraSTo mAnuSyakaM punaH // 50 iti svapnadRSTAMtaH // ch|| // atha cakradRSTAMta etc. , --- fol. 28b yathA sudurvidhaM cakrASTakaMThava()stu durlabhaM / nRjanmani vya(?)tepyAdyamaparaM tu na labhyate // 180 iti cakradRSTAMta ||ch / / , --- fol. 29 pracaMDavAtavIcibhiH preritA sA kathaM punaH yugena labhate yoga jaMtuna tu janu nRNAM // 3 // cha atha pari(ra)mANa(Nu)dRSTAMtaH / / etc. Ends.- (com.) fol. 29a duSkarmavazato bhraSTastathA mAnuSajanmanaH / nistuSaM mAnuSaM janma janmI na labhate punaH // 5 iti manuSyabhavasya durApatA bahanidarzanadarzanataH kRtaaH| samadhigamya ca samyagidaM budhAH saphalatAkalita kalayaMtu taM // 6 iti manuSyabhavasya dasa(za)dRSTAMtakathAnakaM saMpUrNa samAptaH // cha /

Page #107
20 Jaina Literature and Philosopliy 1683. ziSyahitA Sisyahita (TITETUTTHET ( l'ttaradhyayanasutrabRhavRtti) Drhaulvrtti) No. 683 258. 1883-84. Size.- 11 in. by 42 in. Extent.-- 392 + 3 -- 3 = 392 folios : 15 lines to a page ; 53 letters to a line. Description.---Country paper thin, rough and greyish ; Jaina Deva nagari characters with yeahS; sufficiently big, quite legible and elegant hand-writing ; borders ruled in four lines in black ink; red chalk used; numbers for foll. entered only once, and that, too in the right-hand margin ; foll. 1 to 8 numbered twice in the right-hand margin ; foll. 18, 26 and 29 repeated; foll. 53 to 56 bracketed together ; a piece of paper of the size of a fol. pasted to fol. 18 ; fol. Ia blank; fol. 392 equally so, except that the title 3 TIETT(a)aaaqzia: and its extent written on it; edges of the first and the last foll. slightly worn out; condition on the whole very good; almost half the portion of fol. 1 blank; it appears that the scribe wanted to decorate it with an illestration propably of a Tirthaikara ; complete ; extent 18000 slokas; the entire work is divided into 36 sections. Age.-- Samvat 1667. Author.-- Santi Suti, pupil of Sarvadeva of the Tharapadra gaccha. For his life see Prabhavakacaritra (pp. 216-224) As stated therein (pp. 236-237 )2 he revised Tilakamanjari. Hic attained svarga in Samvat 1096. See C. M. Duff's " The Chronology of India" (p. 120), Westminster, 1899. Subject.- A very big commentary explaining Uttaradhyayanasutra and its niryukti. The nihnava-vada is very beautifully treated here. Its treatment seems to surpass even the ex position given in the Visesavasyaka-bbasya. Prior to the I See the introduction (pp. 79-81 ) of the Gujarati translation of Prablavakacaritra. 2 Sec Prabhavakacaritra (p. ) v. 201-202.

Page #108
683.] 1. 4 Mulasatras composition of this Sisyalita also known as Paiya tika! there was already exegetical literature consisting of curni and several vrttis. The colophon given at the end of Sisyahita is summarized by Charpentier in his introduction (pp. 53-54) to Uttaradhyayanasutra. Begins.-- fol. 1b nmo'hte| zivadAH saMtu tIrthazA vighnasaMghAtaghAtinaH / bhavakUpoddhatau yeSAM vAk vastrAyate nRNAM // 1 etc. adhyayanAnAmeSAM yadapi kRtAzcUrNittayaH kRtimiH| tadapi pravacanabhaktistvarayati mAmatra vRttividhau // 5 // iha khalu sakalakalyANanibaMdhanaM jinAgamamavApya vivekinaivaM vivecanIyaM etc. Ends.-fol. 391deg guruprasAdAditi cAbhidhAnamadhyayanArthinA'vazyaM guravaH prasAdanI yAstadadhInatvAttasyeti khyApanArthamiti gAthArthaH // cha // iti (:) parisamAptI bravImIti pUrvavat / ukto(5)nugamaH saMpati nayAste(s)pi prAgvadeva / / cha / ityu. ttarAdhyayanaTIkAyAM ziSyahitAyAM jIvAjIvavibhaktinAmaka patriMza. madhyayana samAptamiti // cha // etc. Asti vistAravAnunyA guruzAkhAsamanvitaH // AsevyA(nyo) bhavyamArthAnAM zrI kauTika'gaNadrumaH // 1 taduttha vaira 'zAkhAyAmabhUdAyAtizAlinI / vizAlA pratizAkheva zrI caMdra'kulasaMtatiH // 2 // tasyAzcotpadyamAnacchadaniva( ca )yasadRkkavA(? kA )thakarNA(ntrayottha zrI thArApadra'gacchaprasavata:bhoralasaddhamakiMjalkapAnAt / zrIzAMtyAcAryabhaMgo yadidamudagiratsanmadhu zrotrapeyaM tadbho bhavyAstridoSaprazamakaramato gRhyatAM lihyatAM ca // 3 // zrI'bhillamAla'kulazekharazAMtyamAtya nirmApitA (5)nnhilpaattk'caitygehe| bhrAtRvyabhUpakamahattamakAritAru sauvarme(? mIramyakalazAndhayamUrtakItau / / 5 // zrIzAMtisUrirakarod guNasenamUri vAcottarAdhyayanazAsanavRttimenAM / prakhyApitA tadanu tadguNasarvadevaH ....guNagaNakasuziSyavargaH // 6 I See Peterson III, p. 63. 2 See this very page r.and p. 72 (1.7).

Page #109
Jaina Literature and Philosophy siddhAMtasvAdhyAyavyasanatayA ( 7 ) nyAsu vRttiSu satISu / yadviraciteyamaparA tatsadbhirmarSaNIyaM me // 7 yasyAd gururAgame guNanidhiH zrIsarvadevAhvayA sUrIzo ( 5 ) bhayadevasUriracitakhyAta pramANo (S) pitra tasyeyaM sugurudvayAdadhigata ( ? tA ) dalpAtmavidyAguNa pratyAkhyAya ciraM bhuvi pracu (ca ) ratu zrIzAMtisUreH kRtiH // 8 // zrI // etc. saMvata 1667 varSe mahAvadi 14 dine 'tapA' gacchAlaMkAra bhaTTArakapuraMdara'savAIjagadguru' birudadhAraka zrIvijaya sena sUri ( rI ) zvaratAtsa (cchi )dhyamaho pAdhyAya zrInayavijaya gaNitatsi (cchi ) SyapaMDitazrIkIttivijayagaNibhiH zrI'akabarapure' || Reference.-- Published. See No. 644. For description of additional Mss. see Weber II, pp. 126 - 157, 311 - 466 ( Nos. 1907-1910). On p. 440 of R. G. Bhandarkar's " Report on the search for Sanskrit Mss. in the Bombay Presidency during the year 1883-84, Bombay, 1887," an extract of the prasasti is given, whereas on p. 129 its substance is given. See also his Report for 1884-85, p. 277. Consult E. Leumann's "Die alten Berichte von den Schismen der Jaina" (Indische Studien vol. XVII, pp. 44 and 97, Leipzig, 1885. J. Kirste's Hamsakhyayika (W.Z. K. M. vol. XVIII, PP. 130-131 ), Wien, 1904 may be consulted for ascertaining its bearing on this commentary. 72 uttarAdhyayanasUtravRhadvRttigatakathA pratisaMskRta No. 684 (683 Uttaradhyayanasutrabrhadvrttigatakathapratisamskrta Size.- 9 in. by 44 in. Extent.73 folios ; 18 lines to a page ; 57 letters to a line. Description. Country paper somewhat thin and greyish; Jaina Devanagari characters with gas; hand-writing neither too big nor too small, clear, uniform and good; ink faded at times; borders ruled in two lines in red ink; 245. A. 1882-83.

Page #110
73 684.] I. 4*Malasutras red chalk and yellow pigment used; foll. numbered (twice on one and the same side but in different margins; a piece of paper of the same size as the fol. pasted to the first fol. ; same is the case with the last fol.; small bits of paper pasted to fol. 159; the original 19th fol. missing; another in different hand and on a white paper is substituted in its place ; condition good ; complete ; composed in Samvat 1657. Age.- Samvat 1799. Author.-- Padmasagara Gani, pupil of Vimalasagara Gani. Subject.- Sanskrit rendering of the narratives given in Prakrit in Sisyahita, the behadvitti on Uttaradhyayanasutra. Thus this work simply deals with stories required to illustrate some of the gathas of the different adhyayanas. After the 25th adhyayana, there is nothing which requires illu strations by way of narratives. Begins.- fol. I zrIjinAya namaH // praNamya zrImahAvIraM namrAkhaMDalamaMDalaM bhArabhyate ta(ka)thA() karttamuttarAdhyayanasthitAH 1 uttarAdhyayanabRhadvRttigatA kathAH saMskRtA(:) kartumArabhyaMte ANA'nihesakare 3 gAthAyAM kUlavAlakakathA 1 yathA ekasya AcAryasya kSullako'vinItaH etc. Ends.-- fol. 73deg iti ciMtayanneva pratibuddhaH 'gaMgA'muttIrya sAdhusamIpe pravrajitaH agragaH saMbaMdhaH mUtra eva prokto( 5)stIti paMcaviMzAdhyayane kathA samAptA // etAvatA uttarAdhyayanabRhadvRttigatAH prAkRtakathA(:) sarvA (bhopi saMskRtA(:) kRtA'stapAgacche bhaTTArakacakravartI(ti)zrIvijayasenamArarAjye saMvat 1657 varSe 'pIpADapure' paMDitaprakAMDazrIvimalasAgaragaNiziSyapaNDitapadmasAgaragaNinA prabarapremasAgaravAkyena kathA (:) kRtAH paNDitapadmasAgaraiH svaziSyavAkyapraNayena saMskRtAra 'pIpADi puryA jinapArzvanAyaka prasAdataH satkusa(za)lAya saMtvimAH 1 zodhayaMtu sajjanA svarUpastu sajjanebhyo yeSAM hRdayAni darpaNAnibhAni durvacanabhasmasaMgAda dhikataraM nirmalAni syuH // 2 //

Page #111
74 Jaina Literature and Philosophy graMthAgraMtha 4500 likhitaM zrI' meDatA' nagare // saMvat afe aisi tithau / zubhaM bhUyAt / zrIrastu . This is line as under in a different hand : gumanAbAI belasakaramedInI che parata uttarAdhenahI. Reference. - See pp. 240-241 of Rajendralala Mitra's "Notices of Sanskrit Mss. published under orders of the Government of Bengal" vol. VIII, Calcutta, 1885. Here 25 legends are given. For an additional Ms. see Limbdi Catalogue No. 28. For a narrative of Harikesi-bala in Gujarati and some verses connected with the life of Jayaghosa and Vijayaghosa see "Prasthana" Vol. XV, No. 2, pp. 121-123. uttarAdhyayana sUtra bRhadvRttiparyAya No. 685 Extent. fol. 28a to fol. 30a. Description. Complete. For other details paryaya No. 736 (1). 1875-76. [684. 1799 varSe caitrafollowed by a Uttaradhyayanasutrabrhadvrttiparyaya 736 (23). 1875-76. Author.--- Not mentioned. Subject.-- Explanation in Sanskrit regarding some difficult words etc. occurring in the brhadvrtti of Uttaradhyayanasutra. Begins. fol. 282 namo'rhate see Pancavastuka UrdhvarathikA iti makAna miti jinAgamanidhiM tadavAptAviti / etc. Ends.-- fol. 30 avyavahArikA nityaM nityaM nigodA eva / udAharaNamiti dvadriyAdInAM / uttarAdhyayanabRhadvRttiparyAyAH samAptAH /

Page #112
687.] uttarAdhyayanasUtrabRhadvRttiparyAya No. 686 uttarAdhyayanasUtrabRhadvRttiparyAya No. 687 I. 4 Mulasutras Exrent.- fol. 45 to fol. 49a. Description. Complete. For other details see Pancavastuka paryaya No. 789 (1). 1895-1902. Begins. fol. 45 namo (S) rhate // UrdhvarathikA iti etc., as in No. 685. Ends. -- fol. 492 avyavahArikA etc., as in No. 685. N. B.-- For other details see No. 685. - Uttaradhyayanasutrabrhadvrttiparyaya Ends. fol. 33 avyavahArikA nityaM etc. N. B.--- For other details see No. 685. 789 (23). 1895-1902. Extent.--" fol. 294 to fol. 342. Description. Complete. For other details see Nandisutravisamapadaparyaya No. 623. Begins. fol. 294 yAvattrailokyazAlaH kamaThapativapurmUlajAlapratiSThA 75 Uttaradhyayanasutrabrhadvrttiparyaya nAgeMdra khaMdhabaMdhastridazapatinadI pallava 'caMdra' gacchaH / AzAkhAprazAkhAzivasadanazilAsatphalodhilpapuSpau 332 (6). A. 1882-83. bhAtAmeSo (S)pi tAvaddalitakAlamalaH pustaka ( : ) paThyamAnaH // cha // namo arhate / udhvaraghekA iti etc., as in No. 685.

Page #113
76 uttarAdhyayana sUtrAvacUrNi No. 688 Jaina Literature and Philosophy Begins. - fol. 14 namaH zrIpravacanAya // Size.- ro++ in. by 4g in Extent.-- 45 folios; 23 lines to a page ; 8 letters to a line. Description. Country paper thin and greyish; Jaina Devanagari characters with as; very small, quite legible and good hand-writing; borders ruled in four lines in black ink ; red chalk and yellow pigment used; diagrams about yugmapradezaprataravRtta etc. given on fol. 24; condition very good ; complete; extent 5250 slokas; composed in Samvat 1441, Age.-- Fairly old. - Uttaradhyayanasutravacurni Author.- Jnanasagara, pupil of Devasundara of the Tapa gaccha. Subject. A small commentary in Sanskrit elucidating Uttaradhyayanasutra and its niryukti as well. This is based upon the brhadvrtti of Santi Suri. [688. 284. A. 1883-84. kaya0 // eSA pUrvAcAryagAthA // prakRto ( 5 )yamuttarAdhyayanAnuyogo'sya ca nAmanikSepe uttarAdhyayanazrutaskaMdha iti nAma etc. Ends. fol. 45 anaMtAzva te gamAzvA'rthaparicchittiprakArAH paryavAzrva zabdaparyavA arthaparyavarUpAstaiH saMyuktAna adhyAyAn prakramAduttarAdhyAyAna yoga upadhAnAdi ru(ra) citavyApArastadanatikrameNe (Na) yathAyogaM // / 12 jIva / jiivaavbhktiH|| ch| iti zrIuttarAdhyayana avacUriH samAptA // cha // zubhaM bhavatu // cha // zrImat 'tapA' gaNana bhogaNabhAskarAt zrI (? madra) deva suMdarayugottamapAdukAnAM / ziSyairjinAgamasudhAMbudhilInacittaiH zrIjJAnasAgaragurUttamanAmadheyaiH // 1 bhUvArdhamanu 1449 mite'bde kRtottarAdhyayanagA ( s) bacUrNiriyaM / zrIzAMtyAcAryabhuvastadvivRteH svaparahitakRtAya // 2 // graMthAgraM 5250 anumitAH // cha // etc. I It is probably on this basis that Charpentier styled this commentary as ava curi in his introduction (p. 64 ) tg Uttaradhyayanasutra.

Page #114
690.] uttarAdhyayana sUtrAvacUri No. 689 I. 4 Mulasatras Uttaradhyayanasutravacuri 77 Size.-- 10++ in. by 4g in. Extent.-- 21 - 1 = 20 folios; 19 lines to a page; 78 letters to a line. 165. 1871-72. Description. Country paper thin and white; Jaina Devanagari characters with pRSThamAtrAs very small, legible, uniform and elegant hand-writing; borders ruled in four lines in black ink; red chalk used; this Ms. contains the gates of the text ; foll. numbered in the right-hand margin only; the 20th fol. missing ; otherwise complete ; condition very good. Age.-- Pretty old. Author. -- Not mentioned. Subject. A small commentary in Sanskrit explaining Uttaradhyayanasutra. This is based upon the brhadvrtti. Begins. fol. 14 zrIjinAgamAya namaH // zrIvarddhamAnamAnamya bRhadvRttyanusArataH / zrI uttarAdhyayanAnAmavacUriM likhAmyahaM // 1 // saMjogA0 // saMyogAnmAtrAdiviSayAd bAhyAt kaSAyAdiviSayAdabhyaMtarAcca etc. Ends. fol. 21 adhyAyAn prakramAduttarAdhyAyAna / yoga upadhAnAdiru (ra) citavyApArastadanatikrameNa yathAyogaM guru 0 // tazcittaprasannatArUpAddhetoradhIyeta na tu pramAdaM kuryAditi bhAvaH // 3 // cha etc. uttarAdhyayana sUtrAvacUri No. 690 Size.-- 10++ in. by 4g in. Extent. 36 folios'; 11 lines to a page ; 8o letters to a line. Uttaradhyayanasutravacuri 579. 1884-86.

Page #115
78 Jaina Literature and Philosophy (690. Description.-- Country paper thin and greyish ; Jaina Devanagari characters with geass; exceedingly small, legible, uniform and good hand-writing: borders ruled in three lines in red ink; red chalk used; this Ms. contains only the gales of the text; foll. numbered in the right-hand margin only; a few foll. slightly worm-eaten ; condition tolerably good; complete. Age.- Samvat 15102 (? 1512). Author.-- Not mentioned. Subject.--- A small Sanskrit commentary on Urtaradhyayanasutra, Begins. -- fol. 14 TIAYTTAR: saMyogAnmAtrAdi kaSAyAdi bAhyAbhyaMtarabhedAt vividhaiH prakArAnabhAvanA FAT TICA FOTETETT etc. Ends.-- fol. 366 SETITIA TEATEATTETTE ho gquangrie ITOTT: tadanatikrameNa yathAyogaM / cha / SaTtriMzadapyuttarAdhyayanAni kiMcid Pargana il 7 ll etc. ugaria li ll etc. ___ saMvat 15102(?) varSe jyeSTavahi 12 bhaume likhitaM // cha // zrIsarvaTTY #: 11 Ultr: 11 etc. uttarAdhyayanasUtrAvacUri Uttaradhyayanasutravacuri No. 691 1158. 1887-91. Size.- 101 in. by 48 in. Extent.-- 23 folios; 23 lines to a page ; 96 letters to a line. Description. - Country paper very thin and white; Jaina Deva nagari characters; very small, quite legible and fair handwriting; borders ruled in three lines in black ink; red chalk used; numbers for foll. entered in the right-hand margin only; this Ms. contains the gares of the text; complete; edges of some of the foll. slightly worn out; condition on the whole very good.

Page #116
692.] Age.- Fairly old. Author. Not mentioned. I. 4 Malasutras Subject. A small commentary in Sanskrit to Uttaradhyayanasutra. Begins. - fol. 14 zrIjinAgamAya namaH // citrasambhUtIyAdhyayana (cittasaMbhU ijjajjhayaNa ) - vyAkhyA saMjogA * saMyogAnmAtrAdi kaSAyAdi bAhyAbhyaMtarabhedAt vividhaiH etc. Ends. fol. 23 ii0 ityetAn sUtratvAtprAduHkRtya kAMzvidarthataH kAMzvitsUtrato(s) pi / buddhaH kevalI jJAtakaH zrIvIraH / uttarAH pradhAnA adhyAyA adhyayanAni bhavasiddhikAnAM samatA abhipretAstAna || 267 jIvAjIvAvabhaktiH // 36 // cha // 79 Age. Pretty old. Author. Citrasambutiyadhyayana (Cittasambuijjajjhayana ) vyakhya No. 692 Size. 10 in. by 41 in. Extent. 16 folios; 12 lines to a page; 43 letters to a line. Description. Country paper tough and white; Jaina Devanagari characters with gears; big, legible and good hand-writing, borders ruled in three lines in black ink; yellow pigment used; numbers for foll. entered only once, and that, too, the right-hand margin as usual; some of the foll. slightly worm-eaten; condition good; complete so far as it goes; the entire work is mostly in Prakrit. in 162. 1871-72. Not mentioned. He does not seem to be Santi Suri; for, the opening lines etc. do not tally with Sisyahita. Subject. A narrative of Citra and Sambhuta. For a reference see P. 7.

Page #117
80 Begins. -- fol. 1 OM namaH / Jaina Literature and Philosophy vyAkhyAtaM dvAdazamadhyayanaM adhunA trayodazamArabhyate / te'sya cAyamabhisaMbhaMdha ihAnaMttarAdhyayane tapasi yatno vidheya ityuvyA ( cya ) te tacca kurvatA nidAnaM parihartavyaM // iti darzayituM yathA tanmahApApahetustathA citrasaMbhUtodAharaNena nirdizyate etc. Ends. - fol. 16b citrasaMbhUtavaktavyatA tAvaducyate / sA ceyaM 'sAgee' nagare caMDavahiMsasaraNo patto muNivaM (caM ) dA nAma Asi so ya nivviNakAmabhogo sAgaracaMdassa aMtie pavvati etc. Reference. eyassa silogassa pacchimaddhaM pUrei tassa rAyA niyayarajja saaddhaM deatti / evaM ca patidiNaM payattamA ghosaNaM laMbiu bahusu paesesu pAu / atrAvapUrvavizvitrAbhidhAnastatsahodarajIva: 'purimatAla'na / samAptaH zrIrastu // lakSitaM Thakara balarAjasatasaSIdAsaH // zubhaM bhavatu // [ 692. This Ms. is referred to by Jarl Charpentier in his introduction (p. 64 ) to Uttaradhyayanasutra. uttarAdhyayana sUtrakathA No. 693 Size.-- rog in. by 44 in. Extent. - 20 folios; 17 lines to a page; 60 letters to a line. Description.-- Country paper rough and greyish ; Jaina Devanagari characters with very rare ears; small, legible and very fair hand-writing; borders ruled in four lines in black ink ; red chalk used; numbers for foll. entered only once; edges of some of the foll. slightly worm-eaten ; condition good; complete so far as it goes. Uttaradhyayanasutrakatha Age. -- Sarvat 1520. Author - A Jaina sadhu, a devotee of Munisundara Sari. 1295. 1887-91.

Page #118
694.] I. 4 Malashtras Subject.-Narratives in Sanskrit pertaining to laghuvrtti of Uttara dhyayanasutra. Begins. --- fol. 1 ahe // etc. arha ( hai )taH sarvasiddhAzvA (cA) ryopAdhyAya sAdhavaH / bhavaradA ma ( zru tAraMbhasiddhaye || zrIuttarAdhyayanAnAM laghuvRttigayA (tA.) svayaM prAyaH kaizvinna budhyate yAH kAzcitprAkRtAH kathAH // 2 // munisuMdarasUrIMdrAna sarvAgamavido gurUn / pRSTvA pRSTvA svabodhAya likhyate saMskRtena tAH // 3 // prathamaM vinayAdhyayane / ANAnidesakare atra kUlavAlakathA || tadAha Ends--- fol. 200 viviktacaryA dhRtimatAH kartuM zakyAta utpannavizrotakenApi raghA - ( ? )namiva cacaraNe dhRtiH kAryA // 22 // zubhaM bhavatu lekhakapAThakayoH // cha / saMvat 1520 varSe bhAdrapadasudi 12 dine guruvAre zrI maMDapadurge zrI'tapA' gacche paM0 jJAnaharSagaNinA likhApitaM // cha // zrIH // This is follow ed by the following lines in a bigger hand-writing : saMvat 1520 zrAvaNa zudi 3 dine 'tapAgacchanAyaka zrIlakSmI sAgarasUriziSya paM jJAna harSagaNInAM sA sA0 sonAbhA sUDIpramukha kuTuMbayutena zrIsiddhAMtArAdhanAya nijanya yopArjitavittavyayena zrIuttarAdhyayanakathA likhApitA // cha // zrIH // uttarAdhyayana sUtrakathA No. 694 Size.-- rog in. by 44 81 in. 7 Uttaradhyayanasutrakatha Extent.-- 37 - 2 = 35 folios; 14 lines to a page ; 48 letters to a line. 1319. 1891-95. I Perhaps this is Nemicandra Suri's composition. 2 This word " arham " forms the very first sutra of Siddhahaima. It is defined as under : " 'arhama ' iti sAnunAsikaM mArtaM vA'vyayaM sakalAgamarahasyabhUtaM yogijanAGgIkRtaM mahAprabhAvaka mantrAkSaramiti / "

Page #119
82 Jaina Lilerature and Philosophy [694. Description. - Country paper thin and greyish ; Jaina Devanagari characters : big, legible, uniform and good hand-writing; borders ruled in four lines in black ink ; red chalk and yellow pigment used ; foll. numbered in the right-hand margin only; a piece of paper of the size of a fol. pasted to tol. 1'; same is the case with fol. 37"; foll. 1 and 37" blank; corners of some of the roll. torn; a strip of paper pasted to fol. 15"; condition on the whole very lair ; loll. 29 and 34 missing ; otherwise complete. Age.-- Samvat 1552. Author.-- Not mentioned. Subject.-- Narratives in Sanskrit pertaining to the laghuvrtti of Uttaradhyayanasutra. Begins.- fol. 19 namo vItarAgAya namaH // zrIuttarAdhyayanaladhuvRtti etc.. up to siddhaye as in No. 695. This is followed by prathame vinayAdhyayane ANAnidesA'kAragurUNama aNuvadeg 'tra kUlavAlakakathA yathA ekasya bhUreH etc. Ends.- fol. 37deg zrIdharmaprati pratikrameNa sukha kha( rA? )jyaM ca prApta / puNyAkarasya sarvatrAjJA jAtA bahuni puNyakarttavyAni kRtAni // cha // zrIuttarAdhyayanAkSarazravaNamahimAkathane puNyAkarakathAnakaM zrIuttarAdhyayanaprAraMbhanakasamarthanaM / / cha / devAdhidevazrI autsukyAviparItArthakathanyA( ? )tpadavismRteH yatpApaM me( 5 stu tanmithyA zrutokto saMghasAkSikaM / 4 (1) / bahvarthamatiga(? gaMbhIra samIra pApapAdape / jinoktaM sUkSmadhIgamyamuttarAdhyayanazrutaM // vAcita puNyalAbhAya duSTakarmakSayAya ca / bodhAya budhaye duHkhapraNAzAya jayAya ca // 2 zrImadguro( : ) prasAdAt zrIsaMghasAMnidhyatastathA / bAlo( 5 )pi bijJamAnyaH syAnayA(?)va vAcayati zrutaM // cha // etc. saMvat 1552 varSe mahopAdhyAya'......zrIlabadhi(bdhi)samudragaNizikSapUjyapa saMva( ve ge(gi)hamagaNinA laSArpitA / leSaka etc. Letters are illegible; for, yellow pigment is applied here. I

Page #120
695.] I.4Malasutras uttarAdhyayanasUtrakathAsakSepa Uttaradhyayanasutrakathasarksepa 163. 1871-72. No. 695 Size.--- 104 in. by 41 in. Extent.--- 29 folios ; 14 lines to a page; 48 letters to a line. Description.-- Country paper thin and white ; Jaina Devanagari characters; small, legible and good hand-writing ; borders ruled in four lines in black ink; red chalk used; for ia blank ; almost all the foll. slightly worm-eaten ; condition very fair ; complete; composed not earlier than the date of Hemacandra Suri; for, his work viSaSTizalAkApuruSacaritra is quoted on fol. 200. Age.- Not modern. Author.--- Not mentioned. Subject.-- Narratives illustrating some of the gathas of Uttara dhyayanasutra, the Ist story being that of Kulavalaka. Begins.--- fol. I" zrIuttarAdhyayanalaghuvRttikathA likhyate / arhataH sarvasiddhAzvAcAyA( yo )pAdhyAyasAdhavaH bhavaMtu varadA mahyaM suzrutAraMbhasiddhaye / agappabhavA jiNabhAsiyA ya pttybuddhsNvaayaa| baMdhe mukve ya kayA chattIsa uttarajjhayaNA // 2 // aMgaprabhavaM yathA / parISahAdhyayanaM vakSyati hi kammapavAyapubve sattarasa pAhuDaMmi jaM sutaM ta iha modAharaNaM baddhaM tu parIsahajjhayaNe // 3 // cc. --- fol. 298 seMdhumauvAra dezezazrIudAyanarAjarSikathA triSaSTIyazrIvIra caritA(t ) jJeyA etc. LEnds..-- fol. 29" jayaghoSavijayaghoSau yamalabhrAtarau / jayaghoSaH snAtuM gaMgAM gataH / pecchai mappeNa maMDukko gamijai sma(sa)ppA vi majA( jjA )reNa'kato / tahAvi ma( ma )ppo maTukka ciniyaMta myAi / majjAge vi sappa taDaphaData khAi taM aNNamaNaNadhAyaM pAminA aho mamArasma asArayA jo jassa pabhavai so tamintha

Page #121
XA Jaina Literature and Philosophy [695. gasai ! kayaMto puNa savvassa pabhavai ti savvaM gasai / to dhammo cevettha sANaM viciMtiya 'gaMga muttariya mA( sAhupAse pabbaiu ti // zeSa sUtre / / iti zrIzrIuttarAdhyayanakathAsaMkSepaH samAptAmati [:] etc. uttarAdhyayanasUtra UttaradhyayanasutrakathAsakSepa kathasamksepa 1321. No. 696 1891-95. Size.-- 104 in. by 42 in. Fxtent.-- 54 folios; II lines to a page ; 40 letters to a line. Description.- Country paper thin and greyish ; Jaina Devanagari characters with occasional Alats; big, legible, uniform and good hand-writing; borders ruled in two pairs of lines in black ink; the space between these pairs coloured red; foll. numbered in the right-hand margin only; unnumbered sides have a smail disc in red colour, in the centre; the numbered, in each of the two margins, too; fol. ra blank; fol. 546 is practically so; for, the title viz. JATTETTHEAT etc. written on it; red chalk used; yellow pigment, too; complete ; condition very good. Age.--- Pretty old. Begins.-- fol. 1 STEJTaggar etc., as in No. 695. Ends.- fol. 536 Tata TETET TAHTAR etc., practically up to. the end as in No. 695. N. B.- For further particulars see No. 695.

Page #122
673.] 1. 4 Malasutras uttarAdhyayanasUtra ( adhyayana 1-9) kathAsahita Uttaradhyayanasutra ( Adhyayanas I-IX) with kathas No. 697 1324. 1887-91. Size.- 104 in. by 43 in. Extent.--77- I = 76 folios ; 16 lines to a page ; 42 letters to a line. Description.- Country paper rough and white ; Jaina Devanagari characters; small, clear and good hand-writing ; borders ruled in two lines and edges in one, in red ink ; red chalk used; the ist fol. lacking ; this Ms. contains some portion of the text (chapters I-IX) as well as its commentary most ly in Sanskrit ; condition very good. Age.--- Old. Author of the kathas etc... . Not mentioned. Subject.-- This Ms. starts with the katha of Kulavalaka and ends with those of the 4 Pratyekabuddhas (kingly saints). At times there is given a portion in Gujarati. Begins.--- ( text ) fol. 20 jahA suNI paikaNNI nikAsijai sabbaso / evaM dussIlapaDiNIe muharI nikasijjar3a // 4 // - ( com. ) fol. 2* zApo'smai kSulakAya dattaH he durAtman tvaM strIto vini(na kSyasi atha sa kSullako AcAryo(5)yaM mithyAvAdI bhavatu iti vicitya pRthabhUtatApasAzrame gatvA tiSThati / etc. - fol. 21 samaNe jaha kUlavAlae mAgahiaM gaNiaM rAmassae / gayAya alogacadae 'vaive)sAliM' nagari gAhasmae // 1 // etc. -(com.) fol. 77 evaM catvAro'pi paraspara saMbaddhAH satyavAdinaH sarvathA saMyama mArAdhakA kevalajJAnamAmAdya ziva jagmuH / iti pratyekabuddhacatuSTayakathAH samAptAH / navamAdhyayanakathA samAptA / atha navamAdhyayanasUtra praarmH|

Page #123
86 Jaina Literature and Philosophy [ 697. Ends.--- (text ) fol. 770 caiUNa devalogAo uvavaNo mANusamI loga('ga mi / upasaMtamohaNijjo sarati ya porANiyaM jAti / 1 // ' ,, - ( com. ) fol. 77deg namirAjA devalokAt cyutvA manuSyaloke utpannaH paurA NikIyAM jAti(tiM ) smarati nami rAjA devalokathI cavI manuSyalokiM utpanna bhaNIyai U gno paurANikIyAM jAti bhaNai gata janmAMtara jAti smarai kiMviziSTo namirAjA upazAMtamohanIyaH pratyekabuddhacatuSTaya l'ratyekabudalacatustaya caritra caritra 293 No.698 A. 1883-84. Size.---9 in. by 4: in. Extent.-- 18 folios; 15 lines to a page ; 33 letters to a line. Description.- Country paper thin and white; Jaina Devanagari characters with occasional pRSThamAtrAs; big. legible but poor hand-writing ; borders ruled in red ink; foll. numbered as usual ; foll. I. and 18b blank ; every sidc is decorated with three small discs in red colour, one in the centre and two in the margins ; complete ; yellow pigment used ; con dition good. Age. -- Fairly old. Author.-- Not mentioned. Subject.-- Narratives about 4 Pratvekabuddhas. For comparison ctc. sec Charpentier's introduction (p. 44) to Uttaradhyayana sutra. Begins.--- fol. rb uktamaSTamamadhyayana sAMprati namivaktavyatAbaddha namitrajyAkhyaM navamamArabhya vA(cA)yamabhisaMbAMdhAnaMtarAdhyayane nitve(?)bhitvamuktAmaha tu tadanuSThita ihaiva deveMdrAdi prajAyata iti dazyate ctc. This is the first verse of the niuth chapter kuown as Namipravrajya ). amipavvajja

Page #124
.87 699. 1. 4. Mulasutras Ends. fol. 18* imAmanuzAsti kara kaMDukRtAM pratipannAH kAlena ca catvAro'pi mokSaM gatA iti / saMprati sUtramanuzriyate / -(text) fol. 18a Reference. See " Sulla leggenda dic quattro Pratyekabuddha" by P. E. Pavolini published in "Actes du XII congre's international des Orientalistes", vol. I, pp. 129-137, Firenze, 1901. caiUNa devalogA ubavaNo mANusaMmi logaMmi / vasaMtamohaNijjo sarai porANeyaM jAyaiM No. 699 cyutvo ( ? )de iti pratyeka buddhacatuSTayaM // samAptaM // cha // etc. pratyeka buddha catuSTaya caritra Pratyekabuddhacatustaya caritra Size.- -9 in. by 41 in. Extent. 231 22 folios; II lines to a page; 31 letters to a line. 296. A. 1882-83. Description. Country paper rough and white; Jaina Devanagari characters; bold, big, legible and fair hand-writing; borders ruled indifferently; yellow pigment used; foll. numbered in the right-hand margin; the 1st fol. lacking; practically incomplete; fol. 5a blank; but the matter is continuous; condition good. Agc. Not modern. Author.--Not mentioned. Subject. This Ms. starts with Karakandukatha which ends on fol. 4".

Page #125
Jaina Literature and Philosophy [ 700. Begins.- ( abruptly ) tol. 21 yA dRddhN| rAjJA gRhItA dakSeNa tasthau rAjJI tathaiva hi // 7 // kiMkartavyatayA mUDhaH sazojhoDagA gRhaM nRpaH / / nirmAmu(nu)SAM(pA)TavIM nItA tenebhena nRpapriyA // 8 // etc. 'paMcAla desaahiyo puyamayupa ca iMdaM keussa / / daTuM virattakAmo pabvaio domuhanariMdo // 66 // Ends..--- (text) fol. 23b puSpa(ppha)ttarAu cavaNaM pavvajjA tahaya tesi samakAlaM / patteyabuddhakebali siddhigayA egasamaya(yeNaM / 62 / ,, -- (com.)-- fol. 40 etayorgAthayorakSarArtha ukta( :) kathAnakAMzAdevAvaseyaH navara akariMsumi tti akArSuH / tathA pravrajyA teSAM samakAlaM yugapadeva pratyekabuddhatvaM ca gatA prAptA ekena samayena paramanikRSTakAleneti gAthArthaH / iti zrInigattityaM( ? ) catuHpratyekabuddhacaritraM / yAdRzaM etc. paMDitazrIsaMjamavizAlapaTha( nArthe ) / Reference. -See No. 698. manuSyabhavadurlabhatA. ManusyabhavadurlabhatasUcakadazadRSTAnta sucakadasadrstanta 794. No. 700 1895-1902. Size.-- 102 in. by 4 in. Extent.-- 13 folios ; 19 lines to a page ; 56 letters to a line. Description.--- Country paper thin and grey; Jaina Devanagari characters with occasional pRSThamAtrAs; small, clear and fair hand-writing ; borders ruled in four lines in black ink; red chalk used ; foll. numberd in the right-hand margin ; a corner of almost each of the foll. slightly worn out ; this seems to be a part of some other Ms. as its first fol. is numbered as 13 ; complete ; condition tolerably good.

Page #126
701.] Age.- Sarvat for. Author - Not mentioned. Subject. Ten typical illustrations' narrated in Sanskrit pointing out the difficulty of attaining birth as a human being. Begins. fol. 14 || || OM zrIsarvajJAya namaH | saMsAre catasRSu gatiSu mAnavagatireva zlAghyA / yataH / I. 4 Malasatras suranArayANa dunna vitiriyANa gaI ya huti cattAri / maNuyANaM paMca tathA teNaM ciya uttamA maNuyA // 1 // etc. Ends. fol. 25 atha pari (ra) mANudRSTAMto yathA / tathAhi kazcittridaza ArAzanaSaNmayaM staMbhamutpATya sUrya (?) dRSTinikSepanibhaM cUrNa kRtavAn / taccUrNa samAdAya 'meru parvataM gatvA etc. puna: pari (ra) mANumelanAta staMbhapunarnavIkaraNAya ciMtitaM / melayati paramANUna yAvattAvanna milati te / vAtAhatAste paramANavo girinadI samudreSu nipAtitAH / sa devo'pi na puna staMbhaM cakAra / tathA mAnavaM janma nirarthakaM gataM punaH prAptuM na zakyate jIvena / iti paramANudRSTAMto dazamaH / 90 // cha // etc. saMag ( tU ) 1501 zAkye 1366 samaya pravartamAne vaizASazudi 15 tithau sa ( za ) nivAsare liSitA daza diSTAMta zrI' yoginIpure' 'DhilikA'yAM / zrImahaMmadasAhirAjye | li0 meghacaMda kAhastha kaulasIsutaH / zubhaM etc. manuSya bhavadurlabhatA sUcakadazadRSTAnta No. 701 Size.- ro++ in. by 44 in. Manusyabhavadurlabhatasucakadasadrstanta Extent. - 19 folios; 15 lines to a page; 53 letters to a line. Description.-- Country paper very thin and white; Jaina Devanagari characters; small, legible and good hand-writing ; borders ruled in two pairs of lines in black ink; the space 1307. 1887-91. 1 For a brief exposition of these narratives see my explanatory notes (pp. 12-15 ) on Vairagyarasamanjari. 12 IJ. L. P. I

Page #127
90 Jaina Literature and Philosophy [ 701, between these pairs coloured red; red chalk and yellow pigment used; unnumbered sides decorated with a small disc in red colour in the centre only, whereas the numbered, in each of the two margins, too; the 19th fol. partly torn; edges of several foll. partially worn out; condition very fair ; complete. Age.-- Samvat 1558. Begins.-- fol. 14 FF maag stay etc., as in No. 700. Ends.-- fol. 1953727 FC TATUTETIHI Tor etc., practically as in No. 700 up to gia TANECIAFOTA: 801. This is followed by the lines as under : Haa 2446 spalisada (a) CHATIH goE ETUTang iyi qura I etc. N. B.- For further particulars see No. 700.

Page #128
702.) II. 4 Malasutras 91 THE SECOND MULASUTRA dazavaikAlikasUtra (feaufuga) (3274a 8-8) Dasavaikalikasutra (Dasaveyaliyasutta ) ( Adhyayanas I-IV) No. 702 723. 1899-1915. Size.- 9 in. by 48 in. Extent.- 7 folios; 11 lines to a page ; 28 letters to a line. Description.--- Country paper thin, rough and whitish ; Jaina Deva nagari characters with frequent qualiTS; big, quite clear, uniform and good hand-writing; borders ruled in two lines in red ink ; the space between these pairs coloured yellowish; black ink and red ink as well used for writing the text; foll. numbered in the right-hand margin only; fol. 70 blank; yellow pigment rarely used; complete so far as the first four adhyayanas are concerned; condition very good. Age.-- Old. Author.-- Sejjambhava ( Sayyambhava ) Suri. For details see No. 704. Subject.-- This forms a part of the second mulasutra which con tains 10 adhyayanas. For detailed information sec No. 704. Begins.- fol. 18 sf F*T FA: 11 Areglag etc. as in No. 704. Ends.-- fol. 7a icceyaM chajjIvaNiya / sammaTTiI sayA jae / dulahaM lahiu sAmannaM / kammaNA na virAhijjAsi tti bemi // 29 chajjIvaNiyA nAma cautthamajjhayaNa mamataM likhita(ta) harSacane (m) TFT Sari

Page #129
92 Jaina Literature and Philosophy [703. Reference.--- Published. See No. 704. For additional Mss. having only four adhyayanas of this text see Limbdi Catalogue Nos. II SI and II52. The latter contains tabba, too. Gujarati anuvadana is published by Mahavirasahityaprakasanamandira, Sabarmati, Gujarat in A. D. 1935. - dazavakAlikasUtra (adhyayana 1) Dasavaikalikasutra ( Adhyayana I) No. 703 1372(b). 1891-95. Extent.--- fol. 7a to fol. 7b. Description. Only the five gathas of the first chapter of Dasa vaikalikasutra are given here. For other details see Tirtha mala No. _1372 (a). * 1891-95. . Age.--Samvat 1717. Begins.- fol. 7deg dhammo maMgalamukkaTeM etc. Ends.--- fol. 70 vI(va)yaM ca vittaM labhA( bbhA )mo| na ya koi sa(?u)vahama(mma)I ahAgaDesa rIyaMte puSke(pphe )se bhamarA jahA // 4 // mahukArasamA buddhA je bhavaMti aNusayA // nANApaMDarayA daMtA teNa vuccati sAhUNo tti bemi // 5 // ___ iti zrIpuSkI(SpI)yAadhyayana saMpUrNaH // saMvat 1717 varSe kAtImAse zuklapakSe dazamIdine zukla(ka)vAre likhitaM muzrIvairAgyasAgareNa // zrI 'akabarAvAda'vAstavya // sAhapannajIbhAryAzrAvikAjeTUpaunArtha // Reference.--- For Mss. having only one adhyayana sec Limbdi Cata logue No. 1156. No. I IS5 of this Catalogue refers to a Ms. having the first 17 gathas. For additional particulars see No. 704.

Page #130
704. II. 4 Malasutras 93 The gagsate is mentioned in the svopajna laghuvstti (p. 25 ) of Siddhahaima ( V-2-25 ) as under : dhArayan AcArAGgam, adhIyan dumapuSpIyam / " N. B.-- For author' and 'subject ' see Nos. 702 and 704. dazavaikAlikasUtra tathA cUlikAyugala (ground) Dasavaikalikasutra and Calikyaugala (Culiyajuyala ) 36 No. 704 1869-70. Size.-- 104 in. by 44 in. Extent. -- 19 folios; 15 lines to a page ; 44 letters to a line. Description.--Country paper thick, durable and greyish; Jaina Deva nagari characters ; clear, uniform and good hand-writing ; borders ruled in three lines in red ink, whereas edges, in two; fol. 1a blank; numbers for gathas etc., written in red ink; yellow pigment used; numbers for foll. circumscribed by different figures; complete ; ink faded ; condition very good. Age.-- Samvat 1785, Saka 1650. Author of the text ( Dasvaikalikasutra ).-Sayyambhava Suri, father of Maraga (Manaka) for whom he composed this work. He is praised by Muniratna Suri in his Amamasvamicaritra as under: "zayyambhavo'stu vo bhUtyai cakre sarvAGgabhUtibhUt / yenAduHprasabhAcAryakAlikaM dazakAlikam // 14 // " For other details see Indian Antiquary vol. XI, p. 246 and Peterson Reports IV, p. CXVIII, and V, pp. 4, 121 and 130.

Page #131
94 Jaina Literature and Philosophy ( 704. Author of the two Culikas.- Simandharasvamin according to the Jaina tradition. See p. 96 as well as Haribhadra Suri's com mentary (p. 279 ) on Dasavaikalikasutra. Subject.-- The text which is styled as Dasakaliya and Dasaveya liya' as well, has ten chapters. Their significant titles are as under: ( 1 ) gar, ( 2 ) APSF, ( 3 ) HitEur, ( 4 ) Testaat, (5) QuS GOTT, ( 6 ) HERREUT, ( 7 ) TIPE, ( 8 ) Barefont, ( 9 ATHAT and ( 10 ) min. Eulogy of dharma, firm faith in it, the code of discipline, ahimsa, rules and regulations pertaining to bhiksa, rules of conduct in details, purity of speech, advertedness, discipline and the qualities of a good saint respectively form the main topics of these. chapters. For a summary of the contents of these ten chapters in Sanskrit see Keith's Catalogue No. 7503 which deals with a Ms. styled as" apartea tu faos:". In a Gujarati article published in - Jaina prakasa" (vol. XXII, No. 14, dated 17-2-35), we find the following information : In the first chapter there is a detailed exposition of the twelve upamas given to a Jaina ascetic in Anuyogadvara. The second chapter resembles the 22nd chapter of Uttaradhyayanasutra, and that some of the gathas are also common to both. The third chapter seems to be based upon Nisitha etc. The fourth agrees with the 24th chapter of Acaranga. The fifth appears to be a paraphrase of Pindaisana, the ist chapter of the 2nd part of Acaranga. The sixth deals with the 18 siksas referred to in Samavaya (XVIII). The seventh is an exposition of bhasa dealt with in the 13th chapter of the 2nd part of Acaranga. The eighth has several topics in common with the eighth chapter of Sthananga. The ninth can be compared with the 1 Somc interpret this as "ten chapters preached at the time of evening". Compare "The.Dasavaikalikasutra, a study" (p. 91) Patwardhan, 1933.

Page #132
704.1 II. 4 Malasatras 95 first chapter of Uttaradhyayanasutra. The tenth resembles the 15th chapter of Uttaradhyayanasutra and has some gathas in common with it. The ist Culika deals with the problem of the stability of a Jaina saint shaken in faith while the second, with the question of secluded residence. Thus on the whole the entire work deals with the life a Jaina saint is expected to lead. Begins.- ( text ) fol. I zrIvItarAgAya namaH // dhammo mNglmukk(kki)|| ahiMsA saMjamo tavo // devA vi taM namasaMti / / jassa dhamme sayA maNo // 1 // etc. ., -- ( Ist Culika) fol. 18" iha khalu bho pavvaieNaM // uppannadukravaNaM // saMjame araisamAvannacitteNaM etc. ,,--( 2nd Culika ) fol. 194 cUliyaM tu pavakkhAmi / suyaM kevalibhAsiyaM / jaM suNenu sa(su)punnANaM dhamme uppajaI maI // 1 // Ends.-- ( text ) fol. 186 taM dehavAsaM asuI asAsayaM sayA cae // nizcahiyaTTiyappA // chiMdittu jAI maraNassa baMdha(Na) ___uvei bhikkhU apuNAgamaM gae(iM) tti bemi // 21 // sabhikkhuajjhayaNaM dasamaM samattaM // 10 // ,,-( Ist Calika )-fol. 19" icceva saMpassia buddhimaM nro|| AyaM uvAyaM vivihaM viyANiyA / / kAraNa vAya( yA ) adumANaseNaM // tiguttigutto jiNavayaNamahiTTijjAsi te(tti ) bemi // ch| rahavaktA sNmttaa||

Page #133
96 Jaina Literature and Philosophy [704. Ends.-- ( 2nd Culika ) fol. 19 appA [6] khalu samayaM rakkhiyabvo // sabidi ehiM susamAhiehiM / / aravivaujjA( o jA )ipahaM uvei // surakviu(o) savvaduhANa muccai tti bemi / / dasaveyAliyasuyakkhaMdho sammatto // maNagaM paDucca sejjaMbhaveNa nijjUhiyA dasajjhayaNA / / veyAliyAi ThaviyA tamhA veyAliyaM nAma // 1 // sijjamavaM gaNaharaM // jiNapaDimAdasaNeNa paDibuddhaM ma[ na ]NagapiyaraM dasakAliyassa // nijjUhagaM vaMde // 2 // ' eyAo do calAu // ANIya jakkhiNAi ajjAe // sImaMdharapAsAe // bhaviyANa bohaNatthAe // 3 // iti zrIdazavakAlikasUtraM samAptaM / / saMvat 1785 varSe zAke 1650 pravartamAne // kArtivadi 2 dine budhavAre zrI. The subsequent letters are illegible as ink is applied here. Then we have: liSitaM...paThanArtha // Reference.--- Edited with Bhadrabahusvamin's niryukti in Z. D. M. G. (vol. 46, pp. 581-663 ) by E. Leumann, with introduction dealing with the different strata of Jaina commentaryliterature in general and the stories connected with the text, in special. The text along with two Culikas, this niryukti and Haribhadra Suri's commentary is published in the D. L. J. P. F. Series in A. D. 1918 and that with Samayasundara Gani's commentary by Hiralal Hamsaraj, Jamanagar, in A. D. 1915. Dasavaikalikasutra along with two Culikas, their sabdaratha and bhavartha, too, is published in Samvat 1987, by Jaina-mahila-mandala, Santinatha Upasraya, Bombay. Banarasi Das Jaina has given in his Ardha-Magadhi. Reader the 8th chapter of the text on pp. 74-78, along with its English translation on pp. 167 172. The text together with the Culikas has been edited and translated into English by K. V. Abhyankar. He has made 1-2 These are respectively the 15th and the 14th gathas of Dasavaikaliksutraniryukti. 3. With the help of this edition Jivraj Ghelabhai Dosi has published an edition in Devanagari characters.

Page #134
704.) II. 4 Malasatras 97 certain allegations against the Jainas and Jainism.' W. Schubring, too, has edited the text with the iwo Culikas and has given the English translation of the same. This edition of his is published by Sheth Anandji Kalyanji Pedhi. In this edition he has referred to the question of flesh-eating? For description of a Ms. having the bare text see Keith's Catalogue No. 7498 and for other Mss. see Limbdi Catalogue Nos. 1150-1152, 1954-1157 and 1160-1168. For description of additional Mss. see B. B. R. A. S. vols. III-IV, p. 382 and G. O. Series vol. XXI, p. 25. for contents etc. see Weber II, pp. 807-813, Indische Studien vol. XVII, pp. 77-80, Indian Antiquary vol. XXI, pp. 339ff., Winternitz, Geschichte (vol. II, p. 315), La Religion Djaina ( pp. 43, 79 & 81). A History of Indian Literature (vol. II, pp. 429, 433n., 470 f., 474, 476n., 481, 484 and 509 ) and Die Lehre der Jainas (p. 80 ). See also G. Buhler's "Two lists of Sanskrit Mss. together with some remarks on my connexion with the search for Sanskrit Mss." (Z. D. M. G. vol. XLII, p. 553). Sec also Mitra, Notices vol. VIII, pp. 119-120. I Sec 219 of my article " TFF leasfa" published in "Citramayajagat" ( vol. 18, December 1932 ) and also another itticle of mind "BESTOFTFUET Ne ft seat" published in the issue of " Jain", weekly dated 25th December 1932. For other articles of mine having the same title see the issues of this "Jain " dated 21-5-33, 28-5-33, 4-6-33 and 23-7-33 res. pectively. 2 In this connection he informs me in his letter dated the 7th September 1936 as under: "Through the kindness of Mr. Gode I received your article concerning fleshCating in Jainism, partly based upon Professor Jacobi's brilliant suggestions. I appreciate it very much and it is now on the part of the managers of Sheth Anandji Kalyanji. Ahmedabad, to make use of what I wrote then after having reconsidered certain places in my translation of the Dajavaikalikasuulid on the ground of those investigations."

Page #135
98 dazavaikAlika sUtra cUlikAyugalasahita No. 705 Extent. - fol. 5 to fol. 21. Description. Both the text and the Jaina Literature and Philosophy Ends. other details see Paksikasutra No. Begins. - fol. 54 dhammo maMgalamukkaTTe etc., as in No. 703. fol. 5 sAmannapuvviyaM nAmajjhayaNaM sammattaM // cha // fol. 8h chajjIvaNiyA sammattA // cha // fol. 11 piMDesaNAe paDhamo uddeso sammatto // cha // fol. 12 piMDesaNA ( e ) bIo uddesao sammatto // cha // fol. 13 dhammatthakAmajjhayaNaM ( N) chaTTu sammattaM // cha // fol. IS vakkasu (ddhi) ajjhayaNaM sattamaM sammattaM // cha // fol. 16h viNayasamAhIe paDhamau uddesau // cha // fol. 17 AyArapANa (hi) aTTamaM ajjhayaNaM sammattaM // cha // fol. 17 viNaya samAhIe paDhamau uddesau // cha // [705. Dasa vaikalikasutra with Culikayugala two Culikas complete. For 613 (a). 1884-86. fol. 18 viNayasamAhIe bIu uddesau || cha | fol. 18th viNayasamAhIe taIu uddesau // cha // fol. 194 viNaya samAhIe navamajjhayaNaM sammattaM // cha // fol. 19deg sabhikkhuajjhayaNaM samaM sammattaM // cha // fol. 200 raivakkA sammattA // cha // fol. 21 a 1 maNagaM paDuJca sijjaMbhaveNa nijjUhiyA dasajjhayaNA / aroga tamhA dasakAliyaM nAma // 12 // cUliyA sammattA dasaveyAliyasuyakkhaMdho sammato // cha // N. B.----For other details see No. 704. 613 (b). 1884-86. i Just as this work is composed by Sayyambhava Suri for his son so it is said Dharmadasa Gani has composed Upadesamalaprakarana for his son Rapasimha, Sce Ramavijaya's vivarana on this prakarana. 2 According to the printed edition this is the 1,th gatha of the Dasavaikalikasutraniryukti.

Page #136
706.] II. 4 Malasutras 99 dazavaikAlikasUtra Dasavaikalikasutra cUlikAyugalasAhita with Clilikayugala No. 706 434 ( a ). 1882-83. Size.-- 11 in. by 43 in. Extent.-- 14 folios; 15 lines to a page ; 56 letters to a line. Description.-Country paper thin and grey; Jaina Devanagari charac ters with occasional qalars; bold, legible, uniform and good hand-writing ; borders ruled in two pairs of lines in black ink; the space between these pairs coloured red; unnumbered sides have one small disc in red ink in the centre; the numbered have two more such discs, one in each of the two margins; a piece of paper of almost the same size as the fol. pasted to the first fol.; edges of some of the foll. worn out; condition very fair; red chalk used; at times letters have been made illegible by applying red and black ink, instead of applying the yellow pigment; this Ms. contains the Dasavaikalikasutra and the two Culikas as well; all complete ; extent 700 slokas ; this Ms. has an additional work viz. Paksikasutra beginning and ending on fol. 14thus having 7 complete verses plus a part of the 8th, Age.- Pretty old. Begins.--( Dasavaikalika ) fol. 16 DE 11 YFAZag etc., as in No. 704. >> -- (Ist Culika ) fol. 13" za 3 H etc., as in No. 704. , -(2nd ,, , fol. 144 hi a ( )FEIA etc., as in No. 704. Ends.-- ( Dasavaikalika ) fol. 136 SAE 197&T SAGOTITA ITE IT AH 1188 sabhikkhuajjhayaNaM dasamaM sammattaM // cha / >> - ( ist Culika ) fol. 144 for TAUTAIETZSTIF IT T 1 PC raI(i)vakkA paDhamA calA sammattA // cha / >> --(2nd >> ) fol. 140 gram 31 Haagio ga II a II 16 bIA cUlA sammattA // cha /

Page #137
100 Jaina Literature and Philosophy sijjabhavaM gaNaharaM jiNapADamAdaMsaNeNa paDiba (bu) ddhaM / aratri dasakAliyasya nijjUhagaM vaMde // 1 ( This is the 14th gatha of dazavaikAlikAni yukti ) maga paDuca sijjaMbhaveNa nijjUhiya (yA) dasajjhayaNA / vepAliyAya ThaviyA tamhA dasakAliyaM nAma // 2 (This is the 15th gatha of daza * niyukti ) chammA seNa ahi (hI) yaM ajjhayaNamiNaM tu ajjamaNageNa ( 1 ) chammAsA pariyAo aha kAlagao samAhIe // 3 ( This is the 37oth gatha of daza niryukti ) ANaMdayaM supAyaM kAhI sejjaMbhavA tahi therA / jasabhahassa ya pucchA kahaNA ya viyAlaNA saMghe // 4 (This is the 371th gatha of daza niryukti) (tu) mhAsi ( sa ) risA vi muNivara mohapisAeNa jai chalijjati / tA sAhu tumaM ci dhIramAkaM samAllIyao || 5 dasaajjhayaNasamaya sijjaMbhava sUriviraithaM evaM / lahuyAoyaM banAuM ahAe maNagasIsassa || 6 eyA u do cUlA ANIyA jakkhirNAi ajjAe / sImaMdharapAsAo bhaviyaNajaNavibohaNaTTAe // 7 khullo saNadIhaMmmI ahiyaM kArAvio ya ajjA / taNI kAlagao ajjA saMvegamAvannA // 8 kahameyaM saMjAyaM risihaccA pAviyA mae pAve / to devayAvinIyA sImaMdharasAmiNo pAse // 9 sImaMdhareNa bhaNiyA ajje khullo gao mahAkappo / mA jjharasu appANaM dhammaMmi ya niccalA hosu // 10 iti davaikAlikaM samAptamiti // // graMthAgraM 700 N. B.- For additional particulars see No. 704. [ 706. zubhaM bhavatu zrIsaMghasya // 1

Page #138
708. II. 4 Malasatras tor dazavaikAlikasUtra Dasavaikalikasutra cUlikAyugalasahita with Culikayugala 1269 (e). No. 707 1887-91. Extent.- fol. 12s to fol. 244. Description.-- Both the text and the two Culikas complete. For other details see No. 1269 (a). - 1889-91. Begins...- ( Dasavaikalika ) fol. 12 ahaM nmH|| dhammo maMgalamuktaTuM etc. as in No. 704. ,, - ( Ist Culika ) fol. 23deg iha khalu etc. as in No. 704. ,, -- ( 2nd ,, ,, 23 cUliyaM tu etc., as in No. 704. Ends.--- ( Dasavaikalika ) fol. 224 uvei etc. as in No. 704. ,, - ( Ist Culika) fol. 23 jiNavayaNamahiTrijjAsa(si) tti bemi 18 // raivakkAcUlA sammattA // ,, -- ( 2nd , ) fol. 23b sambaduhANa muccaI tti bemi / 16 cUliyA ajjhayaNaM sammattaM / / cha / zrIH / / This is followed by 10 verses beginning with sijaMbhavaM gaNahara and ending with the line dhammami ya nicalA hosu // 10 as in No. 706. Then we have: iti zrIdazavakAlika paramAgama samAptamiti // cha / N. B.-- For further particulars sce No. 704. dazavaikAlikasUtra Dasavaikalikasutra (adhyayana 2-10) (Adhyayanas II-X) cUlikAyugalasahita with Culikayugala 1171 (8). No. 708 1887-91. Size.- 55 in. by 3} in, Extent. --- 461=45 folios; 10 lines to a page ; 44 letters to a line.

Page #139
102 Jaina Literature and Philosophy [708. Description.- Country paper thick, smooth and grey ; Devanagari characters with pRSTamAtrA ; quite bold, legible, uniform and very beautiful hand-writing; borders ruled in two pairs of lines in black ink ; unnumbered sides have one circular disc in the centre ; the numbered have two more, one in each of the two margins ; red chalk used ; numbers for foll. twice entered on one and the same side in one and the same left-hand margin and also once in the right-hand margin as sti, zrI, ka, t etc.; the 46th numbered as " hai; condition very good ; the Ist fol. missing so this Ms. commences with the last word of the 6th gatha of the 2nd adhyayana ( see pp. 95-96 D. L. J. P. F. Series, No. 47 ); otherwise complete. This Ms. contains two additional works as under : (i) pAkSikasUtra foll. 30 to 420 (ii) zramaNa pUtra ,, 42 ,, 46. Age.- Old. Begins.- ( Dasavaikalika ) fol. 20 gaMdhaNe // 6 dhiratthu te jasokAmI jo taM jiiviykaarnnaa| vaMtaM icchasi AveDe seyaM te maraNaM bhave // 7 etc. ,, -( Ist Culiki ) fol. 27" iha khalu bho etc., as in No. 704. ,, --- ( 2nd ,, ),, 29 jUliyaM tu paca(ba)kkhAmi etc., as in No.703 Ends.-- ( Dasavaikalika ) fol. 27 apuNAgamaM gai tti bemi // 21 ||ch // sabhikkhuajjhayaNaM dasamaM sammattaM // cha / ,, -- (Ist Culika) fol. 29* jiNavayaNamahiTrijjAsi tti bemi / / 18 raya(i)vakA nAma paDhamA calA sammattA // cha / / ,, - (2nd ,, ) fol. 30deg savvaduhANa muccai ti bemi ( 16) // cha / dasaveyAliyasuyakhaMdho sammatto / / cha // This is followed by only one verse commencing with forti aga and going up to TaviyA tamhA veyAliyaM nAma // cha / N. B.- For further particulars see No. 704.

Page #140
709. 1 II. 4 Malasutras 103 dazavakAlikasUtra, cUlikAyugala, FAQ (avgia) tathA TIkA Dasavaikalikasutra, Culikayugala, piryukti (nijjutti) and tika 721. 1875 -76. No. 709 Size.-9} in. by 4i in. Extent.-- 160 + 1 = 161 folios; 15 lines to a page; 49 letters to a line. Description.- Country paper very thin and greyish ; Devanagari characters with qaras ; bold, legible, uniform and elegant hand-writing ; borders ruled in three lines in red ink ; this Ms. contains Dasavaikalikasutra, the Culikas, the niryukti and the commentary ; edges of the first fol. somewhat worn out; all the same condition on the whole very good; fol. 36th repeated; complete. Age.- Pretty old. Author of the niryukti.-Bhadrabihusvamin, twin pupil with Sambhuti. vijaya of Yasobhadra Suri. He is looked upon as the author of ten niryuktis. The texts corresponding to these ten niryuktis are as under :-- (1) Avasyakasutra, (2) Dasavaikalikasutra, ( 3 ) Uttaradhyayanasutra", (4) Acarangasutra?, (5) Sutrakstangasutra", (6) Dasasrutaskandhasutrat, (7) Kalpasutra, ( 8 ) Vyavaharasutra, ( 9 ) Suryaprajiapti and (10) Rsibhasita. Muniratna Suri in his Amamasvamicaritra (v. 15) compares these niryuktis with the ten mandalas of the kgVeda. 1-4 For a niryukti for each of these works see Nos. 681-682, 6-8, 48-50 and 485-487. 5 Sec Peterson ), App. p.11 h Vide l'eterson II!, App. F. 30.

Page #141
104 Jaina Literature and Philosophy [.709. Devacandra mentions Bhadrabahusvamin as the author of Vasudevacariya, in 125,000 slokas." Bhadrabahu is referred to as one of the five srutaparagas 2 and is looked upon as yugapradhana, too. 3 Peterson in his Report IV, p. LXXXIV mentions Satrunjayakalpa as one of his works with a cross-reference to 3, App. p. 306. Malayagiri refers to him as the author of Pindaniryukti.1 Ksemakirti praises him as the uddharaka of Brhatkalpasutra. Oghaniryukti has been composed by this Bhadrabahusvamin to whom the authorship of Upasargalarastotra is ascribed. For other details about Bhadrabahusvamin see Klatt, Indian Antiquary vol. XI, p. 246, Weber II, p. 999 and my Sanskrit introduction to Priyamkaranapakatha. Author of the commentary.-- Haribhadra Suri. He has named about 63 gathas as bhasyakrd-gathas which are usually included in the niryukti of Dasavaikalika. As regards this Haribhadra Suri A. M, Gharage in his article " Dasavaikalika Niryukti" observes :-- "The commentator is clearly far-fetched and twisting in interpreting udaharanas as the drstantas of the logical syllogisms. (p. 637) ......... Haribhadra's opinion that a vauliya is a reference to the school of the Nastikas is not very accurate ( p. 638)." This Haribhadra Suri has composed a number of works, out of which the following are noted by Peterson in his Report IV, pp. CXXXVII-CXXXIX : i See Peterson V, App. p. 73. 2-5 Vide Peterson III, App. p. 266 od 308 and V, p. 31 and V. p. 102 respectively. 6 This is published in The Indian llisturiul Quluttu vol. XI. No. 4. Ir. 627-639.

Page #142
709.] II. 4 Mulasutras (1) Anekantajayapataka (III, App. p. 191), (2) Avasyakatika called Sisyahita ( III, App. p. 202), (3) Upadesapada (I, App. p. 34: III, App. p. 46), (4) Caityavandanavrtti called Lalitavistara (III, App. p. 148), (5) Jambudvipasangrahani (I, App. p. 49; III, App. pp. 213, 253 and 276), (6) Jnanapancakavivarana (III, App. p. 285 ), (7) Darsanasaptatika (III, App. p. 13), (8) Dasavaikalikaniryuktitika, (9)1 Dharmabindu (I, App. p. 44; III, App. p. 53), (10) Nanacitrika (I, App. p. 48), (11) Pancasaka (I, App. p. 11), (12) Munipaticaritra, (13) Lagnakundalika (I, App. p. 88), (14) Vedabhyatanirakarana, (15) Sravakadharmavidhiprakarana (I, App. p. 16), (16) Samaradityacaritra (III, App. p. 118), (17) Yogabinduprakaranavrtti (III, App. p. 327 ) and ( 18 ) Pancasutravrtti ( IV. 104 ). 105 In his Report V, p. LXXXIV, he mentions the following additional works: (1) Lokatattvanirnaya, (2) Yogadrstisamuccaya and its commentary. For a detailed discussion about Haribhadra Suri's life, date, works etc., see my introduction to Anekantajayapataka, which is being edited with its svopajna commentary and Municandra Suri's vivarana and which will be hereafter published in Gaekwad's Oriental Series. Subject. The text as usual. It is accompanied by a Prakrit commentary known as niryukti several gathas of which are found in Mulacara, a Digambara work. This niryukti is explained in the Sanskrit commentary which follows it. As stated in Ganadharasardhasataka (Weber II, p. 987) Haribhadra composed a brhadvrtti and a laghuvrtti to Dasavaikalikasutra. The commentary given here is a laghuvrtti, it being an epitome of the brhadvrtti. The niryukti above referred to is a metrical composition in Prakrit, and it consists of 447 verses (gathas) or so2. Out of them 62 gathas are styled by Haribhadra as 1 Diksavidhipancasaka is here excluded by me; for, it forms only a part of Pancasaka. 2 Sec p. 108.

Page #143
I06 Jaina Literature and Philosophy 1709. bhasyakst-gathas. They mostly occur in the niryukti of the fourth adhyayana and seem to supplement the original niyurkti-gathas. Haribhadra has noted one gatha as famo kartRkI. See the printed edition ( p. 844 ). The niryukti explains the titles of the adhyayanas and some words from the body of the text. It deals with the subject-matter from various view-points wherein (1) niksepa, ( 2 ) nirukta, ( 3 ) ekartha, (4) linga and (5) pancavayava hold a promiment place. Out of them niksepa is given full scope in verses 8, 9 and 178". Some of the words of which niksepa is given are duma, dhamma, samaNa, kAma, paya, AyAra, jIva, kAya, sayAra, bhikhu vakka, suddhi, and paNihi. Nirukta is noticed in connection with ajjhayana, ajjhina, aya, kama, jhavana etc., and ekartha for vakka in v. 270.2 Begins.- ( Dasavaikalika ) fol. 20 dhammo etc., as in No. 704. -- ( niryukti ) fol. I siddhigaimuvagayANaM etc., as in No. 710. ,, - ( com. ) fol. I OM namaH zrutadevatAyai jayati virji(ji )tAnya etc., up to practically mahArthagocarasya STIETI requa ( see No. 716 ). This is followed by a prastutArthapracikaTayiSayeSTadevatAnamaskAradvAreNa zeSavighnavinAyakApohasamarthI paramamaMgalAlayAmimAM gAthAmAha niyuktikAra: etc. vyAkhyA siddhigatimupagatebhyo etc. Ends.---- ( Dasavaikalika ) fol. I59 appA khalu etc. , - ( niryukti:) fol. I60deg samvesi pi nayANaM etc., up to sAhU // ,, - ( com.) fol. 160deg zAstramupasa(saM)hara(n) upadezasarvasvamAha appatti sUtra vyA / AtmA khalviti khaluzabdo vizeSaNArtha(:) zakto(ktau) matyAM paropi etc. nizamya zrutvA sarvanayavizuddha sarvanayasaMmataM vacanaM yaccaraNa( guNa )sthitaH sAdhu( : ) yasmAtsarvanayA eva bhAvanikSepamicchaMtIti gAthArthaH followed by the following lines written perhaps by some one else :1 These numbers refer to D. L.J. P. F. Series No. 47. 2 For details sec Ghitage's article ( above relerred to ) p. 635 and ll. Here he has remarked that in many cases the interpretation is clearly wrong and much of it is based upon the mere similarity of sound or the possibility of a secondary sense".

Page #144
710.) II. 4 Malasutras 107 namo varddhamAnabhagavate vyAkhyAtaM cUDAdhyayanaM tadvyAkhyAnAcna samAptA dazavakAlikaTIkA yAkinIdharmasUnuzrIharibhadrAcAryakRtA dazavakAlikaTIko vidhAya yat puNyamarjitaM tena / mAtsaryadukkha( duHkha )virahAd guNAnurAgI bhavatu lokaH // Reference.- For a fragment of the ending portion of Haribhadra's tika see Keith's Catalogue No. 7499. For a Ms. having the text and an anonymous commentary in Sanskrit see the same Catalogue No. 7501. No. 7502 of this Catalogue records a Ms. having an extract of the text with a Sanskrit commentary, on truth and falsity in the use of a language taken from Haribhadra's tika. In " A History of Indian Literature " vol. II, p. 479 n., Dasavaikalika-niryukti-tika is mentioned, N. B.- For other details see No. 704. dazavaikAlikasUtraniyukti Dasavaikalikasutraniryukti (dasaveyAliyasuttanijjutti) ( Dasaveyaliyasuttanijjutti) 1261. No. 710 1886-92. Size.-- 103 in. by 4} in. Extent.--- 10 folios ; 17 lines to a page ; 56 letters to a line. Description.- Country paper thin, durable and greyish; Devanagari characters with gears; quite bold, perfectly legible, singularly uniform and very beautiful hand-writing ; borders ruled in four lines in black ink ; unnumbered sides have one circular disc in red ink, in the centre; the numbered have, over and above this, two more such discs, one in each of the two margins; red chalk used; foll. doubly numbered as I to 10 and also as 29 to 38 ; most probably this is done with a view to mark out a different work and at the same time not to disturb the continuity of the fol ation of the Ms. ; at least the few foll. prior to the 29th must be dealing with straight as can be seen from the last

Page #145
108 Jaina Literature and Philosophy [710. lines written on this fol.: complete; this Ms. does not contain Dasavaikalikasutra : condition very good. Age. -- Samvat 1492. Begins. -- ( Oghanirukti ) fol. 1a (or 29a ) ghnniymaautto| maraNArAhaNajutto caMdagavijjha samANei // 60 This is continued up to esA aNuggahaTTA which goes up to saMgahiyA // 1164. Then we have : - zrIodhaniyuktisUtra navamapUrva tRtIyasAmAcArIviMzatitamaprAbhUtAni(ni)yUTa zrIbhadrabAhusvAminA // cha / Begins.---fol. Inamo vItarAgAya // siddhigaimuvagayANaM kammAvisuddhANa svvsiddhaannN| namiUNaM isakAliyanijjuttiM kittaissAmi // 1 // etc. Ends.-- fol. 100 dabbe sarIrabhavio bhAveNa ya saMjao iha tassa / uggahiyA paggahiyA vihAracariyA muNeyavvA / / 43 (443) aNieyaM pairikkaM annAyaM sAmudANiya urcha / appovahI akalaho vihAracariA isipasatthA // 44 (444) chahiM mAsehiM ahi(hI)yaM ajjhayaNamiNaM etc. as in No. 7II, ANaMdaaMsupAyaM kAsI sijjabhavA etc. as in No. 71. nAyami giNhiyatve agihiyavaMmi ceva atthaMmi / jaiyatvameva iha jo uvaeso so nao nAma // 47 (447 ) ( See 285th page of D. L. J. P. F. Series, No. 47 ). savvesi pi nayANaM bahuvihavattavvayaM nisaamittaa| taM savanayavisuddhaM jaM caraNaguNaddhi(TrI)o sAhU // 48 (448) dazavakAlikanijjuttI sammattA // (See ibid., p. 286). // cha ||||ch // // cha / evaM granthAnaM gAthA 448 zloka 558 cha / saMvata 1492 varSe a(A) zva(zci)namAse kRSNapakSe ekAdazyAyAM tithau paM0devaratnagaNibhiH dazavaikAlikaniyukti.

Page #146
711.) II. 4 Mulasutras 109 Reference. - Published. See No. 704. In Peterson's Report for 1882-83 (p. 97 ), this niryukti is mentioned. As regards the question of the date of this niryukti see Vidyabhusana's " History of Indian Logic" II and A. M. Ghatage's article "The Dasavaikalika-Niryukti" (p. 631). Both of them agree in assigning to it a date nearer the 4th century A, D. dazavaikAlikasUtraniyukti Dasa vaikalikasutraniryukti 76 (1). 1880-81. No. 711 Size.-- 144 in. by 2 in. 40 to 45 Extent.-- 190 + a few leaves; 3 to 6 lines to a leaf ; letters to a line. Description.- Palm-leaf thin, durable and greyish; Devanagari characters with AETS ; this Ms. presents an appearance as if the work is divided into two separate columns; but, really it is not so ; for, the lines of first column extend to the second ; borders of each of the columns ruled in four lines in black ink ; leaves numbered in both the margins ; in the left-hand one as far eft, etc.; several leaves worm eaten ; some very badly ; leat 153 and the following have a d leaves 191 etc., are in fragments; condition on the whole pretty fair; the ist leaf' missing; otherwise complete ; extent 5 so slokas ; this work ends on leaf 42; two extra blank leaves at the end; ink spread out on leaves 494 and 910; red chalk used; there is one small leaf on which the table of contents is written. This Ms. contains the following additional works :

Page #147
iro Jaina Literature and philosophy [7II. , 74*,, 760 (1) navatattvavicAsAroddhAra (?) vRttisahita leaves 426 ( 2 ) parigrahaNa( ? pari )mANa , 56",, 58b (3) mahAvIrakalaza ,, 58 ,, 6r: (4) parigrahapramANa (zrIsiddhArtha0),, 61* ,, 66" (5) janmAbhiSeka , 66deg ,, 68b (6) gurustuti ,, 68,, 700 (7) yatistuti ,, 70deg ,, 7I (8) pauSadhavidhi ,, 71deg ,, 73b! (9) manha jiNANaM sajjhAya (svAdhyAya),, 73 ,, 74 ( 10 ) praznottararatnamAlikA (II) dharmalakSaNa ,, 77* ,, 78 (12) catuHzaraNa " 78deg,, 79b (13) aSTAdazapApasthAna ,, 79,, 80b (14) sAkArapratyAkhyAna , 80deg ,, 8 (IS) jinabhavanAdi ,, 8,, 82(16) rAjapraznIyasUtrAvataraNa __, 82deg ,, 83 (17) yogazAstra ,, 83deg,, I220 (18) vItarAgastotra ,, 122' ,, 139 (19) bhaktAmarastotra (4+ verses) ,, I39deg ,, 145 (20) prazamaramapadya leaf. 1456 ( 21 ) bhayahara(namiUNa)stotra (23 verses) leaves 1456,, 1484 ( 22 ) vardhamAnastava 148. ,, ISO( 23 ) triSaSTidhyAnakathAnakakulaka ,, I50" ,, IS4 (24) bhayaharastotra ( I4 verses) ,, I54" ,, 1560 ( 25 ) caturviMzabuddhAtizayastotra ,, I56 ,, I58a (26) ajitazAntistava (40 verses) ,1582 ,, 164 ( 27 ) kSetrasamAsa ,, 164deg ,, I74 (28) ekaviMzatisthAnaka (caSaNavimANA) , 174* ,, 181 (?)

Page #148
712.] 11. 4 Malasutras III (29) gautamapRcchA leaves 1814(2),, 1860 (30) arihaMtavinati 186' ,, 1896 ( 31 ) kevalanANasahANaM ., 189" ,, 191(?) ( 32 ) micchattakulaya leaf I91(?) Begins.-leaf pa ( kAla )o ya nniddeso| dasakAliyasayakhadhaM ajjhayaNuhesa Nikkhiviu // 7 // NAmaM ThavaNA davie mAugapayasaMgahekkae ceva / pajjavabhAve ataH(hA) sacce(te)e ekkagA hoti // 8 // Ends.---leaf 42a chahiM mAsehiM ahIyaM ajjhayaNamiNaM tu ajjamaNaeNaM / chammAsA pariyAo aha kAlagao samAhIe // ANaMdaaMsupAya kAsI sejjabhavA tahiM theraa| jasabhahassa ya putthA(cchA) kahaNA ya viyAlaNA sNghe|| cha / vi(bi)ti(tI)yacUlANijjunI sammattA // dasaveyAliyaNejjuttI sammattA // cha / zlokAnAM zatAni paMcapaMcAzatyadhikAni // aMko(?kataH) zloka 550 // cha // maMgalamastu // cha // cha // zrIH 74 // N. B.-- For other details sce No. 710. dazavaikAlikasUtrAdivRhadvRttyavacUri Dasavaikalikasutradibrhadvrttyavacuri No. 712 1169. 1887-91. Size.--- Iot in. by all in. Extent.-- 17 * 3 = 14 folios ; 21 lines to a page ; 76 letters to a line.

Page #149
II2 Jaina Literature and Philosophy [712. Description.- Country paper very thin, smooth and grey; Deva nagari characters with TEATATS ; clear though somewhat small, uniform and good hand-writing ; borders ruled in three lines in black ink ; red chalk used; yellow pigment also used, but very rarely; lol. 13 to 15 missing ; otherwise the work is complete ; some foll. slightly worm-eaten; condition tolerably good. Age.- Samvat 1510. Author.-Not mentioned. Subject..-- Explanatory notes to Haribhadra Suri's commentary on Dasavaikalikasutra and two Culikas. Begins.-- fol. I sarvajJAya namaH / ihArthataH zrIvIrakRtasya sUtrato gaNadharakRtasya dazavakAlikasya vyAkhyA // zAstrANyAdimadhyAMtamaMgalabhAMji bhavati / iha cAdimaMgalaM dumapuSpikAdhyayanAdi dharmaprazaMsApratipAdakatvAt / tatsvarUpAdityarthaH / madhyamaMgalaM tu dharmArthakAmAdhyayanAdi prapaMcAcArakathAdyabhidhAyikatvAt / caramamaMgalaM tu sabhizvadhyayanAdi bhikSuguNAdyAlaMbanatvAt / ityevamadhyayanavibhAgato maMgala trayavibhAga uktaH / adhunA mUtravibhAgato dazyate etc. Ends.--fol. I7deg kathitaM nAtra bhavatAM doSaH guruparisthApana vA vicAraNA saMghe iti / zayyaMbhavena alpAyuSamenamavetya mayedaM zAstra niryuTaM / kiM(ki)matra yuktamiti nivedito vicAraNA saMghe kAlahAsadoSAt / prabhUtasattvAnAmidamevopakArakamatastiSThatvatAdityevaMbhUtA sthApanA ceti gAthArthaH // 20 // zrIharibhadrasUrikRtabRhadvatteravacUririyaM kRteti / cha / / // 1 // saMvat 1510 varSe 'pattana'nagare likhitaM tri vinAyakena bhaTTArakaprabhuzrImunisuMdarasUrivacanAt //

Page #150
714.] II. 4 Malasutras I13 bRhadvRttiparyAya dazavakAlikasUtra Dasavaikalikasutrabrhadvrttiparyaya 736 (19). No. 713 1875-76. Extent.- fol. 24 to 254. Description.--- Complete. For other details see Pancavastuka paryaya No. 736 (1). - 1875-76. Author.- Not mentioned. Subject. - Dillicult words etc., occurring in the brhadvrtti of Dasa vaikalikasutra explained in Sanskrit. Begins.--- fol. 24 dazavakAlikabahavRtteH pryaayaaH| bAdIti tanuH guNasatyAMtara jJAnAditi guNAH sattvarajastamAkhyA / etc. Ends.-fol. 25* anulvaNayuktati abahudravyaM / ariSTamiti takraM / parisaMsthApaneti sAdhunAmasaMtoSanivAraNaM / sthApanA / dazavakAlikaparyAyAH smaaptaaH| - - dazavakAlikasUtrabRhadvRttiparyAya Dasavaikalikasutrabrhudvrttiparyaya 789 (19). 1895-1902. No. 714 Extent.--- fol. 38a to fol. 10'. Description.- Completc. For other details see Pancavastuka paryaya No. 79 ( 1 ). No. 1895-1902. Begins.-- fol. 38* dazavaikAlikabRhadvatteH paryAyAH / / etc. as in No. 713. Ends.--- fol. 40 anulbaNayukteti etc. as in No. 713. N. B..--- For additional particulars see No. 713.

Page #151
114 dazavaikAlikasUtravRhadvRttiparyAya No. 715 dazavaikAlikasUtra, cUlikAyugala tathA TIkA No. 716 Jaina Literature and Philosophy Extent. fol. (?) to fol. 22. Description. Since the folios have stuck together, it is not possible to mention where it begins. This work appears to be the same as Nos. 713 and 714. For other details see Nandisutravisamapadaparyaya No. 623. Ends. etc. as in No. 713. N. B. For further particulars see No. 713. 23 29 dr rw Size. 9 in. by 41 in. Extent. (text) 62 folios; 6 lines to a page; 53 letters to a line. --(com.),, ;9 ; 69 Description. Country paper thin and greyish: Devanagari characters with occasional ras; this is a fare Ms.; so the text containing Dasavaikalikasutra and Culikayugala is written as usual in the centre and the commentary above and below it; legible, bold, uniform and beautiful handwriting; borders ruled in four lines in black ink; fol. 1a blank; this Ms. contains Dasavaikalikasutra, the two Culikas and their small commentary all complete; red chalk and yellow pigment used; condition very good. >: [-715 Dasavaikalikasutrabrhadvrttiparyaya 332 (2). A. 1882-83. Dasavaikalikasutra, Culikayugala and tika dw 104. 1872-73. ww .. dr

Page #152
716.] Age. - Sarvat 1745 Author of the commentary. - Sumati Suri, pupil of Bodhaka. The text along with the two Culikas and their explanation in Sanskrit. Subject. Begins. -- ( text ) fol. 1 zrIvItarAgAya namaH / 33 " " II. 42 Mulasutrast dhammo maMgalamukkaTTe etc. as in No. 704. 1st Culika ) fol. 55 iha khalu bho etc., "" (2nd ) fol. 592 cUliyaM tu paca ( ba ) kkhAmi etc. " Ends. -- ( text ) fol. 55 uvei bhikkhu apuNAgamaM gaDa ti bemi 21 sabhikkhU nAmajjhayaNaM sammattaM 10 com. ) fol. r namo jinapatibhyaH jayati vijitAnyatejAH surAsurAdhIzasevitaH zrImAn / vimalAsavirahita strilokacintAmaNivara : 1 (See P. 106. Cf. the 28th verse of Sakalarhat ) hArthatastatpraNItasya sUtrato gaNadharopanibaddhapUrvagatAdadhRtasya zArIramAnasAtikaduka duHkhasaMtApavinAzaheto deza vaikAlikAbhidhAnasya zAstrasyAtisUkSmamahArthagocarasya vyAkhyA prasU (stU yate / tatra etc. ~~( 1st Culika ) fol. 59 jiNavayaNamahiTTijjAmi ti bemi 18 raddacakkA paDhamA cUlA sammattA 115 as in No. 704. -- ( 2nd Culika ) fol. 62 savvaduhANa mu(pu) va (cca) i ti bemi 16 vivakkacariyA bIyA tUlA sammattA dasaveyAliya maM akeMdhI ( ? ) samatto . This is followed by the 4 verses which begin with sijjaMbhava and which are found in No. 706. Then we have yA udo cUlA etc. as the sth verse and thereafter the lines as under: iti niyukta gAthApaMcakamaunena samagra zrIdazaivakAlikaguNanaM / saMvat 1745 varSe zAke 1610 pravarttamAne bhAdrapadazadi 5 bhaumavAsare zrI ' pattana - nagare mi (i)daM pustakaM likhitaM iti maMgalaM.

Page #153
116 Jaina Literature and Philosophy 1716. Ends.-- ( com. ) fol. 62deg vividhamanekai prakArairapunargrahaNaparamasvAsthyA(sthyA)pa(pA) dA(donalakSaNairvimucyate iti bravImIti pUrvavat samAptA dazavaikAlikaTIkA iti cha mahattarAyA jA(yA)kinyA dharmaputreNa ciMtitA AcAryaharibhadreNa TIkeya ziSyabodhinI 1 dazavaikAlika(ka)TIko vidhAya yatpuNyamArjitaM tena mAtsaryadu(:)khAMvarahAT guNAnurAgI bhavatu lokaH 2 dazavaikAlikAnuyogAtsUtravyAkhyAM pRthaka kRtA haribhadrAcAryakRtAnmohAdbhaktyA(5)thavA mayA 3 zrImadbodhakaziSyeNa zrImatsumatisUriNA vidvadbhistatra no dveSo mayi kAryoM manAgapi 4 yasmAdvyAkhyo kramaH proktaH sUriNA bhadrabAhanA Avazyakasya niyuktau vyAkhyAkramavipazcitA 5 mutrArthaH prathamo jJeyo niyuktyA mizritastataH sarvairvyAkhyAkramayukto bhANitavyastRtIyakaH 6 pramodakAryavikSepa(?)cetasAM tadAyaM mayA kriyAyA avabodhArtha sAdhUnAM tu pRthaMkRtaH 7 labdhvA mAnuSyakaM janma jJAtvA sarvAvadAM mataM pramodamohasaMmUDhA baiphalya yena yAMti hi 8 janmamRtyujarAvyAdhirogazokAyupadrute saMsArasAgare raudre te bhramati viDaMbitAH 9 . yena punarjJAnasamyaktvacAritravihitAdarAH bhavAMbudhiM samullaMghya te yAMti padamavyayaM 10 iti prazastiH graMthAgraM 2650 zrIrastu saMvat 1745 varSe bhAdrapadadi 5 bhaumadine mi(i)daM pustakaM likhitaM zubhaM. Reference.- For another Ms. see G. O. Series vol. XXI, p. 18. For information as regards Sumati Suri's commentary see ibid., p. 22.

Page #154
717.1 II. 4 Malasutras 117 dazavakAlikAsUtra, Dasavaikalikasutra, cUlikAyugala Colikayugala tathA TIkA and tika No. 717 198. 1871-72. Size.-- 104 in. by 44 in. Extent.--71- = 70 folios ; 14 lines to a page ; 56 letters to a line. Description.-- Country paper thin and greyish ; Devanagari charac ters with HATIS ; this is a grei Ms. ; but there is very little difference so far as the sizes of hand-writing for the text and the commentary are concerned ; bold, less legible, uniform and good hand-writing; borders ruled in two pairs of lines in black ink; there is some space between these pairs ; this Ms. contains Dasavaikalikasutra, the two Culikas and their commentary which is the same as in No. 716; fol. 19 blank; red chalk used; fol. 12th missing hence the corresponding matter missing; fol. 11th ends where the 3rd sutra of the 4th adhyayana terminates, and fol. 13th commences practically with the beginning of the 8th sutra of the same adhyayana ; condition very good. Age.-- Petty old. Begins.-- ( Dasavaikalika ) fol. 1 STE I FAT Angarang AT HFA etc. as in No. 704. , - (1st Culika) fol. 64" z te H ,, -- (2nd , ), 686 ou a quart >> >> >> >> >> : - (com. ) fol. 1b TA: Ha aata etc. as in No. 716. Ends.-- ( Dasavaikalika ) fol. 64a at first COTTAH ATE A 28 sabhivU nAmajjhayaNaM sammattaM // cha / - ( ist Culika ) fol. 68a Fot( ago AFEC T for af PC raivakkA liyaM ||ch||

Page #155
118 Jaina Literature and Philosophy [717. Ends.-- ( 2nd Culika ) fol. 71 savvaduhANa muccai nna(tti) bemi 16. This is followed by sijjabhavaM gaNahaNa(re) jiNa etc. up to viyAlaNA saMghe i. e. to say the first four verses as in No. 706, which are here numbered as 17 to 20. Then we have the following lines: iti zrIdasaveyAlisuyakkhaMdha sammatte no (1) cha // graMthAnaM 2000 mAnaM zubhaM bhavatu // cha // cha // cha / , -- (com.) fol. 7I vividhamanekaiH etc., up to yAMti padamavyayaM, the last (the Ioth) verse as in No. 716. This is followed by an additional portion as under : ye bhavyA praticchAdhA janavacane syAdvAdasalapi na ne vANIzrita vataso vidadhi 2 sattavamArgayogyA na snada sAdhUnA vidhibhAnAvasUriSadavAmArApayavannira zrA(zrI)maji(ji)nada(de)vasUricaraNA rakSatu saMghaM sadA / / 11 // samAptA // cha dazavaikAlikaTIkAmiti cha graMthAgrasAdhanA / 3000 va(? ca) uddsh(s?)||ch|| N. B.- For further particulars see No. 716. dazavakAlikasUtraTIkA Dasavaikalika sutratika No. 718 1373. 1891-95. Size.- II in. by 4g in. Extent.--- 50 folios; 16 lines to a page ; 48 letters to a line. Description.- Country paper rough and white; Jaina Devanagari characters with occasional Teas; small, clear and very fair hand-writing ; borders ruled in four lines in black ink; this Ms. contains the states of the text; foll. numbered in the right-hand margin only; yellow pigment used; a margin of fol. 6th partly gone; condition tolerably good; the last two foll. seem to have been added to this Ms. by way of replacing the old ones.

Page #156
719.] II. 4 Malasatras 119 Age.- Fairly old. Author:- Sumati Suri. Subject.--A commentary in Sanskrit, explaining Dasavaikalikasutra. Begins.-- fol. IG arha jayati vijityAnyatejAH etc., as in No. 716. Ends.- fol. 49deg vividhamanekaiH etc. up to padamavyayaM 10 as in No. 716. ___This is followed by zubhaM bhavatu // Reference.-- See No. 716. dazavaikAlikasUtraTIkA Dasavaikalikasu tratika 710. No. 719 1892-95. Size.-- 104 in. by 4d in. Extent.- 65 folios ; IS lines to a page ; 40 letters to a line. Description.- Country paper rough and greyish; Devanagari cha racters; small, legible and tolerably good hand-writing ; borders ruled in three lines in red ink; fol. I blank ; numbers for foll. entered in the right-hand margin only; yellow pigment used ; red chalk, too; complete ; extent 2800 slokas; condition very good. Age.- Sarivat 1663. Begins.--- fol. 1 OM namaH jayati etc. as in No. 716. Ends. - fol. 65 vividhamakaiH etc. up to padamavyayaM / / 10 // as in No. 716. This is followed by graMthAj2800 // cha / iti zrIdazavaikAlikaTIkA samAptA // saMbati 1663 vaizAkha vadi 7 dine zrI bRhatkharataragacche zrIsAgaracaMdrasUrizAsvAyAM zrIvAcanAcAryarAjacaMdragaNivarANAM ziSyavA.. jayAnadhAnagaNibhiralekhi // 'mAdIpAna'grAmAMtaH / zamastu / N, B.--- For others details see No. 718.

Page #157
120 dazavaikAlika sUtra, cUlikAyugala tathA avacUri No. 720 "" 22 Size. 10 in. by 48 in. Extent. (text) 16 folios; 8 lines to a page; 58 letters to a line. 16 -- (com.),, ; 921 Description.- Country paper thin and white; Jaina Devanagari characters; this is a qara Ms. ; it contains the text, two Culikas and avacuri as well, the last in an extremely small hand; uniform, legible and elegant hand-writing; borders ruled in red ink; foll. numbered in the right-hand margin only; mostly, unnumbered sides have a small disc in the centre and the numbered, in the margins, too; the text, the two Culikas and the commentary complete; condition very good; red chalk and yellow pigment used. Age. Samvat 1515. Author of the avacuri.-- Not mentioned. rw dr - 17 Jaina Literature and Philosophy dw dr " Subject. A Jaina agama with a small commentary in Sanskrit. Begins. -- ( text ) fol. 1* namaH zrIsudharmasvAmine || dhammo bhaMgala etc. (1st Culika) fol. 15deg etc. (2nd ) 16 cUliyaM tu etc. wr 21 21 27 : 720. Dasavaikalikasutra, Culikayugala and avacuri dr 713. 1892-95. rw dr * ( com.) fol. 1 " ihArthataH zromahAvIrapraNItasya sUtrato gaNadharopaniSa(ba)ddhapUrvagatoddhRtasya zArIramAnasAneka kaTukaduHkhasaMtApavinAzaheto' etc. Ends. (text) fol. 15 agar etc. up to as in No. 704. This is followed by samApta // (1st Culika) fol. 16 etc. up to as in No. 704. This is followed by cUlikA paDhamA || zrI sImaMdharasvAminA tIrthakareNa gaditA // cha // 1 This refers to a horizontal line.

Page #158
"" 721.1 Ends.- ( 2nd Culika ) fol. 16b appA hu khalu etc. up to saMghe // 4 // as in No. 706. This is followed by gAthAcatuSkaM niryuktigatA / / iti zrIdazavaikAlikazrutaskaMdha sUtraM samAptaM // gAthAsaMkhyA // 700 / / zlokasaMkhyA dazavaikAlikasUtra, cUlikAyugala tathA avacUri No. 721 "" 11. // cha // - ( com. ) fol. 16b tatra tasminkAle sthavirA: yazobhadrasya ca pRcchA kathanAca vicAraNA saMghe // 4 // iti niryuktigatagAthAvacUriH // cha // iti zrIdazavaikAlikazrutaskaMdhAvacUriH // cha // graMthAgraM 2143 / zubhaM bhavatu / saMvat 1515 zake 138 (1) 'bahudhAnya saMvatsare zrAvaNazuddha 7 somadine likhitaM // cha // 16 IP 1 4 Malasitras Size.-- ro++ in. by 4g in Extent. - ( text ) 24 folios; 6 lines to a page ; 48 letters to a line. "" ; 14 - ( com.) Description. Country paper thin and white; Jaina Devanagari characters with pRSTamAtrAs ; this is a tripATI Ms. containing the text, the two Culikas and a commentary; hand-writing on the whole small, legible and good; borders ruled thickly in red ink; foll. numbered in both the margins; unnumbered sides have a small square in the centre, only; the number-. ed, in the margins, too; each of the foll. ra and 24b decorated with the same design in red and blue colours; both complete; condition very good. "" " " " 121 " Daga vaikalikasutra, Culikayugala and avacuri 435. 1882-83. , 70 " Age.- Pretty old. Subject. A Jaina agama along with a small commentary in Sanskrit. "" ""

Page #159
122 Jaina Literature and Philosophy [721. Begins.- (text) fol. I" arha / zrIgautamasvAmine namaH // dhammo maMgala etc. ...,, -- ( Ist Culika) fol. 21" iha khala bho etc. , -- ( 2nd ,, ) fol. 23deg cUliyaM nu etc. , -- (com. ) fol. I dharmo maMgalamutkRSTamityanema(na) maMgalamuktaM etc. Ends.- ( text) fol. 21" taM dehavAsaM etc. up to ajjhayaNaM as in No. 704. ,, . -- ( Ist Culika) fol. 23* icceva etc. up to bemi // 18 // as in No. 704. , -- ( 2nd , ) fol. 23 appA khalu etc. up to saMghe // 4 // as in No. 706. This is followed by iti zrIdazavakAlikaM saMpUrNa likhitaM 'biDura mahAnagare / ch|| - (com.) fol. 24 etAvataiva eti tena zrutena bhA (?) yugapradhAnadharo bhaviSyati tato(s)smAdeva kAraNAyuSmAdvacanAcca ziSyapraziSyaiH paSa(vya)mAnamidaM sumaMgalApa bhUyAn( t) zrIsaMghAya // 4 // iti zrIdazavaikAlikAva cUriH / / // cha / Reference.-- For a Ms. having the text and an anonymous avacuri ___ see Keith's Catalogue No. 7500. dazavakAlikasUtra, Dasayaikalikasutra, cUlikAyugala Culikayugala tathA avacUri and avacuri 1170. No. 722 1887-91 Size:--- 104 in. by 44 in. Extent.-- (text) 37 folios ; 12 lines to a page ; 32 letters to a line. Description.- Country paper thick, smooth and grey ; Jaina Deva nagari characters with pRSThamAtrAs; bold, clear, uniform and elegant hand-writing; borders of the text and those of the two Culikas ruled in four lines in black ink, whereas those of the commentary, in two lines; this is a pazcapATI Ms; so the text is in the middle and

Page #160
722.] Age.- Samvat 1653 Author of the avacuri. - Not mentioned. Subject. The text along with two Culikas and a small commentary in Sanskrit. Begins. -- ( text ) fol. 1deg dhammo maMgalamukka ( kki ) etc. as in No. 704 >> 23 11. 4 Malasatras 123 the commentary on all its four sides, and that the commentary is written in a smaller hand than the text; complete; foll. It and 37b blank; corners of some of the foll. worn out; condition very fair; the text the two Culikas and the commentary complete. " " " 23 " (com.) jayati vijitAnya etc. as in No. 716. This is followed by dhammo maMgalamityAdi / ahiMsAsaMyamataporUpo dharma utkRSTaM maMgalaM // etc. ( 1st Culika ) fol. 342 iha khalu bho etc. as in No. 704. } 34 caliye tu etc. as in No. 704 . - ( 2nd Ends-- ( text ) fol. 342 taM dehavAsaM etc. up to sabhikkhUajjhayaNaM as in No. 704. ( 1st Culika) fol. 35deg icceva saMpatti etc. tti bemi as in No. 704 This is followed by 18 raivakkA nAmaM paDhamaM cUlajjhayaNaM 19. 33 33 ( 2nd Culika ) fol. 360 appA khalu etc., up to suyakkhaMdhoM sammatto as in No. 704. Then follows the couple of verses sijjaMbhavaM etc. and maNagaM paDucca etc. as in. No. 706. This is followed by the lines as under: ime niyuktigAthe prathamAdhyayanagate. Then we have: chahiM mAsehiM etc. and ANaMdayaM etc., the two verses as in No. 706. Then run the lines as under:--- (s) ime niyuktigAthe atye 4 saMvat 1653 varSe azvayujamAse prathamapakSetithau mADavAsare zrI'vIramapura'madhye 'pallIvAla' gacche upAdhyAyazrI kanakazekharANAM ziSyalezena sumatize (kha) reNAlekhi pratiriyaM sAvacUriH svaziSyAvalibhirvAcyamAnA ciraM naMyAt // -- - (com) fol. 374 vicAraNA cirakAlAvijayabhAvi // 20 // iti vivikta caryAnAmadvitIyannUDA(?lA ) 'vacariH // cha // iti zrIdazavekAlikAvacUriH samAtA[ : ] // // zrI Hua Reference. --- See No. 704.

Page #161
124 dazavaikAlika sUtra, cUlikAyugala tathA avacUri No. 723 "" Begins. (text) fol. 1a 37 Size.- -11 in. by 4 in. Extent. 18 folios; 21 lines to a page; 74 letters to a line. Description. Country paper very thin, brittle and grey; Jaina Devanagari characters with gears; small but clear, uniform and tolerably good hand-writing; borders ruled in four lines in black ink; edges of some of the foll. worn out; condition very fair; this Ms. contains the text along with the two Culikas and the commentary; but on that account, it is neither a fe nor at Ms.; red chalk and yellow pigment as well, used; the peculiarity of this Ms. is that it does not give the complete verse all at once but it takes it up part by part and explains it. Age. Pretty old. Author of the avacuri- Not mentioned. Subject. 22 19 Jaina Literature and Philosophy 33 - Ends-(text) fol. 16 (1st Culika) fol. 16 (2nd Culika) fol. 183 19 ( com.) dharmma utkRSTaM ahiMsA jIvadayA etc. The text, two Culikas and a small commentary explaining them in Sanskrit. [723. Dasavaikalikasutra, Culikayugala and avacuri 274. A. 1882-83. (f) etc. as in No. 704 etc., as in No. 704. etc., as in No. 704. ( 1st Culika ) fol. 17 icceva saMparisaa etc., up to tti bemi as in No. 704. tu etc. as in No. 704. maMgalaM / ahiMsA saMyamastapaH / tatra (2nd Culika) fol. 18 etc., up to fa af as in No. 704.

Page #162
724.] II. 4 Malasutras 125 Ends.-- (com.) fol. 18b istage surat lor afh ya para ad 118811 iti dvitIyA cUlA samAptA / / iti zrIdazavakAlikAvacUriM // chaM // cha / Ti mad THI TEST OF etc. Reference.- See No. 704. dazavaikAlikasUtra, cUlikAyugala tathA TabbA Dasavaikalikasutra, Culikayugala and tabba No. 724 197. 1871-72. Size.- 9} in. by 41 in. Extent.-- (text) 44 folios ; 6 to 7 lines to a page ; 41 letters to a line. >> -(com.) ,, ,, ; 12 ,,13 >> >> >> >> ; 57 >> >> >> >> Description.-- Country paper thin and white; Jaina Devanagari characters with arts; this is a ferrat Ms.; bold, legible and tolerably good hand-writing ; borders ruled in four lines in black ink ; fol. ra blank; so is the fol. 44"; some of the foll. have their edges worn out; condition very fair; this Ms. contains Dasavaikalikasutra, the two Culikas and their explanation in Gujarati; all complete. Age.-- Samvat 1666. Author of the tabba -- Upadhyaya Kanakasundara Gani, pupil of Vidyaratna Gani. Subject.-- The text and the Culikas as before. The explanation is almost throught in Gujarati ; only at times it is in Sanskrit; for such cases, see " begins" and "ends". Begins.- ( Dasavaikalikasutra) fol. I FART AA: 1! TFA A iz etc., as in No. 704. >> - ( Ist Culika ) TT etc., as in No. 704.

Page #163
[ 724. Jaina Literature and Philosophy Begins.-- ( 2nd Culika) cUliyaM tu paca (va) kkhAmi etc., as in No. 704 . -- ( tabba ) fol. b 126 35 " "3 -- * ( tabba ) fol. 428 anaMtarAdhyayane utpravrajitasya sthirIkaraNamuktaM / adhunA vicci (vitta (kta) caryocyate / etc. Ends. fol. 404 ubei bhikkhU apuNAgamaM gai tti bemi // cha // su (sa) bhikkhU adhyayanaM " 93 " praNamya zrImahAvIraM / surAsuranamaskRtaM / alentertari | karomi stabukopamaM / / 1 prathama maMgalAcaraNagAthA dharmo maMgalamutkRSTaM || dharma te utkRSTa maMgala jANivaM / te dharmanA triNi bheda chai / / te kima jIvadayA saMyama te iMdrInuM gopafai saptadazadhA etc. -- ( tabba ) fol. 404 cUlAdvayamArabhyate / bhikSuH kadAcit karmmavazAt sIdet / (a) tastasthirIkaraNaM kartavyaM ityAha / etc. -- ( 1st Culika ) fol. 424 jiNavayaNa mahiTTijjAsi tti beti (mi) (18 ) iti vAkyA nAma prathamacUlikA / ( 2nd Culika ) fol. 442 savvaduhANa mucaiti bemi // 16 // viva(vi)ktacaryA nAma dvitIyA cUlA sammattA / / -- ( tabba ) fol. 442 vizeSaI vyakta prakaTa yatInI caryA cAlavArUpa dvitIyA bIjI cUlA samAptA saMpUrNA jAtA graM. 82 a. 12 sarva graMthAgra TabbAnuM 1500 zloka a. 12 evaM sUtra Tabbu mIlane graM. 2200 a. 12. zrIvarajinasya paTTAbharaNazrIgotamagaNapati tatsahatIrthI zrIsudharmmasvAmin tadaMtevAsI zrIjaMbUpaTTe prabhavasvAmI tadanukrameNa vajrasvAmI tadaMtevAsI zrIcaMdrasUri / tadanukrameNa 'caitra'gacchAgacche zrIdhanezvarasUri yena zrIzi (za) va (tru) jayama (mA)hAtma ( tmyaM) kRtaM / tatpaTTe bhuvaneMdumarirabhavat / tatpaTTe zrIdevabhadrasUri suguru ( : ) yena 'tapA' birudaM kRtaM / tathAhi / jiNadattAe 'kharayara' | 'puNNima' muNicaMdasUriNo jAyA / 'pallavIyA' khADhArie / 'tavo' mayaM devabhaddAu // 1 // iti vacanAt / tatpaTTAMbarabhAskara' vRdha ( da ) tape 'tikhyAtaH zrIvijayacaMdrasUri (rI) sva(zvaro'bhUt / tatpaTTe zrIkSemakIrtigaNaH / yena kRtA zrI vR(a) hatkalpavRrti (ttiH) aSTacatvAriMzatsahasramitA zlokasaMkhyA / yaH zrI.

Page #164
725.1 Reference. -- See No. 704 . - kSema kIrtisUriNA jAvajjIva SaT vigayasya tyAga ( : ) kRtaH / tadanukrameNa zrIratnasiMhariH yenA (S)hmapAtasyAha pratibodhitaH // tasyAnvaye sAMpratavarttamAne zrIdevaratnasUrI (zva) rapaTTe zrIjayaratna sUrivijayarAjye mahopAdhyAyasyAnvaye upAdhyAyazrIvidyAratnaga NivinayaiH upAdhyAyazrIkanakasuMdaragaNibhiH to ( s) stakaH saMvat vikramArkAt rasarasaraseMdu ( 1666 ) vAmagatigaNanAt jJeyaH tatsaMvatsare poSamAsasite pakSe aSTamI ravivAre asva (zvi) nInakSatre saMpUrNeSa stabukaH zrIdazavaikAlikalaghuvRrtti (tti) vilokanAta / kiMcita guruparaMparayA kRto(s) yaM stabukaH / yadazuddhakaTa akSarArtha syAt / tadvibudhaiH zodhanIyo zaM (saM) zodhya zuddha kriyatAM // sUtragraMtha 700 // zubhaM bhavatuH // // 1 dharmopadeza ( dazakAlika sUtra ? ) vyAkhyA sahita No. 725 II. 4 Mulasutras Age. - Not quite modern. Author of the vyakhya. -- Not mentioned. Subject. 127 Dharmopadesa ( Dasavaikalikasutra ? ) with vyakhya Size.-- 81 in. by 47 in. Extent. --- 25 folios; 17 lines to a page ; 32 letters to a line. Description.-- Foreign paper with water marks Vigo etc.; thin, rough and white; Jaina Devanagari characters; small, clear and fair hand-writing; borders ruled in two lines and edges in one, in red ink ; red chalk used; yellow pigment, too, but rarely; fol. 25b blank; complete; condition very good. 1269. 1886-92. This Ms. starts with the first verse of Dasavaikalika and goes on elaborately explaining it. Several types of puja too, are described. The various types of dana are discussed.

Page #165
128 Jaina Literature and Philosophy [ 725. Some stories are also narrated herein. But it is difficult to say exactly what this work is. Begins. fol. ra ( text ) " // prathama kAvyamaMtra // OM hrIM hrIM hU~ zrI~ hrI~ kkI blU zrI OM hrI~ namaH / atha dvitIya kAvya maMtra: OM hrI~ klI~ hrIM namaH kumatinivAraNaM 2 ma maMgalamuka ahiMsA saMjamo tavo / devA vitaM namasaMti jassa dhamme sayA maNo // 1 // - ( com. ) fol. 1 dhammo maMgalamityAdyapadyaM vyAkhyAyate / iha jagati sarvakAryaprasAdhakaM mahAmaMgalaM zrIjinadharmo bhavati etc. fol. 24 sadanuSTAne viziSTatarakriyAkalApe yo (S) nurAgaH paramA prItiH sa dharmarAgaH iti gAthArthaH bhAvArthastvArogya dvijanidarzanAdavaseyaH taccedaM etc. Ends. -- fol. 25 niAmikaNaM cariyaM imassa AugAvippassa daDhavvayassa ThihavaM dhaneru imAyareha jahA dhuvaM siddhasiriM vareha 36 iti dharmopadeza // paM manasuSena svavAcanArthe // dazavaikAlikasUtracUlikAyugalAvacUrNi No. 726 Size.-- 1o++ in. by 4g in. Extent.-- 12 folios; 26 lines to a page ; 8o letters to a line. Description.-- Country paper very thin and greyish; Jaina Devanagari characters; very small, legible and good hand - writing; borders ruled in three lines in red ink; red chalk used; only the s of the text and those of the two Culikas are given ; complete : condition very good. DasavaikalikasutraCulikayugalavacurni Age.- Samvat 1492. Author.-- Not mentioned. Subject. A small commentary explaining Dasavaikalikasutra, the Culikas and a few gathas of the corresponding niryukti. two 711. 1892-95.

Page #166
726.1 Begins. fol. 14 OM namaH zrIpravacanAya / II. dazavekAlikasUtracUlikAyugalAvacUrNi No. 727 4 Malasatras ihArthataH zrIvIrakRtasya sUtrato gaNadharakRtasya dazavaikAlika ra vyAkhyA / tatra zAstrANyAdimadhyAMtamamaMgalabhAMji bhvNti| etc. Age.- Pretty old. Author. --- Not mentioned. Subject. Ends.fol. 12deg kimatra yuktamiti nivedite vicAraNA saMdhe kAlanhA sadoSAtprabhUtasatvAnAmidamevopakArakaM / atastiSThatvevaM sthApanA | 20 // iti dazavaikA - likAvacUrNiH / saM. 1492. Then in a different hand we have : 1700 graM0 129 Size.- ro++ in. by 44 in. Extent. - 21 folios; 19 lines to a page ; 56 letters to a line. Description.---- Country paper thin, smooth and grey ; Jaina Devanagari characters with gears; bold, clear and good handwriting; borders ruled in three lines in red ink; every side at least in the begining decorated with three small discs, one in the centre and one in each of the two margins; complete condition very good except that the edges of the first and the last foll. are slightly damaged. DasavaikalikasutraCulikayugalavacurni 1262. 1886-92. A small commentary in Sanskrit explaining the original text and the two Culikas. Begins. - fol. 1 dhammo dharma utkRSTaM maMgalaM bhavati / sa ca ahaM (hiM) sAsaMyamataporUpaH / tatra ahiMsA jIvadayA etc. Ends. fol. 21 vicAraNA cirakAlavijayabhAvi / idama'dhyayanamiti // 4 // atra zrIzayyaMbhavasUrikathAnakaM jJeyaM // cha // iti zrIdazavai kAlikA'vacUrNi rakSarArthagamanikA // cha // zubhaM bhavatu // cha // 1 The second Culika consists of 16 gathas. The gathas of the niryukti herein explained are numbered in continuation, hence we find this number here.

Page #167
130 darzavekAlikasUtracUlikAyugalAvacUri No. 728 Jaina Literature and Philosophy (1) pAkSikasUtrAvacUrNi (2) kSAmaNakAvacUrNi Size.- 1og in. by 4g in. Extent.-- 22 folios ; 20 lines to a page ; 65 letters to a line. Description.-- Country paper very thin and greyish; Jaina Devanagari characters; very small, clear, uniform and good hand-writing; borders ruled in two lines in black ink ; red chalk and yellow pigment used; foll. at times numbered in the right-hand margin; this Ms. contains the s of the text and those of Culikayugala; complete; condition on the whole tolerably good; for, only the right-hand corners and the edges of several foll. are worn out; this Ms. contains additional works as under : " DasavaikalikasutraCulikayugalavacuri foll. 14b (?) to 224 22a 22b [728. 1182 (a). 1884-87. " Author. Yasobhadra Suri, pupil of Sricandra seems to be the author. For, he has composed the last work mentioned here. Subject. A small commentary in Sanskrit on Dasavaikalikasutra and its two Culikas. Begins-- fol. ra N namaH sarvavide // jayati vijitAnyatejAH etc. up to cUDAmaNivaraH // 1 // Then we have : saMhitAdiSaDUvidhA vyAkhyA / durgatau prapatatamAtmAnaM dhArayatIti dharmaH etc. Ends. fol. 14deg iti zayyaM bhavenAlpAyumenamavetya mayedaM zAstraM niryUDhaM kimatra yuktamiti nivedite vicAraNA saMgho duHkha ( pa ) mAka ( kA ) la (da) -hAsada (do) SA (tU) prabhUtasattvAnAM (nA) midamevopakArakamatastiSThatvetaditi // 13 // iti zrIdazavaikAlikAvacUriH samAptA //

Page #168
729.1 II. 4 Malasatras 131 dazavaikAlikasUtracUlikAyugalAvacUri DasavaikalikasutraCalikayugalavacuri 712. 1892-95. No. 729 Size.- 11 in. by 4 in. Extent.- 31 folios; 15 lines to a page ; 56 letters to a line. Description.--- Country paper thin and whitish ; Jaina Devanagari characters with TAFIS; small, legible and good handwriting; borders ruled in two pairs of lines in black ink; the space between these pairs coloured red; foll. numbered in the right-hand margin only; unnumbered sides have a small disc in red colour, in the centre; the numbered, in each of the two margins, too; red chalk used; this Ms. gives the gates of the text and those of the two Culikas ; the commentary complete; condition very good; for, only the last fol. is slightly worm-eaten. Age. - Pretty old. Subject.--- Dasavaikalika surta, the two Culikas and the 4 gathas of the niryukti commented upon, in Sanskrit. Begins -- fol. 1deg TFA ANSEH TE JET ANG AT HHATTTT BIGAT ATAFT: 11 79 AT Haur etc. Ends. -- fol. 315 FEE Gfrio fararpol FT SETT ATTI TEATATA1 midamevopakArakaM / ati(ta)stiSThatvevaMbhUtA sthApanA // 20 // iti zrIdazaThe Ta Thig l etc.

Page #169
132 Jaina Literature and Philosophy 1730. THE THIRD MULASUTRA SaDAvazyakasUtra Sadavasyakasutra ( ESTEFEUET ) ( Sadavassayasutta ) No. 730 1174 (a). 1887-91. Size.- 99 in by 4 in. Extent.- 8 folios ; 14 lines to a page ; 46 letters to a line. Description.- Country paper tirin, tough and greyish; Jaina Deva nagari characters; small, legible and elegant hand-writing ; borders ruled in three lines mostly in red ink ; edges, in one; fol. ra blank except that a table of measurements etc. is written on it in Gujarati; red chalk used; complete so far as it goes; condition good. This Ms. contains the following additional works : (1) 91155 foll. 45 to 56 (2) Julare Tuttaa , sb, 75 (3) TIGHURTITION 76., 8a (4) 1992aland fol. ge (5) aSTamItapastuti (6) agraatiaftarala , 8a, 86 (incomplete ) (7) G HIATE Age.- Old Author.- A Ganadhara according to some. Sukhlal does not hold this view. He has explained his view in Hindi introduction to his edition of " Pancapratikramana" and its Hindi translation published by Atmananda Jaina Pustaka-Pracaraka Mandala, Agra in A. D. 1921. This view is challenged by Ramavijaya ( now styled as Ramacandra Suri) in his Gujarati work" FANTA FEAT ATATEATT " (pp. 1-67). Rb 1 This is a titlc as recorded in some Mss, and works.

Page #170
730.) II. 4 Malasdirds 133 The view that Ganadhara is the author of the Avasyakasutra is expressed in Gujarati in the introduction to "sfilarterasTEHTFAT" pt. I. This view is refuted by Sukhlal in a book-let " navakAramaMtra yA paMcaparameSThI ane Avazyaka HAUT TEFT (Tiga HC TIA )" published by Sri Jaina yuvaka sevasamaja, Ahmedabad, in Samvat 1983. Anandasagara Suri, in his introduction to his edition of Avasyakasutraniryukti and Malayagiri Suri's commentary says that Ganadhara is the author of the Avasykasutra, Subject. This is a mulasutra as stated in Keith's Catalogue. It deals with several sutras which are associated with six avasyakas!. So Sadavasyakasutra may be roughly defined as a collection of the sutras to be daily uttered twice, once in the morning and once in the evening, while performing the six essential duties (avasyakas) viz. ( 1 ) samayika, ( 2 ) caturvimsatistava, ( 3 ) (guru )vandana, (4) pratikramana, (5) kayotsarga and ( 6 ) pratyakhyana. The propriety of this order is discussed in Siddhacakra ( vol. IV, No. 9, pp. 201-202.) In this issue, it is explained why pratikramana is used as a synonym for a collection of the six avasyakas. Sadavasyakasutra given in this Ms. consists of a number of sutras. They are as under : As regards the synonyms of Avasyaka, its importance, its six divisions, and their explanation etc. in Gujarati sce my " Arhatadarsanadipika "pp. 822-829. 2. H. D. Velankar strikes a different note in lis work "A Descriptive Catalogue of Sauskata and Praksta Mss. in the library of B, B. R. A.S." (vols, III-IV). For, there (p. 397), he mentions as one of the six avasyakas, caityavandaga instead of caturvimsatistava. Moreover he mentions the six avasyakas in the fol. lowing order: Caityavandana, Kayotsarga, Guruvandana, Samavika, Pratikramana and Pratyakhyana. He supports this statament on p. 397 by saying: "This is the order in which they are given in the Mss." Furtlermore, on p. 399 he identifies Vandittu sutra with Pratikranianasutra.

Page #171
134 Jaina Literature and Philosophy 1730. I) navakAramaMtra (namaskAramantra x or namaskArasUtra*). 12) jagaciMtAmaNi (prabodhacaityavandana*) (3) jaMkiMci (tIrthavandanamUtra) (4) namutthaNa (zakrastava or praNipAtadaNDaka'). (5) jAvaMti ceiyAiM (sarvacaityavandana*). (6) jAvaMta ke vi sAhU (sarvasAdhuvandana* ). (7) ughasaggaharathotta (upasargaharastotra x or pArzvanAthastava). (8) jaya vIyarAya (praNidhAnasUtra* ). iriyAvahiya ( IryApathikIsUtra x or airyApathikIsUtra'). (10) tassa uttarI (uttarIkaraNasUtra* ). (11) annAtha (kAyotsargasUtra). (12) logassa (nAmastava or caturviMzatistaba ). (13) savaloeM arihaMtaceiyANaM (caityastava). (14) pukakharavara (zrutastava ). (15) siddhANaM buddhANaM (siddhastava ). (16) saMsAradAvAnalastuti ( vIrastutisUtra*). (17) suguruvaMdanasUtra (dvAdazAvatarvandanakasUtra* or bandanakasUtra ). (18) devasia AlouM (devasikAlocanAsUtra ). (19) saMthArA oTTiNakI if same as rAtrikAticAra*. (20) abbhuTrio (gurukSAmaNAsUtra* or kSAmaNAsUtra ). (21) karomi bhaMte (sAmAyikasUtra). (22) jaya mahAyasa. (23) Ayariya uvajjhAe (AcAryAdikakSAmaNaka* ). (24) zrutadevatAstuti. (25) kSetradevatAstuti. (26) sirithaMbhaNayapAsanAhathui. (27) sAmAyikapauSadhapAraNagAthA'. * This cross indicates a Sanskrit name ( equivalent) for the corresponding Prakrit one. ... This name as well as all other names marked with an asterisk, have been given from the edition of "sAdhusAdhvIdevisakarAtrikapAkSikacAturmAsikamAMvatsarika pratikramaNAni prakIrNakavidhisaMyutAni SaDAvazyakasUtrANa". These names have been used by the editor whose name though not mentioned, is Anandasagara Suri as can be surmised. This edition has been published by Sresthi Rsabhadevaji Kesa arimalaji Jaina Svetambara Sarnstha, in Samvat 1992. This name is taken from Lalitavistara. It is mentioned by Hemacandra Suri, too, in his commentary (p. 2164) on Yogasastra ( III, v. 124). 2 This name is given in the svopajna vrtti (p. 2134) ol Yogasastra (III, V. 124). In the anukramanika of this work we have this very name (kAyotsargamUtra). 3 Each of these 27 sutras cxcept the 19th is scparately treated, while describing certain Mss. Scc infra.

Page #172
730.] III. 4 Mulasutras All these 27 sutras are not be found in the Avasyakasutra (Avassayasutta ). Furthermore, some of the sutras occurring in the Avasyakasutra are not given here. In order that this remark may be properly grasped, I give below a list of the sutras which appear to constitute the Avasyakasutra-the sutras as noted by Haribhadra Suri in his Sisyahita, a commentary on Avasyakasutra and its niryukti : (I) karomamaMte P. 454. (2) ( 3 ) ( 4 ) (5) ( 8 ) ( 9 ) PP. 4943, 501b, 507b and 510a. ( 6 ) cattArisaraNasUtra P. 5714. (7) ( 11 ) ( 12 ) bandanakasUtra p. 5464 and 546b. (13) ( 14 ) ( 15 ) ( 16 ) cattAri maMgalaM sUtra p. 5690. cattAriloguttamAsUtra p. 5702. icchAmi paDikkamiDaM jo me devasio0 (pratikramaNasUtra ) p. 571. iriyAvahiyasUtra ( gamanAticArapratikramaNa ) p. 5734. icchAmi paDikkamiuM pagAma0 ( zramaNasUtra ) PP. 5742, 5754, 5766, 577a, 579a, 611b, 615b, 644, 655a, 725a, 7282, 731a, 760a, 7612, 761b, 762", 762 and 763". ( 10 ) icchAmi ThAuM kAussaggaM jo me devasio aiAro kao 0 P. 778b. tassa uttarI p. 7792. annattha P. 7794. savaloe arihaMta ceiANaM p. 786 pukharavara p. 7884. siddhANaM buddhANaM p. 7898. icchAmi khamAsamaNo ! uvaDiomi abhitara pakikhaaM khAmeuM panarasa divasANaM p. 7922. pAkSikakSAmaNAsUtra 2 p. 7932 and 793. 135 ( 17 ) ( 18 ) samyaktvAlApaka sAticAra p. 8112. For their 1 These sutras constitute what are known as " Pratikramanasutras. name, style, source etc. see my article " pratikramaNasUtrAnuM paryAlocana " published in an issue of the " Jain" dated 23rd February 1936. 2 This sutra is counted as four sutras which are respectively referred to as citiyakhAmaNAmutta, tiiyakhAmaNAsutta, cautthakhAmaNA sutta and paMcamakhAmaNAsuna as the previous sutra here numbered as 16 is there looked upon as paDhamavANAsuta,

Page #173
136 Jaina Literature and Philosoply 1730. ( 19 ) prathama vrata (sthUlaprANAtipAtaviramaNa) sAticAra p. 818 and 818b. (20) dvitIya ,, (sthUlamRSAvAdaviramaNa) , p. 820". ( 21 ) tRtIya ,, (sthUlAdattAdAnaviramaNa) , p. 822.. ( 22 ) caturtha ,, (sthUlAbrahmaviramaNa) ,, p. 823deg and 823. ( 23 ) pazcama , (sthUlaparigrahaparimANa) p. 8250. (24) SaSTha , (dikaparimANa) , p. 8274. ( 25 ) saptama ,, (bhogopabhogaparimANa) , p. 8284. (a) upabhogAdiparimANa sAticAra p. 8294. (b) karmAdAna p. 8291. ( 26 ) aSTama vrata (anarthadaNDaviramaNa ) sAticAra p. 830. ( 27 ) navama ,, (sAmAyikatrata) , p. 831". (28) dazama ,, (dezAvakAzika) , p. 834. (22) ekAdaza,, (pauSadhopavAsa) , p. 835". ( 30 ) dvAdaza ,, (atithisaMvibhAga) ,, p. 837'. (31) saMlekhanAvicAra pp. 838" and 839. (32) namaskArasahita pratyAkhyAna P. 849". (33) pauruSIpratyAkhyAna p. 8520. (34) ekAzanapratyAkhyAna p. 8530. (35) nirvikRtikapratyAkhyAna p. 854". Out of these Nos. 2, 14 and 15 are metrical compositions containing 7, 4 and 5 verses respectively. Nos. 9 and 27 have 2 and 3 verses respectively ; the remaining portion is in prose. It may be mentioned en passant that the 35 sutras noted above do not belong to one and the same adhyayana I Anandasagara Suri in his edition of "nandyAdigAthAdyakArI iyato viSayAnukamaH" (Agarr.odaya Samiti Series, No. 55) has mentioned the sutras noted by Haribhadra Suri. There he has given the serial number for these sutras from 1 to 54. My number (2) is not counted by him. No. 2 is counted in sutragathi. He has numbered Sramanasutra as Nos. 8 to 23. Nos. II and 12 of mine are considered as one by him. No. 17 is counted as four numbers ( 32 to 35). This will explain why my number comes to 35 and his as 54. It may added that it appears that really speaking he ouglit not to have given separate sutrankas for the paras of Sramanasutra.

Page #174
730.] III. 4 Malasatras 137 of Avasyakasutra'. That is to say ( 1 ) belongs to Samayikadhyayana, ( 2 ) to Caturvimsatistavadhyayana, (3) to Vandanadhyayana, (4) to (9) to Pratikramanadhyayana, ( 10 ) to ( 18 ) to Kayotsargadhyayana and ( 19 ) to ( 35 ) to Pratyakhyanadhyayana. Vacaka Umasvati in his bhasya ( p. 90) on Tattvarthadhigamasutra (I. 20) has noted ( 1 ) Samayika, ( 2 ) Caturvimsatistava, (3) Vandana, (4) Pratikramana, (5) Kayavyutsarga and (6) Pratyakhyana as some of the varieties of angabahyasrutajnana. Begins.-- fol. I' namo arihaMtANaM etc. up to havaDa maMgalaM. Then we have : 8 saM. 8 59 guru 7 laghu 61 evaM 68 jayau sAmI risaha 'settuMji' etc. Ends.---- fol. 4 yAsAM kSetragatAH saMtaH sAdhavaH zrAvakAdaya jinAjJAM sAdhayaMtastA rakSatu kSetradevatA siri thaMbhaNaya TTI(TTi )yapAsasAmiNo sesatitthasAmINa titthasu(sa )ma(munnaya( i )kAraNaM surAsurANaM ca savesiM 1 Then we have the 2nd verse'. Then again we have five verses, the last ( 5th ) being as under :-: sAmAiyaposahasaMThiyassa jIvassa jAi jau( jo ) kaalo| so saphalo bodhavvo seso saMsAraphalaheU 57 Reference.-- Avazyaka is mentioned in Hemacandra Suri's laghuvrtti (p. 51 ) on his own work Siddhahaima (II. 1. 33 ) as under :___ "uddiSTametadadhyayanamatho enadanujAnIta, etakaM sAdhumAvazyakamadhyApaya atho enameva sUtrANi / " ___ It is also mentioned in this lagbuurthi ( p. 73) on Siddhahaima ( II. 2. 43 ) in the following line : "mAsena mAsAbhyAM mAsairvA AvazyakamadhItam / " 1 This work consists of sis adhyayanas so it is called Adhvayanasacka and Adhyayanasatkavarga as well. 2 For this see p. 147. 3 This occurs on p. 8 of the Appendis to Sukhlat's edition ot Pancapratikran mana. referred to on p. 132.

Page #175
138 Jaina Literature and Philosophy 1 730. I do not know if there is any printed work which contains nothing else but the sutras given in this Ms. No. 730. Almost all the sutras given here are printed with some more along with their explanation in Gujarati in the edition of Sri-Pratikarmanasutra published by Sravaka Bhimasimha Manaka in a. D. 1888. This edition contains additional matter such as Fakhruts and TrangHERT. Practically all the sutras given in this Ms. are also printed in the edition named as paraugaano and published by Sri Jaina Sreyaskara Mandala, Mhesana, in Samvat 1971. This edition contains chaya, sabdartha, Gujarati translation etc. Sukhlal's edition noted on p. 132 may be also consulted. The 27 sutras noted on p. 134 are mostly to be found in several other editions containing only two Pratikramanasutras. They occur in Sadavasyakasutrani noted on p. 134. Some of the sutras occur in Hemacandra Suri's commentary on his own work Yogasastra, in Vardhamana Suri's Acaradinakara, in Manavijaya's svopajna commentary on Dharmasamgraha, in the edition containing Lalitavistara and in the edition containing Vandaruvstti. Out of these, the sutras commented upon in Lalitavistara and Vandaruvstti are noted in the description of these very works which are included in this Part III. So, here I shall first of all mention the 23 sutras commented upon in Yogasastra and 29 in Dharmasamgraha, the two works in cluded in Vol. XVIII under "Darsanika literature ", and then 31 noted and explained in Acaradinakara. The commentary on Yogasastra ( Prakasa III ) contains the following works : Page-No'. (1) tufatearea with vyakhya 2138 to 214* (2) A 39 >> 2149 >> 2146 (3) 3762* > > 214 ,,, 215b 1 The page--number given here belongs to the edition of Yogasastra and its svopajna commentary, published by Sri Jaina dharma prasaraka Sabha, Bahvnagar, * This sign is here used to point out that the sutra under question is split up into parts, while being commented upon

Page #176
730. ] ( 4 ) namotthu NaM * ( thayapADha ) arihaMtaceiyANaM * III. 4 Malasutras (5) ( 6 ) caturviMzatistava (7) zrutastava * (8) siddhastava * ( 9 ) ( 10 ) suguruvandanasUtra ( 11 ) daivasikAlocanAsUtra ( 12 ) savvassa vi jaya bIyarAya with vyakhya (19) AcAmAmlapratyAkhyAna ( 20 ) abhaktArthapratyAkhyAna (21) pAnakAkArasUtra ( 22 ) divasaccaramabhavacarama pratyAkhyAna ( 23 ) vikRtipratyAkhyAna " (1 ) IryApathikIsUtra' (2) tassa uttarI (3) annattha * 93 "" 21 (13) gurukSAmaNAsUtra * ( 14 ) namaskArasahita pratyAkhyAna, ( 15 ) pauruSIpratyAkhyAna ( 16 ) pUrvArdhapratyAkhyAna "" 31 "2 "9 ( 17 ) ekAzanapratyAkhyAna (18) ekasthAnapratyAkhyAnapratIka,, "" "" 13 19 " 13 27 39 " 33 " " "" " " "2 39 12 12 "" "" "" 39 "3 " " "" rd Page-No. 216b to 2232 2232 224b 228b 2302 2332 2376 2442 245* 245b 252b 2526 253 2532 254a 2546 2552 255* 2556 2562 " "" 35 "" "1 29 " "" " 19 17 23 " See the corresponding foot-note on p. 138. 1 These are mostly given in parts, while being commented upon. 224" 228a 230 233 In Upadhyaya Manavijaya's commentary ( pt. I. ) on his own work Dharmasamgraha, we have the following sutras 1 with their explanation in Sanskrit :-- Page-No. 142a to 143a 1442 1446 144b 145a 139 2342 2402 2452 2456 2460 253* 253b 2542 3 2 This page-number refers to the edition published in D. L. J. P. Fund Series as No. 26, in A. D. 1915. 3 This is the name given by the author himself. 4 Some portion of this sutra is not mentioned.

Page #177
140 Jaina Literature and Philosophy 1730. Page-No. 1466 to 1530 153", I540 1558 , 1582 158 ,, 160 1603 ,, 163deg 163 1626 " 164 1746 , 1800 174 181a 1813 , 1824 (4) namutthu NaM (5) arihaMtaceiyANa (6) caturvizatistava (7) zrutastava (8) siddhastava (9) vaiyAvRttyakarasUtra (10) jaya vIyarAya (II) suguruvandanasUtra (12) savvassa vi (13) gurukSAmaNAsUtra (14) namaskArasahitapratyAkhyAna (navakArasI) (15) pauruSIpratyAkhyAna (16) pUrvArddhapratyAkhyAna (17) ekAzanapratyAkhyAna (18) AcAmAmlapratyAkhyAna (19) abhaktArthapratyAkhyAna (20) pAnakAkAramUtra (21) divasacaramabhavacaramapratyAkhyAna (22) vikRtipratyAkhyAna (23) vaMdittusUtra (24) Ayariya uvajjhAe (25) zrutadevatAstuti (26) kSetradevatAstuti 184 186 1874 ,, 1870 1870 188 , 1880 1880 189 1894 ,, 189 189deg 2232,, 234 234 , 235 235 235 1 "This is as under: "pANassa levADeNa vA alevADeNa vA accheNa vA bahaleNa vA sasittheNa vA asityeNa vA vosirai." 2 It runs as under : "suyadevayA bhagavaI, nANAvaraNIyakammasaMghAyaM tesiM khaveu sayaya, jesiM suasAyare bhattI // 1 // " 3 This is as follows :--- "jIse khitte mAha, dasaNanANehiM caraNasahiehiM / sAhaMti mukkhamaggaM sA devI harau duriaaii|| 1 // "

Page #178
730.] II 1.4 Mulasutras 141 ___Pag: --No. (27) vardhamAnastuti' 255 ) 235" (28) vizAlalocana 235 (29) varakanaka 235 ,, 2360 __ In the 38th utiayn : chapter ) of Acaradinakara we have Avasyakavidhi. This chapter begins with the enumeration of the six types of avasyaka and the explanation of samayika. The following 31 sutras alorig with their Sanskrit explanation are given in this work : Page-No. 261 254 with com. 2674 2684 2670 268a 2680 2680 TaTa 2690 ( 1 ) sarvaviratisAmAyikanatra (2) dezaviratisAmAyikatra (3) navakAramaMtra (4) zakrastava (G) caturvizatistava (6) arhaccaityastava (7) zrutastava (8) siddhastava* (9) vaiyAvRttyakarasUtra ( 10 ) jAvaMti ceiyAI (II) jAvaMti ke vi sAha ( 12 ) jaya vIyarAya (13) suguruvandanasUtra' (14) airyApathikIsUtra* 269b , 271 , 2712 " " ,, ,, " , , ,, , 2710 271b 273 ,, 2773 2774 ,, 278. 1 This is the name given by the author. It is otherwise known as "namo'stu vardhamAnAya". the words with which it begins. 2 This page-number is given from the printed edition published by Pandit K. O. Khamgamwala, Bombay, in A. D. 1923. This sutra is styled here as Dandaka and is explained on pp. 261-263a. 4 This is explained on p. 2634. It is stvled as zrAddhasAmAyikadaNDaka onp 3050 5 This sutra is explained on pp. 2648 and 265" This very sutra is again given on p. 3750 * See the corresponding toot-note on p. 138. 6-9 These are respectively styled as Caitvasmarana, Sadhusmarana, Bhagavatprarthana and Vandanasutra.

Page #179
142 Jaina Literature and Philosophy (15) tassa uttarI (16) atIcArAlocana' ( 17 ) yatirAtrikAticAra ( 18 ) sayaNAsayaNa' ( 19 ) aticArASTaka* ( 20 ) gurukSAmaNA' 21 ) Ayariya uvjjhaaye| ( 22 ) pAkSikAdikSAmaNa * ( 23 ) zramaNasUtra' (24) pAkSikasUtra * (25 ) baMdisUtra' * with "" 31 "" "" "" "" 93 37 "" "" ( 26 ) annattha ( 27 ) dazavidhAddhApratyAkhyAna (28) bhayavaM dasaNNabho (77 verses + a line in prose),, "" "" wr 39 y, I This slightly differs from daivasikAlocanasUtra. 2 This is only one gatha as under : 66 com. 278a rw "" 39 12 "" "" 33 "" "" "" "" dw 23 29 33 Page-No. "" dw 279b "" 280a 28rb "" 282a 283b 294* 305b 311a 313a to 2796 22 .. 22 "" 13 "" 3195 ( 29 ) varakanaka 3242 ( 30 ) atIcAragAthASTaka 3256 ( 31 ) dazavidhapratyAkhyAna 326a 331a 331b The three sutras viz. Logassa, Suguruvandanasutra and Karemi bhante are printed in Roman characters along with the German translation in "Ubersicht uber die AvasyakaLiteratur " 8 published by Walther Schubring in A. D. 1934. 3 "" .. dr 1730. "" saNArAyaNNapaNe ve ( ce ) iya je (jar3a) si ( se )jna kAya uccAre / samabhAvaNaguttI vitahArakaraNe a aiArA || This is almost the same as 1498th gatha of Avasyakasutraniryukti. 3-4 These are styled as . and in respectively. 280 281b 282a 282b 294 305b For Mss. styled as Sadavasyaka see Limbdi Catalogue Nos. 2660-2663 and 2666-2671. Out of them, Nos. 2661 311a 311b 3176 5-6 These are respectively styled as yatipratikramaNasUtra and zraddhapratikramaNasUtra. 7 Out of these, the first four verses are practically the same as those given on pp. 7-8 of the ppendix to Pancapratikramana (Sukhlal's edition). 8 This is No. 4 of the series known as "Alt und Neu-Indische Studien ".

Page #180
730.) III. 4 Malasatras 143 2663 contain anonymous balavabodha, too. Nos. 26662671 contain tabba. Therein No. 2667 has a tabba by Samaracandra and No. 2669, a tabba by Jinavijaya. For description of Mss. styled as Salavasyakasutra see B. B. R. A. S. vols. III-IV, pp. 397-399'. In this Catalogue Nos. 1535 and 1536 given on p. 400 contain over and above Sadavasyakasutra, Merusundara's balavabodha and an earlier but anonymous balavabodha respectively. In Keith's Catalogue, No. 7495 gives the description of a Ms. styled as Sadavasyakasutra and a balavabodha in bhasa (Gujarati). For other details see Weber II, p. 739sn., Indische Studien vol. XVII, pp. 50-76, Indian Antiquary vol. XXI, D. 329ff, Leumann's "Ueber die Avacyaka-Literature" (Actes du X* Congress international des Orientalistes IIdeg C, parte section I, p. 125, Leide, 1895, E. Leumann's " Die Avasyaka-Erzahlungen", Leipzig, 1897, " Essai de Bibliographie Jaina " Nos. 58 and 374, G. O. Series vol. XXI, p. 24, Winternitz, Geschichte Vol. II (p. 315), A History of Indian Literature vol. II, pp. 429, 470, 476n., 481, 485, 489n., 536, 575 and 589, Z. D. M. G. vol. XXXIV ( Jacobi's article on Kalakacarya-katha) and vol. XXXVII ( Leumann's article on Kalikacarya-katha) and Die Lehre der Jainas (p. 81 ). On pp. 397-399 we have in Devanagari characters the following sutras: -- (1) Navakaramantra, ( 2 ) Pranipatasutra, (3) Iriyavahi (this is not separated from the former, that is a slip), (4) Tassa uttari, 05 ) Anpattha (this, too is not, separated from the former ), (6) Sakrastava, ( 7) Arihantacaivanam styled as Caityastavadandaka, (8) Caturvimsatistava, (9) Srutastva also stvled as Siddhantastava, (10) Siddhastava, ( 11 ) Java viyarava, (12) Suguruvandanasutra styled as Guruvandana, (13) Daivasikalocanasutra without any specific name, (14) Savvassa vi, ( 15 ) Abbhutthio (this is not separated from the former once more a slip ), (16) Samayikasutra styled as Samayika, (17) Vandittunutra also styled as Pratikramapasutra, and ( 18.28) eleven Pratyakhyanastras.

Page #181
144 Jaina Literature and Philosophy ( 731. SaDAvazyakasUtra Sadavasya kasutra 1131. No. 731 1891-95. Size.-- 78 in. by 61 in. Extent.--- 17 folios; 13 lines to a page ; 17 letters to a line. Description.- Foreign paper with an elephant-brand as the water mark : Jaina Devanagari characters ; quite bold, big, legible and good hand-writing; borders ruled in three lines in red ink, whereas edges singly; numbers for foll. entered twice as usual; foll. 19 and 170 blank; complete; the ending portion includes Snatasyastuti, too, which is also treated as a separate work in some Mss.; condition very good. Age. - Samvat 1946. Author.- More than one Jaina saint.. For instance, it is said that Snatasyastuti is a composition of Balacandra, a pupil of Kalikalasarvajna Hemacandra Suri. Subject. - This work mostly in Prakrit consists of sutras some of which are not to be found in the previous work', and thus it differs from it. Begins.-- fol. 15 FA 1 STE PIATT AA: 1 namo arihaMtANaM / namo siddhANaM / namo AyariyANaM / namo uvajjhAyANaM / namo loe sabbasAhUNaM / eso paMcanamukkAroM(ro) savvapAvappaNAsaNauM( nno)| maMgalANaM ca savesa(siM) paDhamaM havaI(i) maMgalaM // (TTTTTA CATHAUT etc. Ends.-fol. 162 iccAyA? i) mahAsaIo jayaMtu akalaMkasIlaliAo / 3755 1a FAT(T) FF TOT)34(ET) fa55(E)STU AISI zia frate () ! For instance, the last sutras viz. Bharahesarasajjhaya ( styled as silavadadigunasmaranasutra in Sadavasvakasutrani ) and Snatasvastui are not there. 2 This sutra is usually known as l'rapipatasutra. In the contents of "Sadavasyakasutrani ". it is styled as "Sthobhavandanastia" and "Khamasamana" as well.

Page #182
732.1 Reference. III. 4 Malasntras All the sutras given here seem to be published in one or the other editions of Pancapratikramanasutras mentioned in No. 730. SaDAvazyaka sUtra svAtasyApratimasya 'meru' zikhare zacyA (cyA) vibho (:) zaizave / rUpAlokanavismayAhRtarasabhrAMtyA bhramaccakSuSA / unmRSTaM nayanaprabhAdhavalitaM kSIrodakAzaMkayA / vaktraM yasya punaH punaH sa jayati zrIvarddhamAno jinaH // 1 // haMsAzA (sA) hatapadmareNukapizakSIrArNavAMbhobhRtaiH / kuMbhairapsarasAM payodharabharaprasparddhibhiH kAMcanaiH / yeSAM 'maMdara' ratnazailazikhare janmAbhiSekaH kRtaH / sarvaiH sarvasurAsurezvaragaNaisteSAM taM (na) to'haM kramAn // 2 // arhakaprasUtaM gaNadhararacitaM dvAdazAMgaM vizAlaM / citraM bahvarthayuktaM munigaNavRSabhairddhAritaM buddhimadbhiH / mokSAgradvAra bhUtaM vratacaraNaphalaM jJeyabhAvapradIpaM / bhaktyA nityaM prapadye zrutamahamakhilaM sarvalokaikasAraM // 3 // niSpaMkavyomani (nIla (dyuti) malasadRzaM bAlacaMdrAbhadaMSTraM / mattaM ghaMTAraveNa prasRtamadajalaM pUrataM samaMtAt / ArUDho divyanAgaM vicarati gagane kAmadaH kAmarUpI / kSaM (kSaH) sarvAnubhUti (ti) di (di) zatu mama sadA sarvakAryeSu siddhiM // 4 // iti zrISaDAvazyakaM saMpUrNa / saMvat 1946 suMdaralAlakA / 145 No. 732 Size.-- 8 in. by 42 in. Extent.- 27 folios; 7 lines to a page ; 20 letters to a line. Sa davasyakasutra 871. 1892-95. Description. - Country paper somewhat thick, rough and white; Jaina Devanagari characters; quite bold, very big, perfectly

Page #183
146 Jaina Literature and Philosophy (732. legible and elegant hand-writing: borders ruled in two lines in crimson ink, whereas edges, in one line; fol. 1* marked with diagrams; white paste used instead of the yellow pigment; complete so far as it goes; condition very good. Age.- Samvat 183 ( 1835?). Begins.-- fol. 163 79: lo sfiatfeqraflorary TA: 1 TRT SPENUT etc. as in No. 731. Ends.-- 26* TIE HETTE 3 etc., up to sgoi ll as in No. 731. This is followed by a line as under : #863(?) a stref ara crear pafacer N. B.-- For further particulars see Nos. 730 and 731. SaDAvazyakasUtra Sadavasyakasutra 242. No. 733 1871-72. Size.- 95 in. by 41 in. Extent.- 6 folios ; 12 lines to a page ; 31 letters to a line. Description.- Country paper thin and white; Jaina Devanagari characters with quaTITS; bold, big, quite clear and good hand-writing ; foll. r* and 60 blank; borders as well as the edges ruled in two lines in red ink; red chalk used; edges of the last two foll. slightly damaged ; condition good; complete so far as it goes. Age.-- Pretty old. Author.-Not mentioned. Subject.-- A collection of sutras connected with the six avasyakas. Begins.- fol. 1 CAT steari etc. as in No. 731.

Page #184
733.] III. 4 Malasutras Ends. fol. 6(c) siri'thaMbhaNa' dviyapAsasAmiNo / sesatitthasAmINaM / titthasamunnakAraNaM surAsurANaM ca savvesiM // 1 // esamahaM saraNatthaM kAusaggaM karemi sattIe / tI guNasa (su) dviya (ssa) saMghasya samunnanimittaM // 2 // karomi kAueri iti zrISaDAvazyaka sUtraM / Reference. - See No. 730-732. These two verses are given on p. 11 (Appendix) of the edition of 11 * Pancapratikramana published with Hindi translation from Agra, in A. D. 1921, 147

Page #185
148 namaskAramantra ( navakAra maMtra ) No. 734 a line. Description. Jaina Literature and Philosophy Size.9 in. by 3 in. Extent. 43-2-1-1-1-2-36 folios; 9 lines to a page; 35 letters to (5) jAvaMti ceiyAI (6) jAvaMta ke vi sAhU ( 7 ) ( 8 ) uvasaggaharathotta ( 9 ) jaya vIyarAya (10) praNipAtasUtra Country paper somewhat thick, rough and greyish; Jaina Devanagari characters; big, fairly legible, uniform and good hand-writing; borders ruled in four lines in black ink; red chalk used; foll. numbered fn the right-hand margin just in a corner; each and every fol. worm-eaten in several places; so, in a few cases, the numbering is gone; condition fair; red chalk used: there is some space kept blank in the centre of the numbered and the unnumbered sides as well; yellew pigment used while making corrections fol. 1a blank; complete; this work ends on fol. 1; this Ms. contains in addition the following works:(1) jayau sAmiu' ( 2 ) jaM kiMci (3) varakanaka ( 4 ) : fol. 16 namutthu NaM ( zakrastava ) namo'rhat ( parameSThinamaskAra ) (11) IryApathikIsUtra (12) tassa uttarI ( 13 ) annattha 39 95 17 Namaskaramantra (Navakaramantra) 99 pttttaa ; fol. # 39 23 2a 2222 222 2 foll. 2 to 3a 2a to 2b 2b 2b 2m 1270 (1). 1887-91. [ 734. 3a 3b 3a to 3b vs va 1 This is practically same as without the first.gatha. 2 This is the name given by Sukhlal in his edition of Pancapratikramana re ferred to on p. 132.

Page #186
734.] ( 14 ) logassa (nAmastava ) ( 15 ) caityastava ( 16 ) annattha ( 17 ) pukkharavara ( zrutastava ) ( 18 ) suyassa bhagavao ( 19 ) caityastava ( 20 ) siddhANaM buddhANaM (siddhastava ) ( 21 ) veyAvaJcagarANaM ( vaiyAvRttyakarasUtra ) III. 4 Mulasutras ( 22 ) annattha ( 23 ) pArzvasta ( 24 ) paJcadevastuti (kallANakaMdaMstuti) ( 25 ) AdinAthastuti (26) neminAthastuti ( 27 ) saMsAradAvAnalastuti (28) suguruvandanasUtra ( 29 ) devasiya AlouM (AlocanasUtra ) ( 30 ) savvAssa vi ( sarvasyApi ) ( 31 ) abbhuTTio (gurukSAmaNA sUtra ) ( 32 ) aDDhAijje ( 33 ) vaMdita sUtra (34) lUNapANIvidhi ( 35 ) ArAtrika ( 36 ) maGgalapradIpa (37) kusumAJjali ( 38 ) mahAvarikalaza ( 39 ) abhiSeka ( 40 ) mahAvIravRddhakalaza (41) dhUmAvalI ( 42 ) devakAba (43) guruchappA ( 44 ) namiUNa ( bhayaharastotra ) ( 45 ) tijayapahutta ( saptatizatastotra ) (46) bRhacchAntistotra foll. 30 to 44 fol. 4a 29 4b 4b foll. 4b to 54 fol. 5a 5a 39 " 33 "1 " 37 foll. 5 to 6a " fol. 6a 27 79 foll. 6b fol. 7a yb 7b 39 4a to 4b 4b 22 23 25 tion in 77 5a to 5b 23 5b 4% foll. 12b 29 10a to 10b foll. 11 (?),, 124 fol. 12a 64 to 6b ryb 27 14a 13a fol. 14a 14b foll. 14b ,, 16b 16b 17b 17b 19a 22b 19a 22b ? 26a 12a to 12b 13a 13 25 "1 33 " 22 22 33 " 29 7a 7b 99 23b 26a 28a 149

Page #187
150 Jaina Literature and Philosophy [ 734. ( 47 ) Fytalat fol. 28a to 286 (48) TITEITEN foll. 286 , 315 ( 49 ) H TARFAITE fol. 316; foll. 342 to 35b (50) FATFART foll. 35b to 39a (51 ) waar ,,, 392 ,, 406 ( 52 ) AFFITTO ,, 41 , 422 (53) Pratt ,, 422 ., 436 Out of these sutras, 1-33 may be said to be constituting what is, roughly speaking, known as Salavasyakasutra. Foll. 8, 9, 11, 24, 25, 32 and 33 are missing ; so the corresponding works are incomplete. Age.- Old. Aurhor.-- Not mentioned. Subject.-- This entire work in Prakrit deals with obeisance to the five Parameshins and its fruit. It is styled as Mahasrutaskandha. Each of its first five padas such as FAT TEaroi etc. is looked upon as an adhyayana. The portion following these five adhyayanas" is called culika, and it shows the importance of the five adhyayanas. Some look upon this culika as redundant. This view is refuted in "Siddhacak ra" ( vol. IV, No. 3, p. 67). There it is remarked that in that case, the first and the last verses of Logassa, and the verse beginning with ISHTT which forms a part and parcel of Pukkharavaradivaddhe should be discarded. It is further observed that the last pada of this Mahasrutaskandha occurs in Mahanisithasutra. So those who substitute er for at are not justified in doing so. An additional criticism is made as under : | Just as there is in Avasyakasutraniryukti niksepa and sutrasparsikaniryukti respectively in the beginning and end of every dhyayana, so we have beginning and end for these five padas (adhyayanas). That is why this entire work (Pancamangala ) is designated as Mahasrutaskandha. Vide Siddhacakra" vol. IV, No. 3, p. 67.

Page #188
735.) III. 4. Malasatras 151 It is true that there are five padas in the beginning of Bhagavatisutra ; but, on that account, the rest cannot be said to be interpolated. For, those who look upon only the first five padas as genuine ought nou to have discarded FAT jate foaig as it is tantamount to a khandana of a sutra. Begins.- fol. 10 & 11 AAT HOTTTT: 11 namo arhtaannN| namo siddhaannN| namo aayriyaann| namo uvjjhaayaannN| namo loe / svvsaahnnN| Ends.-fol. 1" TheHari 17 (a)ma (CO)ATTEOTTI maMgalANaM ca / savvesiM paDhamo(maM) havai maMgalaM // 1 // Reference.-- Published. It is also edited by me with Sanskrit rendering and Gujarati translation. See "The third Kiranavali" ( Arhatajivanajyoti ) pp. 49-50. Namaskaramantra is given by way of quotation in the svopajna commentary (p. 371 ) on Yogasastra ( VIII, 34). For other details see No. 730. namaskAramantra Namaskaramantra No. 735 1269 (1) 1887-91. Size.-- 12 in. by 48 in. Extent.-- 76 folios ; 14 to 15 lines to a page ; s2 to 58 letters to a line. Description.- Country paper thin, durable and grey ; Jaina Deva nagari characters with frequent qehETS ; bold, legible, uniform, neither too big nor too small and elegant handwriting ; borders ruled in two lines in black ink; the interlinear space coloured red; foll. numbered in the right

Page #189
152 Jaina Literature and Philosophy [ 735. to 20 hand margin ; fol. 1a blank; unnumbered sides are decorated with a small disc in red colour in the centre, whereas the numbered, in each of the two margins, too; red chalk used ; strips of white paper pasted to the edges of the first fol. ; condition on the whole good ; complete ; this work ends on fol. 1b; this Ms. contains in addition the following 67 works :(1) IryApathikIsUtra tol. 10 (2) tassa uttarI (3) annattha (4) logassa.(nAmastava) (5) namatthu NaM (zakrastava) (6) caityastava (7) annattha (8) caityastava (9) zrutastava (10) suyassa bhagavao (11) caityastava (12) siddhastava (13) vaiyAvazyakarasUtra (14) annattha ( 15 ) jAvaMti ceiyAI (16) jAvaMta ke vi sAhU (17) cirasaMciya (18) namo'rhat (19) upasargaharastotra ( 20 ) jaya vIyarAya (prArthanAsUtra) (21) suguruvandanasUtra (22) AlocanAbhUtra (23) savvassa vi (24) gurukSAmaNAsUtra (25) sAmAyikasUtra (26) AlocanAsUtra foll. , to 3. (27) zrAddhapratikramaNasUtra These three may be looked upon as only a portion of Vandittusutra. to 26 1-3

Page #190
III. 4 Malasatras I) fol. 4 foll. 11b 5" .. fol.11h (28) Ayariya uvajjhAe (29) jo ko vihu pANigaNo (30) upavAsapratyAkhyAna (31) (32) (33) grandhisahitapratyAkhyAna (34) vikRtipratyAkhyAna (35) ekAzanapratyAkhyAna (36) ekasthAnapratyAkhyAna (37) abhaktArthapratyAkhyAna ( 38 ) divasacarimapratyAkhyAna (39) sAdhu( yati )pratikramaNasUtra ( 40 ) pAkSikasUtra (41) pAkSikakSAmaNaka (42) dazavakAlikasUtra nalikAdvayasahita ( 43 ) upadezamAlA (44) piNDavizuddhi ( 45 ) zIlopadezamAlA (46) snAtasyAstuti ( 47 ) jIvavicAra (48) vivekamArI (49) guruvandanakabhASya (50) pratyAkhyAna (51) bhAvanAsandhi (52) caityavandanabhASya (53) caupai (Guj.) (54) yogIvA0 (Guj.) (55) sAvadhUpakSepalavaNottAraNalUNavidhi AratImaGgalapradIpottAraNavidhi (56) AdijinezvarajanmAbhiSeka fol.40 " " 41b foll. 41b fol.50a .. 504 foll. 50b , fol. 514 ,, 51 I This work is here described on p. 101. See No. 707. 2 This work is described in Pt. I opp. 369. See No. 412.

Page #191
154 Jaina Literature and Philosophy 1735 , 540 , 69 (57) mahAvIrakalaza foll. 51 to 52b (58) bRhacchAntistotra ,, 520 , 530 (59) laghuzAntistotra fol. 530 (60) paJcaparameSThistavana (61) gautamapRcchA foll. 544, 55 (62) yogazAstra (I-IV ) , 55 , 65 (63) vItarAgastotra , 65 ,, 69 (64) avagAhanAdvAra (65) gatidvAra fol. 71 (66) saGgrahaNIratna foll. , , 75" (67) bhaktAmara stotra ,, 75 , 76 Out of these sutras. I to 28 may be said to be com ponent factors of Sadavasyakasutra. Age. - Old. Begins. -- fol. I // 6 // ahaM // namo arihaMtANaM Ends.- fol. I" eso paMcanamukAro etc. up to havai maMgalaM // 1 // as in No. 734. N. B.--- For other details see No. 734. namaskAramantra Namaskaramantra 1106 (1). No. 736 1891-95. Size.-- 10 in. by 4 in. Extent.-- 58 - I = 57 folios ; 14 lines to a page ; 35 to 40 letters to a line. Description.- Country paper thin, tough and white ; Jaina Deva nagari characters ; big, clear, uniform and good hand-writing; borders ruled in three lines and edges mostly in two, in red ink : red chalk and yellow pigment used ; foll.

Page #192
736.] III. 4 Mulasatras 155 fol. 22 , 20 numbered in both the margins ; a piece of paper of the size of a fol. pasted to fol. 18; condition on the whole good : foll. I and 58b blank ; this work ends on fol. 1'; commplete; fol. 9th missing ; this Ms. contains the following additional works :-- (1) jayau mAmi (jagacintAmANa') fol.1b (2) jaM kiMci (3) zakrastava foll. ,, to 22 (4) jAvaMti ceiAI (5) jAvaMta ke vi sAha (6) namo'hat (7) upasargaharastotra (8) jaya vIyarAya (9) praNipAtasUtra ( 10 ) IryApathikImatra (11) tassa uttarI (12) annattha (13) nAmastava foll., , 34 (14) caityastava fol. 3a (15) zrutastava (16) suassa bhagavao ( 17 ) caityastava (18) siddhastava (19) vaiyAvRttyakaramatra (20) annattha ( 21 ) saMsAradAvAnalastuti (22) suguruvandanasUtra foll. ,, (23) devasikAlocanAsUtra fol. 4 (24) (25)- gurukSAmaNAsUtra (26) sAmAyikasUtra (27) (28) pauSadhasUtra I See p. 148, ft. note 1.

Page #193
156 Jaina Literature and Philosophy [736. fol. 5a 1. " , 64 foll. 6380 (29) Ayariya uvajjhAe (30) jaya mahAyasa (31) zrutadevIstuti ( 32 ) bhavanavAsinIdevIstuti ( 33 ) kSetradevatAstuti ( 34 ) zrutadevatAstuti ( 35 ) pAkSikastuti ( 36 ) vardhamAnastuti ( 37 ) namo'stu vardhamAnAya ( 38 ) sAmAyikapauSadhapAraNagAthA ( 39 ) ajJAtanAmadheya ( 40 ) sAdhvaticAragAthA ( 41 ) gocaracaryAgAthA (42) AkArasaGkhyAgAthA (43) dazavidhapratyAkhyAna (44) caukkasAya ( 45 ) sAdhu( yati )pratikramaNasUtra (46) pAkSikakSAmaNA (47) AlocanA (48) upadezamAlA (49) vaMdittusUtra ( 50 ) rAIsaMthAragAthA ( 51 ) jaya tihuyaNastotra (52) ajitazAntistava ( 53 ) namiUNastotra (54) taM jayau ( 55 ) gurupAratantryasmaraNa (56) sigghamavahara (57) uvasaggaharathotta (58) laghuzAntistotra (59) bhaktAmarastotra (60) kalyANamandirastotra (61) bhAvArivAraNastotra fol. 4 foll. , , " 11 , 120 fol. 122 , 12 foll. 12b , 14 ,, 14 , 15 ,, 151 ,, 160 , 16 , 18 , 18 , 22 ,, 22 , 23,, 234 ,, 24 fol. 24 , 240 foll. 24 ,, 25 fol. 25 foll. 25* ,, 26 ., 28 ,, 300 ,, 30deg ,, 32*

Page #194
736.] ___ III. 4 Malasatras 157 ',, 38 , 4 " 420 (62) duriyarayastotra foll. 32 to 34 (63) jIvavicAra ,, 34* ,, 36 (64) navatattva (65) laghusaGgrahaNI ,, 38,, 39 (66) tijayapahuttastotra ,, 39" ,, 40 (67) navagrahagarbhitapArzvanAthastotra fol. 40' ,, 40" (68) aSTamIstuti (69) paJcamIstuti foll. 40" ,, 41 (70) navapadastuti fol. 4I' ,, 4" (71) ajitajinastuti (72) zItalajinastuti foll. 41deg,, 42 (73) pAjinastuti fol. 42* ,, 42 (74) nemijinastuti (75) jinakuzalamUrikRtastuti foll. 42 ,, 43 (76) caturvizatijinastuti fol. 43 (77) jinastuti ,, 43* ,, 43" (78) sImandharasvAmistuti ,, 43 (79) pArzvajinastuti foll. 43deg ,, 44 (80) viMzativiharamANajinastuti fol. 44 (81) neminAthastuti , 44deg ,, 44 (82) vIrastuti ,, 44 (83) pArzvajinastuti foll. 44" ,, 45 (84) zatraayastuti fol. 45 (85) dIpAvalIstuti ,, 45 (86) mahAvIrastuti ,, 45, 45" (87) maunaikAdazIstuti ,, 450 (88) paryuSaNAstuti foll. 45deg ,, 46 (89) aSTamIstuti fol. 464 (90) sarasvatIstotra , 468., 460 (91) sagrahaNIsUtra foll. 46",, 58 ___ Out of these sutras, I to 38 seem to constitute Sada vasyakasutra. Age.-- Sainvat 1840.

Page #195
158 Jaina Literature and Philosophy 1736. Begins.- fol. b namo arihaMtANaM etc. Ends.-ol. 1" eso paMcanamukkAro etc. up to havai (vai) maMgalaM N. B.---- For additional information see No. 731. namaskAramantra Namaskaramantia No. 737 575 (1) 1895-98. Size.-- 102 in. by 5 in. Extent.- 39 folios ; 16 lines to a page ; 44 letters to a line. Description.- Country paper sufficiently thick, tough and greyish in colour; Devanagari characters; bold, legible and fairly good hand-writing; borders ruled regularly in two lines in red ink and margins singly in the same ink; red chalk used for marking the numbers and the titles of different works; white pigment used in place of the yellow pig ment; the first fol. is little bit torn ; the last three are damaged, perhaps corroded by white ants; condition tolerably good; the last fol. written in a different and bigger hand by some one else ; fol. I blank ; complete ; this Ms. contains the following works in addition :(1) jIrikApallisvAmizrIpArzvajinastuti fol. 16 (2) bhayahara( namiUNa stotra foll. 1 to 25 (3) upasargaharastotra (4) je kiMci (5) zakrastava foll. 20 ,, 3 (6) cintAmaNipArzvastuti fol. 32,, 30 (7) pArzvajinastotra (8) zalezvarapArzvajinachanda foll. 3deg ,, 5" (9) gauDIpArzvanAthachandamotIdAmastuti ,,5deg,,7 fol. 20

Page #196
737.) II. 4 ( 10 ) padmAvatIpUjanavidhi (II) padmAvatIkavaca ( 12 ) padmAvatIsahasranAmastotra Malasatras (13) padmAvatIstotra ( ? kalpa ) ( 14 ) padmAvatIchanda ( 15 ) padmAvatIvidhi ( 16 ) padmAvatIpUjAmantravidhi ( 17 ) padmAvatI pUjA''hUti sarvavidhi cakrezvarIstotra ( 18 ) ( 19 ) kSetrapAlachanda (stuti) ( 20 ) annapUrNAstuti ( 21 ) annapUrNAstotra ( 22 ) sAradAstotra ( 23 ) jvAlAmukhI stotra ( 24 ) sarasvatIstotra ( anubhUtisiddhi ) (25) sarasvatIdvAdazamAsachanda ( 26 ) aDayalanAma sarasvatIchanda ( 27 ) sarasvatIchanda (28) sarasvatyaSTaka sarasvatIstotra ( 29 ) ( 30 ) paThitasiddha sArasvatastotra ( 31 ) bhAratIstotra (32) lakSmIdevIstotra (33) sarasvatyaSTaka (34) sarasvatI devI stotra (35) bAlatripurAchanda ( 36 ) ambikAchanda (37) paJcAGgulIchanda ( 38 ) gaNapatipAhADagatichanda ( 39 ) gaNezachanda ( 40 ) gaurakSetrapAlanIsANI ( 2 ) ( 41 ) laghustavastotranyAsa ( 42 ) tripurAstotra fol. 72,, 7b foll. 7th ga " 39 "" fol. 14 b ga 12a "" 33 12a 13b 13b,, 14b " fol. 24* 24h 33 foll. 24b , 2)* fol. 25 *,, 25h foll. 25, 261 fol. 264 26b "" "" 33 33 foll. 26b,, 272 fol. 27a 27b foll. "" 23 27h,, 286 28b,, 29b 296 13 pis fol. 3ob foll. fol. 31a >> 31a 3rb foll. 31b,, 324 fol. 32a " -15h -23h d. "" fol. 37b foll. 159 " " foll. 326,, " fol. 354," foll. 35b k2 33, 34a fol. 342, 34b foll. 34b,, 35a 35h " "" 33b 372 38h

Page #197
160 Jaina Literature and Philosophy 737 (43) bAlAtripurAstotra foll. 38h to 39 (44) bAlatripurApaddhatyAdi (?) fol. 39* ,, 39" (45) jinastuti (?) ,, 390 Age.-- Not older than the nineteenth century ; see the 23rd folio. On fol. 26b there is the date viz. Samvat 1889. See Saradastotra. Begins.-.foi. 1h zrIpAzcajinAya namaH // namo arihatANaM / etc. Ends.. fol. 1" maMgalANaM ca samvesi paDhama hoDa maMgalaM // 1 // N. B.... For other detals sce No. 734. - namaskAramantra Nauaskaramantra No. 738 640(8). 1895-98. Size..-114 in. by 64 in. Extent.-- 11 folios ; 17 lines to a page ; 46 letters to a line. Description.- Country paper thick, tough and white; Devanagari characters; bold, legible, uniform and elegant handwriting ; borders carefully ruled in three lines in red ink, and the margins singly in the same ink; condition very good ; complete ; this Ms. contains in addition the following works :(1) upasargaharastotra fol. I b (2) bhayaharastotra ____1 to 23 (3) jaya tihuyaNastotra ___2* ,, 4. (4) ajitazAntimtava 4deg,, 5" (5) cintAmaNipArzvastotra 5, 62 (6) bhaktAmarastotra 6 ,, 8

Page #198
739.] (7) kalyANamandirastotra ( 8 ) vRddhanamaskAra ( 9 ) laghuzAntistotra Age. Samvat 1940. Begins. fol. 1 Ends. fol. 1 III. 4 namaskAramantra No. 739 Malasatras foll. 17 aftari etc., as in No. 737. etc., as in No. 737. Reference. This sutra is given as an avatarana in the svopajna commentary of Yogasastra (VIII, 34). For further particulars see No. 734. bhaktAmara stotra ( Incomplete ) "2 "" ( 1 ) upasargaharastotra ( 2 ) tijayapahutta ( saptatizata jinastotra ) zAntikarastava (3) ( 4 ) namiUNastotra ( 5 ) ( 6 ) ajitazAntistava (7) laghuzAntistotra ( 8 ) bRhacchAntistotra Size.- 10 in. by 4 in. Extent. 11-110 folios; 15 lines to a page; 60 letters to a line. Description. Country paper sufficiently thick, tough and greyish; Devanagari characters with gears; bold, legible, uniform, neither very big nor very small and elegant handwriting; borders ruled carefully in two pairs of lines in black ink; there is some space left between these pairs; red chalk used; complete; condition good; this Ms. contains in addition the following works : 8a to 9b 9b,, Iob Iob Ilb Namaskaramantra 350 ( a ). A. 1882-83, fol. Ib foll. fol. 2a foll. rw fol. foll. 22 161 Ib to 2a 2b 1 2 2 w N dr 6b 2b 3a "" as98 3a 4a 92 6b ,, 7a 72 22 118 8a

Page #199
162 Jaina Literature and Philosophy [ 739. (9) Freiherra foll. 8a to 10 (10) FT fagaueala , 104, 1Tb The fifth folio is missing, so the corresponding works are affected. Age.- Old. Begins.- fol. 1 TH ATT I GETTI( atat aquestefaaliga Git gurubhyo nmH| RAT POTATO I etc. Ends.- fol. 12 Angrai T HELT GA ETE ANO 1171181 N. B.-- For additional information sce No. 734. namaskAramantra Namaskaramantra No. 740 885 (a). 1892-95. Size.-- 104 in. by 4.1 in. Extent.-- (text) 13 tolios ; I to 2 lines to a page ; so letters to a line. , - (com.) , , ; , , , , ; 55 ,, to a line. Description.-- Country paper somewhat thick, tough and white ; Jaina Devanagari characters with occasional quara; this is a garat Ms.; the text written in big, quite legible, uniform and very good hand-writing; practically same is the case with the commentary except that it is written in a slightly smaller hand-writing; foll. numbered in the right-hand margin ; fol. ra originally blank has been later on utilised by some one for writing some items connected with the Dikpalas ; condition very good; both the text and the commentary complete; the latter ends on fol. 24; this Ms. contains in addition the following works :

Page #200
740.] III. 4. Malasatras 163 (1) upasargaharastotra TIkAsahita foll. 24 to 3b (2) saptatizatastotra , , 3 , 72 (3) bhayahastotra , , 74 ,, I3b Age.- Samvat I792. Author of the commentary.-- Vacaka Siddhicandra, pupil of Bhanucandra. For his life and works see my Sanskrit bhu. mika ( pp. 72-84 ) of Stuticaturvimsatika published in A. D. 1930, and for information in Gujarati see "TTT prabhAvaka guru-ziSya bhAnucaMdra ane siddhicaMdra" published in " Jainacharya Shri Atmanand Centenary Commemoration Volume" ("jainAcArya zrI AtmAnaMda janma zatAbdi smAraka graMtha"), pp. 225-245. Subject.-- The text together with its explanation in Sanskrit. Begins.- (text ) tol. I" e60 // zrIsarvajJAya namaH / / namo arihaMtANaM etc. as in No. 734. ,, -(com.) fol. 11 :||shriignneshaay nmH|| zrInAbhayaH zriyaM dadyAtsurAsuranamaskRtaH / vighnAnekapapaMcAsyo dadhadvizvajanInatAM / 1 / akabbarasuravANahRdayAMbujaSaTpadaH / bhAnucaMdrazciraM jIyAd gurumeM vAcakAgraNI / 2 / aSTottarazatAnAM yo'vadhAnAnAM vidhAyakaH / dadhAnaH 'pusphahameM ti birudaM zAhinA(s)rpitaM / 3 . tena vAva(ca)kacaMdreNa siddhicaMdreNa sarvadA / buddhivRddhyai vi(vi)taMdreNa bAlAnAmalpamedhasAM / 4 / zazvatsaptasmaraNAnAM vRttireSA vidhIyate / tatra tAvannamaskAra eva vyAkhyAyate mayA / 5 / tribhirvizeSa namo arihaMtANamiti / namo namaskAra kebhyaH / etc. Ends.- (text) fol. 2* sabvapAvappaNAsaNo etc. up to maMgalaM / 1 / as in No. 734.

Page #201
164 Jaina Literature and Philosophy (740. Ends.- (com.) fol. 24 SET TITTI TUTTO I TE TET I spent = HTET vizrAmasthAnAni tatra sapta ekaikapadA / atyA tu dvipadeti namaskArArthaH / Reference.-- Both the text and the commentary are included in Anekartharatnamanjusa (pp. 1-6 ) edited by me and published in Sheth D. L. J. P. F. Series as No. 81 in A. D. 1933. For other details see No. 734. namaskAramantra bAlAvabodhasahita No. 741 Namaskaramantra with balavabodha 742. 1892-95. Size.--- 9 in. by 44 in. Extent.-- 4 folios ; 12 lines to a page ; 34 letters to a line. Description.- Country paper rough and grey ; Devanagari chara cters; big, clear and tolerably good hand-writing ; borders ruled in four lines in black ink ; red chalk used ; yellow pigment, too; edges of all the foll. are slightly damaged ; condition on the whole good : both the text and its explanation complete so far as they go, that is to say the culika and its explanation are not to be found here. Age.--- Old. Author of the balavabodha.- Not mentioned. Subject.- Obeisance to the five Paramesphins in Prakrit and its explanation in detail in Gujarati, with quotations in Prakrit. Begins.- (text ) fol. 14 TAET SENTUT 1 1 - (com.) fol. 1deg HIETU TAFETT Benia Haaat ganti faktor 33 a fuftea etc. Ends.- (text) fol. 36 FAT DIE TAIZOI

Page #202
742.) III. 4 Malasatras 165 Ends. -- (com.) fol. 4" HEIE ETT ATE FT TE r a Are WE THE mAharau namaskAra paMcAMga praNAma trikAlabaMdanA sadA sarvadA havau / iti zrIpaMcaparamaSTi(SThi)namaskAra samApta // Reference.-- See No. 734. namaskAramantra bAlAvabodhasahita Namaskaramantra with balavabodha No. 742 1365, 1891-95. Size.- 104 in. by 4s in. Extent.-- s folios ; 11 lines to a page ; 40 letters to a line. Description.- Country paper thin, rough and white; Jaina Deva nagari characters with frequent TERETS; big, legible, uniform and good hand-writing ; borders ruled in two pairs of lines in black ink ; the space between these pairs coloured red; foll. numbered in the right-hand margin ; fol. 55 blank ; both the text and the commentary complete so far as the first five padas are concerned; condition tolerab ly good. Age.- Old. Author of the balavabodha.- Not mentioned. Subject.-- The text in Prakrit together with its explanation in Gujarati. Begins.- (text ) fol. 16 FHI SIENTOT II etc. , - (com. ) fol. 16 TERAZ ATETE FAAIT T PARET y A arihaMta / rAgadveSarupiA ari vayarI haNyA chai jeNe / te arihaMta valI kisyA 5 11 etc. Ends.-( text ) fol. Sa AHT JIG HETTICO

Page #203
166 Jaina Literature and Philosophy [742. Ends. - ( com. ) fol. 5 nirahaMkArI / nipa( pa )rigrahI nirAraMbhI / zAMta dAMta ratanatrayasAdhaka aDhAI dvIpa mAhi jike chaI sAdhu te savi huM sAdhu pratiI mAharu namaskAra paMcAMgapraNAma trikAlavaMdanA sadA sarvadA hu||5|| __ iti zrIcaityavaMdana paMcapadanamaskArasArtha saMpUrNa // cha / zubhaM bhavatu kalyANamastu // shrii|| N. B.-- For other details see No. 734. namaskAramantra Namaskaramantra bAlAvabodhasahita with balavabodha 593 (c). No. 743 1875-76. Extent.- fol. 42deg to fol. 43". Description. The text up to five padas; the commentary ends abruptly. For other details sce No. -571 - 1875-76. Author of the balavabodha.-- Not mentioned. Subject. -- The text and its explanation in Gujarati. Begins.-~- ( text ) fol. 42* Namo arahaMtANaM / etc. ,, - (com.) fol. 42deg zrIarihaMtani mAhAru sadA kAla namo(s)stu / te zrIara. haMta kehavA chi / zrIsamosaraNa virAjamAna | etc. Ends.- ( text ) fol. 43 Namo loe savvasAhUNaM , -- (com.) fol. 43 zrIsAdhuni mahAru sadA kAla mamo(s)stu // te zrIsAdha kehavA chi // paMcamahAvrata dhAre ||pNc. namaskAramantravyAkhyA Namaskaramantravyakhya 1241 (a). No.744 1884-87. Size.-9 in. by 4g in. Extent.-- 26+1=27 folios ; 19 lines to a page; 60 letters to 1 line.

Page #204
167 Description.--- Country paper thick, tough and white; Jaina Devanagari characters; small, fairly legible and tolerably good hand-writing; borders not ruled; foll. numbered in the right-hand margin; fol. 19th repeated; red chalk used; fol. 26b blank ; condition very good; complete; this Ms. contains the s of the text; this Ms. contains in addi 744.1 tion the following works : (1) upasargaharastotravRtti ( 2 ) zAntikarastavArthANu bhayaharastotravivRti ( 3 ) ( 4 ) (5) ( 6 ) III. 4 Malasutras laghuzAntistavavyAkhyA saptatizatastotravyAkhyA ajitazAntistavavivaraNa bhaktAmarastotraTIkA bRhacchAntistavavivaraNa Begins.-- fol. r // ahe // foll. Ia to 2b 2b "3 23 " "" 33 39 (7) ( 8 ) Age. - Samvat 1873. Author.-- Harsakirti Suri. Subject.-- Commentary on Namaskaramantra which is looked upon as the first smarana out of seven. " 22 5a Sa 8 10a 12a 16b ,, 23a 23a 26a 8 "Toa >> 12a , 166 " praNipatya jinaM vakSye saptasmaraNeSu vivaraNaM kiMcit yasmAnmaMdamatInAmapi bhavati sukhena tadbodhaH 1 yataH parvadineSu sakalazreyo (S) kSudropadravAdidoSanivAraNArthaM ca kAraNAdau sukhaM zAMtyarthaM ca sapta militA (ni) eva smaryate guNyaMte iti sapta smaraNAni ucyate tathAdau caturdaza pUrvANAmAdibhUtaM anAyanaMtaM ca paMcaparameSThinamaskAraM (ra)rUpaM prathamasmaraNaM AdI vyAkhyAyate namo arihaMtANaM ityAdi etc. Ends. fol. 14 idaM ca smaraNamanAdibhUtaM yato jinAH caturviMza ( ta ) yo'naMtA: saMjAtAH anaMtAzva bhaviSyati tadA sadaivA'yamevAto'nAyanaMtamityarthaH atra padAni nava saMpado'STau akSarANi aSTaSaSTiH ladhyakSarANi ekaSaSTiH gurvakSarANi sapta jJeyAni iti prathamasmaraNasya TIkA 1 Reference. Edited by me and published in Anekartharatnamanjusa (pp. 2-6) which forms No. 81 of Sheth D. L. J. P. F. Series, published in A. D. 1933.

Page #205
168 Jaina Literature and Philosophy [745. namaskAramantravyAkhyA Namaskaramantravyakhya 42 (8). 1874-75. No. 745 Size.-- Io in. by 4g in. Extent.-- 27 folios ; 17 lines to a page ; 54 letters to a line. Description.-- Country paper thin, rough, tough and white; Jaina Devanagari characters; small, fairly legible, uniform and very good hand-writing; borders ruled in three lines in red ink; red chalk used ; lines here and there written in red ink; foll. numbered in both the margins ; fol. 270 blank ; there is some space kept blank in the centre, in the case of the numbered and the unnumbered sides as well ; in a few cases, this central place is decorated with a small disc in red colour; in the left-hand margin, the title is written as saptasmaraNaTI.; condition very good ; the extent of the commentary to each of the seven smaranas is as under :-- (1) upasargaharastotratti foll. h to 3 (2) namiUNa(bhayahara)stotravRtti (3) laghuzAntistavavRtti (4) tijayapaTuttavRtti ( saptatizatastotratti),, (5) AjitazAntistavatti (6) bhaktAmarastotratti (7) bRhacchAntistotra , 23 , 27 Begins.-fol. I* // 6 // zrIjinAya nmH|| praNipatya jinaM vakSye etc. as in No. 744. Ends.-- fol. rb idaM ca smaraNamanAdibhUtaM etc. up to jJeyAni as is No. 744. This is followed by the lines as under : 'nAgapurIyatapo gnnraajH| zrIharSakIttimUrivaraH prathamasmaraNe vyAkhyAM saMkSepAdvihitavAn samyak // 1 iti prathamasmaraNavyAkhyA // // N. B.--- For additional information see No. 744.

Page #206
746.] III. 4 Malasatras 169 prabodhacaityavandana * Prabodhacaityavandana [ jagaciMtAmaNi [ JagacintamaniceiyavaMdaNa] ceiyavandana ] No. 746 1220 (13). 1884-87. Extent.-- fol. 1894 to fol. 1890. Description.-- This work may seem to begin abruptly as it does not contain some of the gathas occurring in Jagacintamaniceiyavandana. But it may noted that this sutra begins in this very way so far as Vidhipaksa is concernted. See p.7 of "Vidhipaksagacchiyapratikramanasutra" published by Bhimasi Manaka in A. D. 1934. For other details see No 1220(I). 1884-87.. Author.-- Gautama Indrabhuti Ganadhara ( according to the Jaina tradition ). Subject.- Salutation to the Jinavaras and the caityas. Begins.--- fol. 189* kammabhUmihiM ( kammabhUmihiM ) paDhamasaMghayANa / uknosara ___sattarasau / jiNavarANa viharaMtu(ta) labhai / nava koDihiM kevalihiM etc. Ends.- fol. 189 sattANavai sahassA | lakkhA chappanna attttkoddiio| causai bAsiyA teNe(lu ke ceie vaMde // 2 // vaMde nava koDisae paNavIsa koDilakkha tevannA aTThAvIsa sahassA causai aTTAsiyA paDimA // 3 // Reference.-- Published in some of the printed editions of the Prati kramanasutras. It is edited by me, along with Sanskrit rendering and Gujarati translation, and is published by Babu Bhagvanlal Panalal and Babu Mohanlal Panalal in " The Fifth Kiranavali" (Arhatajivanajyoti) on pp. 81-84 ir A. D. 1937. Of course, this partly differs from what we have here in the Ms. * See p. 134. This sort of brackets indicates that instead of the Prakrit rendering, an independent Prakrit title is given.

Page #207
170 Jaina Literature and Philosophy prabodhacaityandana No. 747 Extent. fol. rb. Description. Complete so far as it goes. For other details see Namaskaramantra No. 736. prabodhacaityavandana No. 748 Subject. This caityavandana begins according to the Kharatara gaccha. See Sukhlal's edition ( App. 15 ) noted on p. 132. Begins. fol. rb jayaDa sAmihi 2 risaha 'setaMja' etc. Ends. fol. 1' kammabhUmihiM etc up to ceie paDimA practically as in No. 746. N. B.- For additional information see No. 746. Prabodhacaityavandana 1106 (2). 1891-95. 1747 Extent. fol. rb Description. Complete so far as it goes. No. 734. Begins. fol. ra Prabodhacaityavandana 1270 (2). 1887-91. For other details see jayau sAmiu risahu 'settu (tuM) ji' / 'ujjita hunemijie / * jayau vIsaM (?) moheramaMDaNU / 8 'bharavaTTi ' muNisuvvara maharapAsu duhadaMDaSaMDaNa avara' videha' vi tittha ya subaha disi vidisi ji ke vi ti ( tI )aNagaya saMpayai / vaMdiu jiNa savve vi 1 Ends. fol. rb kammabhUmihi etc. up to ceie vaMde // 3 // as in No. 746. N. B. -- For further particulars see Nos. 746 and 747

Page #208
750. ] III. 4 Malasutras 171 tIrthavandanasUtra Tirthavandanasutra [ Firear ) [ Jarn kinci ] No. 749 575 (5). 1895-98. Extent.-- fol. 26. Description.- Complete. For other details see Namaskaramantra No. 737. Age.-- Samvat 1889 ( vide fol. 26 ). Author.-- Not mentioned. Subject.- This sutra composed in a verse in Prakrit deals with salutation to the tirthas in svarga, patala and manusyaloka. Begins and Ends. fol. 26 jaM kiMca(ci) nAma titthaM / sago(gge) pAyAle tiriyalogaMmi // jAiM jiNabiMbAi // tAI savvAiM vaMdAmi // 1 // As it consists of one verse, there is no separate end. Reference.- Published with some difference in any of the editions of Pratikramanasutra noted on p. 138 and in "The Fifth Kiranavali" (Arhatajivanajyoti) on p. 85 edited by me, along with Sanskrit rendering and Gujarati translation. tIrthavandanasUtra Tirthavandanasutra 1220 (16). No 750 1884-87. Extent.-- fol. 1896 1220 (1). Description.-- Complete. For other details see No. NO. 1884-87. Author.-- A Jaina Saint. Begins and Ends.--fol. 1896 jaM kiMci nAma titthaM / sagge pAyAla(li) mANuse loe jAI jiNabiMbAiM tAI saghA(vA)I baMdAmi / cha / N. B.--- For other details see No. 749.

Page #209
172 Jaina Literature and Philosophy 1751. tIrthavandanasUtra Tirthavandanasutra 1106( 3 ). No. 751 1891-95. Extent.-- fol. 16. Description. Complete. For other details see Namaskaramantra No. 736. Begins and Ends.-fol. 16 ___ jaM kiMci nAma tithaM etc. up to savvAiM vaMdAmi 3 as in No. 750. N. B.- For additional information see No. 749. tIrthavandanasUtra Tirthavandanasutra No. 752 1270 (3). 1887-91. Extent.-- fol. 1 to fol. 2*. Description.-- Complete. For other details see No. 734. Begins and Ends.-fol. 2to fol. 24 Gif (F) and etc. up to Forg GETIA 11 8 11 as in No.750, N. B.-- For further particulars see No. 749.

Page #210
753.] zakastava [ namutthu NaM ] No. 753 Extent. fol. 1896. Description. Complete. For other details see No. Author.- Sakra according to the Jaina tradition. Subject.- Eulogy of the Tirthamkaras. IlI. 4 Malasatras Begins. fol. 1896 mg of actor etc. as in No. 758. Ends. fol. 189 // cha // followed by the lines as under : jiyabhayANa 11 Sakrastava [Namutthu nam] 1220 (17). 1884-87. 173 etc. up to for as in No. 758. This is ja aiyA siddhA je bhavissaMtiaNAgae kAle saMpaI | mANA savve tiviheNa vaMdAmi || 1220 ( I ). 1884-87. Reference. Published. See any of the printed editions of the Pratikramanasutras noted on p. 138. This work is edited by me with Sanskrit rendering and Gujarati translation and is published in "The Fifth Kiranavali (Arhatajivanajyoti) on pp. 86-88 where the due posture is also shown by way of an illustration. Kalpasutra (sutra 16), Haribhadra Suri's commentary (p. 494ff.) to Avasyakasutra and Vandaruvrtti (pp. 29-36) may be consulted. For an extract see B. B. R. A. S. vols. III-IV. p. 398. For Sanskrit rendering and English translation see Trisastisalakapurusacaritra vol. I, pp. 127-128 (Gaekwad's Oriental Series, No. LI). For a parallel work in Sanskrit see my edition of bhaktAmara kalyANamandiranamiUNastotra (PP. 242-245). For other details see my article "ago" published in Sri Jaina Satya Prakasa vol. II, No. 12, pp. 66 599-602.

Page #211
174 Jaina Literature and Philosophy (754 zakastava Sakrastava 1106 (4). No. 754 1891-95. Extent.-- fol. a to fol. 22. Description.--- Complete. For other details see Namaskaramantra No. 736. Begins.--tol. 1 TATT UT Spearoj etc. as in No. 753. Ends.--fol. 2a Hau etc. up to facagu Erh as in No. 753. This is followed by 8. N. B.-- For further particulars see No. 753. zakastava Sakrastava 1270 (5) No. 755 1887-91. Extent.- fol. 2* to fol. 26. Description.- Complete. For other details see No. 734. Begins.- fol. 2a FATYTTRE) OT I SPEATOT I etc. as in No. 753, Ends.--- fol. 2* sabanaNaM / etc. up to sance tiviheNa baMdAmi / / 7 / ' as in No. 753. N. B.-- For further particulars see No. 753. zakastava Sakrastava 1269 ( 6 ). No 756 1887-91. Extent.- fol. 1 to fol. 2". Description. Complete. For other details see Namaskaramautra No. 735. Begins. - fol. 1 JARSU O TEAU etc. as in No. 753. Ends.- fol. 2a Fermo etc. up to facteUT PETIA 11313 ll as in No. 753. : N. B.- For additional information see No. 753.

Page #212
758.1 III. 4 Malasutras 175 zakastava Sakrastava 77 ( ). 1880-81. No. 757 Exent.---- leaf 120b to leaf 1216. Description.- Complete. For other details see No.77 the any 77 ( 1 ). Begins.-- leaf 120 namotthu NaM arihaMtANaM // bhayavaMtANaM AigarANaM etc. Ends.--- leaf I21deg saMpaiya.vaTamANA / satve tiviheNa baMdAmi / N. B.-- For additional information see No. 753. Sakrastava No. 758 575 (6). 1895-98. Extent.-- fol. 26 to fol. 3*. Description.- Almost complete in case the following lines may be said to be lacking :"jiabhyaannN| jea aiA siddhA je a bhavissaMtiNAgaekAle saMpai vaTTamANA savve tiviheNa vaMdAmi" For other details see No. 737. Begins.- fol. 2' namotyu NaM // arihaMtANaM // bhagavaMtANaM // Ayagi(ga )rANaM // _ titthayarANaM etc. Ends.- fol. 3* satvanaNaM savvadaMsINaM // sivamayalamaruyamaNaMtamakkhayamanyAbAha.. mapuNarAvatti // siddhigainAmadheyaM // ThANaM saMpattANaM // namo jiNANaM // 1 // .... iti zrIzakrastavaH // ___N. B.- For other details see No. 753. -

Page #213
176 sarvacaityavandana [ jAvaMti ceiyAI ] No. 759 Extent. fol. 190o. Jaina Literature and Philosophy Description. Complete. For other details see No. Author. A Jaina saint. Subject. Begins and Ends.- fol. 190a Sarvacaityavandana [Javanti ceiyaim ] 1220 (26). 1884-87. Salutation to the caityas of all the three lokas, in one verse in Prakrit. No. 735. Begins and Ends. fol. 2a [759. jAvaMti ceiyAiM / ( uDne ya ) [ aheya ] ahe ya tiriyaloe ya / savAI tAI vaMde [a] iha saMto tattha saMtAI // 5 Reference. Published. See any printed edition of the Pratikramanasutras. This work has been recently edited by me, along with the Sanskrit rendering and Gujarati translation, and it is published in "The Fifth Kiranavali" (Arhatajivanajyoti) on p. 89. This sutra occurs in Sraddhapratikramanasutra as verse No. 44. So this and Vandaruvrtti (p. 157) may be consulted. sarvacaityavandana No. 760 Extent. fol. 2a. Description. Complete. For other details see Namaskaramantra 1220 ( I ). 1884-87. N. B. For additional information see No. 759. Sarvacaityavandana 1269 (16). 1887-91. jAvaMti ceiyAiM etc. up to tattha saMtAI // 1as in No. 759.

Page #214
762.) Ill. 4 Mulasatras 177 sarvacaityavandana Sarvacaityavandana No. 761 1106 (5). 1891-35. Extent,- fol. 22. Description. Complete. For other details sec Namaskaramantra No. 736. Begins and Ends.-fol. 2a jAvaMti ceiAI etc. up to iha saMto tattha saMtAI as in No. 759. N. B.- For further particulars see No. 759. sarvacaityavandana Sarvacaityavandana 1270 (6). 1887-91. No. 762 Extent.-- fol. 26. Description.-- Complete. For other details see No. 734. Begins and Ends.--fol. 2a Fraia agung etc., up to ze sa faca per fare 3 ll as in No. 759. N. B.-- For additional information see No. 759.

Page #215
178 Jaina Literature and Philosophy ( 763. sarvasAdhuvandana Sarvasadhuvandana ( ata o la Fle] [ Javanta ke vi sahu ] 1220 ( 27). No. 763 1884-87. Extent.- fol. 1909. 1220 (1). Description.- Complete. For other details see No. - 1884-87. : Author.-- A Jaina saint. Subject.-- Salutation to all the saints, in one verse in Prakrit, Begins and Ends.- fol. 1904 strafala ) (?E ) HIE ITETET HEIRATETI sabbesa tesa paNa tiviheNa tidaMDavirayANaM // 2 Reference.- Published. See any printed edition of the Prati kramanasutras. This work is recently edited by me, along with the Sanskrit rendering and Gujarati translation, and is published in "The Fifth Kiranavali" (Arhatajivanajyoti ) on p. 90. This work occurs in Sraddhapratikramanasutra as verse No. 45. Vandaruvitti (p. 157) may be consulted. sarvasAdhuvandana Sarvasadhuvandana 1269 (17). No. 764 1887-91. Extent.- fol. 2". Description.- Complete. For other details see Namaskaramantra No. 735. Begins and Ends.- fol. 2* Arafal alfa hiz etc. up to facaratu etc., as in No. 763. N. B.- For additional information see No. 763. WURDE

Page #216
766. ] Ul. 4 Malasutras 179 sarvasAdhuvandana Sarvasadhuvandana 1270 (7). No. 765 1887-91. Extent.-- fol. 26. Description.- Complete. For other details see No. 734. Begins and Ends.--fol. 26 strafala) @ FIE I etc., up to a largo 18 as in No. 7630 N. B.-- For additional information see No. 763. sarvasAdhuvandana Sarvasadhuvandana No. 766 1106 (6). 1891-95. Extent.- fol. 2. Description.- Complete. For other details see Namaskaramantra No. 736. Begins and Ends. - fol. 2a paa Arial a ) for HT etc. up to farerea face facului 2 as in No. 763. N. B.- For additional information see No. 763.

Page #217
180 Jaina Literature and Philosophy 1767 - upasargaharastotra Upasargaharastotra (STATTET217) ( Uvasaggabarathotta ) No. 767 350 (b). A. 1882-83. Extent.-- fol. 16. Description.- Complete. For other details see No. 739. Author.- Bhadrabahusvamin according to the Jaina tradition. Subject. - This work consisting of five gathas in Prakrit as usual deals with a hymn in honour of Lord Parsvanatha, the 23rd Tirthamkara of the Jainas. This work is variously designated by scribes such as starIQUITET, fiqrealtorage. an and startetaan. Begins.- fol. 1 5 AIIER etc. as in. No. 777. Ends. fol. ib got fryrat etc, up to the end as in No. 777. Reference. Published along with Parsvacandra's commentary in the D. L. J. P. F. Series as No. 80 on pp. 97-112, where Priyankaranspakatha is also included. Also published with the commentary of Jinaprabha Suri and that of Siddhicandra Gani as well, in the D. L. J. P. F. Series as No. 81. This work is recently edited by me, along with the Sanskrit rendering and Gujarati translation, and is published in "The Fifth Kiranavali" (Arhatajivanajyoti) on pp. 92-93. 1 Herein on pp. 41-44 (App. ) is given the text containing 20 verses, and on pp. 45-48 we have padapurti of all the carapas of the first five usual verses.

Page #218
III. Malasetrus 181 770.1 . upasargaharastotra No. 768 Upasargaharastotra 640 (b). 1895-98. Extent.-- fol. xb. Description.-- Complete. For other details see No. 738. Begins.-- fol. 1deg 39#7Ei etc. as in No. 767. Ends.-- fol. 15 531 AYHT etc. as in No. 767. N. B.-- For other details see No. 767. upasargaharastotra Upasargaharastotra No. 769 1220 ( 29 ). 1884-87. Extent.- fol. 1904. Description.- Complete. For other details see No. Pend. 1220 (1) Begins.-- fol. 190* a* etc. as in No. 767. Ends.---fol. 1902 st Argait etc. up to wa ne grafa Y11 711 as in No. 767. N. B.-- For further particulars see No. 767. upasargaharastotra No. 770 Upasargabarastotra 1269 ( 20 ). 1887-91. Extent.- fol. 2deg to fol. 2b. Description.-- Complete ; 5 verses in all. Namaskaramantra No. 735. For other details see

Page #219
182 Jaina Literature and Philosophy [770. Begins.--- fol. 2* uvasaggaharaMpAsaM etc. as in No. 767. Ends.- fol. 2 iya saMdhuo etc. up to pAsajiNacaMda // 5 // cha as in No. 767. N. B.- For additional information see No. 767. upasargaharastotra Upasargaharastotra 672(g). No. 771 1899-1915. Extent.--- fol. 86. Description.- Complete ; five verses in all. For other details see Ajitasantistava No. 672 (a). -- 1899-1915. Begins.-fol. 8 uvasaggaharaMpAsaM etc. Ends.-- fol. 8* iya saMdhuo etc. up to tA deva disaha bohiM bhave bhave pAsajiNa caMda // 5 as in No. 767. This is followed by the lines as under: iti zrIupasargaharaNastotraM // saptamaM smaraNaM // 7 // iti saptamasmaraNa(NaM) samAptaM(pta)m // ccha ||lideg jIvanavIjaya // 'rnnaarsh'| 'rAmaghATa 'madhye // kusallAjImahArAjyakI pozAlame // miti vaikhAsa mudi 10 dazamI zukla(kra)vAsare / saMvat 1932 kA zAke 1797 // paMnivIvIbAcanArtha // ccha

Page #220
774] upasarga hara stotra No. 772 Extent. fol. 2b to fol. 3a. Description. 398rieczala III. 4 No. 734 Begins. fol. 2 Ends-fol. 3gen etc. up to No. 773 Malasatras This is followed by zrIpArzvanAthastavanaM // N. B. For additional information see No. 767. Extent. fol. 2o. Description. Complete. No. 737. upasarga hara stotra No. 774 Complete; five verses in all. For other details see g etc. as in No. 767. Upasargaharastotra 1270 (9). 1987-91. 183 (?) as in No. 767. Begins. fol. 2 etc. as in No. 767. Ends. fol. 25 eha saMdhuya etc. up to jiNacaMda // 5 // practically as in No. 767. This is followed by a IET " N. B. For additional information see No. 767. Upasargaharastotra 575 (4). 1895-98. For other details see Namaskaramantra Extent. fol. 2a. Description. Complete. For other details see Namaskaramantra No. 736. Upasargaharastotra 1106 (8). 1891-95.

Page #221
Jaina Literature and Philosophy Begins. fol. 24 namo ( 5 ) ItsiddhAcAryopAdhyAya sarvasAdhubhyaH / ' uvasaggaharaMpAsaM pAsaM vaMdAmi kammaghaNamukkaM etc. 184 Ends. fol. 24 ia saMo etc. up to bhave bhave pAsajiNacaMda // as in No. 767. This is followed by the line as under :iti zrIpArzvajinala ghustavanaM // N. B. For additional details see No. 767. upasarga hara stotra laghuvRttisahita No. 775 wr Size. 10 in. by 48 in. Extent. 5 folios; 13 lines to a page; 39 letters to a line. Description. Country paper tolerably thick and whitish in colour; Jaina Devanagari characters with occasional legible, bold, big, uniform and fair hand-writing; borders ruled in four lines in black ink; red chalk used; yellow pigment, too; the lower edges of the numbered sides slightly eaten away by white ants; condition very fair; this Ms. contains both(?) the text and the commentary; both complete; the latter ends on fol. 5b; this Ms. contains an additional work viz. af along with its commentary which commences on fol. 5b and ends on the same fol. Author of the commentary.- Purnacandra Suri. Subject. Begins. (text) fol. 1a ger -(com.) fol. ra 1775 A hymn in honour of Lord Parsvanatha, consisting of five gathas. The commentary deals with the yantras and tantras pertaining to them. It is styled as laghuvRtti. Upasargaharastotra with laghuvrtti 272 (a). 1871-72. namaskRtya paraM pArzve sarvayoginamaskRtaM / upasarga hara stotraM vivRNomi samAsataH // 1 // 1 This line may be looked upon as a separate work by itself.

Page #222
776.] III. 4. Malasatras 185 upasargaharaM pArzva pArzva yakSaM pArzvanAthaM ca bhagavaMtaM kiMviziSTaM karmaghanamuktaM maMgalakalyANaAvAsaM viSadharaviSanirnAzanaM cetyakSarArthaH vaMdAmIti kriyApadaM / etc. Ends.---- ( text) fol. 4 iya saMthuo(?) etc. ,, - ( com. ) fol. 5 idAnIM stuterupasaMhAramAha / iti saMstuto mahAyaza bhakti bharanirbhareNa etc. up to tathA OM namo bhagavate pArzvanAthAya kSemakarAya hI namaH kSemaMkaro mNtrH| upasargaharastotraM vivRtaM maMkSepato gurumukhen| vijJAya kimapi tattvaM vidyAvAdAbhidhagraMthAt // 1 // ityupasargaharastotralaghuvRttiH pUrNacaMdrAcAryakRtiriyaM smaaptaa| Reference.--- Published in Saradavijaya Jaina Granthamala, Bhav nagar, upasargaharastotra Upasargabarastotra arthakalpalatAsahita with Arthakalpalata No. 776 2232 (g). A. 1882-83.. Extent.- fol. 18a to fol. 196. Description. -- Both the text and the commentary practically com plete. For other details see No. + _232(a). . talls see NO. A. 1882-83.. Author of the commentary.--- Jinaprabha Suri, pupil of Jinasii ha Suri of the Kharatara gaccha. Subject.-- The text in Prakrit together with the explanation in Sanskrit ; the latter is styled as Arthakalpalata and is com posed in Samvat 1365 (see No. 777). Begins.- ( text ) fol. 184 uvasaggaharaMpAsaM pAsaM vadAmi kammaghaNamuka / visaharavisaninnAsaM maMgalakallANaAvAsaM // 1 // ( com. ) fol. 18 pratibodha vidhAno etc.

Page #223
186 Ends. - ( text ) fol. rgb I (i) saMdhuo mahAyasa / bhattibbharanimbhareNa hiayeNa / tA deva dijja bohiM bhave bhave pAsajiNacaMda // 5 // -(com.) fol. 19b "> Jaina Literature and Philosophy zrIjina // Reference. Both the text and the commentary published. Sec No. 767. upasarga hara stotra arthakalpalatAsahita saMvavikramabhUpate ( : ) zaraRtUdAcamRgAMka (mi te / pauSasyAsitapakSabhAji zaninA yukte navamyAM tithau / Ends.- "" No. 777 Extent. -- fol. 53b to fol. 6rb. Description. Both the text and the commentary complete; the latter composed in Samvat 1365. For other details see 1241 ( a ). 1891-95. No. Age. -- Samvat 1868. Begins. - ( text ) fol. 53 uvasaggaharaMpAsaM (?) etc. Begins.-- ( com. ) fol. 53 pratibodhaM vidadhyAto ( ? ) sa ca varAhamiha (hi) rastathAvidhajJAnAvaraNIya karmakSayopazamAbhAvAtkiMcideva caMdraprajJaptisUrya prajJaptyAdikaM zAstramadhItavAn / etc. (text ) fol. 61 iya saMdhuo etc. - ( com. ) fol. 61 prAkRte pAsajiNAya etc. up to iti siddhaM / practically as in No. 784. This is followed by the lines as under:-- [ 776. saMvadvikramabhUpate (:) zaraRtUda cimRgAMka mile Upasargaharastotra with Arthakalpalata 1241 ( g ). 1891-95. pauSasyAsitapakSabhAji zaninA yukte navamyAM tithau / ziSya (1) zrIjinasiMhasUrasugurorvRtiM vyadarbhIdimAM / zrI ' sAketa pure' jinaprabha iti khyAto munInAM prabhuH / 3 //

Page #224
TIT. 4 Mulasatras 187 graM. 271 / saM. 1868 mArga0 kRSNa 13. vAsare / zrI vRddhaAcArya gacche | zrIjinacaMdrasUrajIziSyapAThakavAcanArthaM / zrIratnalakSmIjI tatziSyaNI rUpai over 'Tapara' madhye | N. B.-- For other details sec No. 776. 779.] upasarga hara stotra arthakalpalatAsahita Begins. - ( text ) fol. 30 ---( com. ) fol. 28th No. 798 Extent. - fol. 28b to fol. 33b. Description. Both the text and the commentary complete; the former contains five verses. For other details see No. 851 (a). 1895-1902. uvasaggaharaMpAlaM etc. as in No. 767. pratibodhaM vidadhAno etc. as in No. 776. ( text ) fol. 32 b iha saMdhuo ctc. up to bhave bhave pAsajiNacaMda // 5 as in No. 767. (com) fol. 332 prAkRte pAsajiNA / padmAvatI tAM caMdayati AilAdayate etc. up to munInAM prabhuH // 3 as in No. 777. This is followed by the lines as under : iti zrIsapta (maM) smaraNaM samAptaM // pratyakSaraM nirUpyAsya graMthamAnaM vinizvittaM / anuSTubhAM ca dvizatyekasaptatisamanvitA // 1 zubhaM bhavatu [ : ] // zrIrastu [ : ] | // graMthAgraM 271 // N. B. -- For additional information see No. 777. "" Ends. 22 upasarga hara stotra arthakalpalatAsahita No. 779 Extent. --- fol. 34b to fol. 41b. Upasargaharastotra with Arthakalpalata 851 (g). 1895-1902. Upasargaharastotra with Arthakalpalata 1229 (g). 1891-95.

Page #225
188 Jaina Literature and Philosophy 1 779. Description.--- In the centre of the 35th solio there is a square with vertical diagonals. Both the text and the commentary complete. For other details see No. ila o N 1229 (a). !, 1891-95. Begins.-- (text) fol. 346 ( ? ) JahrEITIET etc. ,, -- ( com. ) fol. 34' tratate la aurait etc. as in No. 776. Ends.- (text ) fol. 400 SU Hysi etc. up to CIFITOTTE ,, --- (com.) fol. 41a presa Tiago etc. up to threagi' aga sa Barat gatai gy: 113 ll as in No. 777. This is followed by HATAT II SFECEIT: 1 N. B. - For further particulars see No.777. upasargaharastotra vRttisahita Upasarga!arastotra with vrtti No. 780 1205. 1886-92. Size.-101 in. by 4: in. Extent.-- 6 folios; 14 lines to a page ; 48 letters to a line. Description.-- Country paper very brittle, not very thin and quite grey in colour ; Jaina Devanagari characters; bold, legible, big, uniform and elegant hand-writing: borders ruled in four lines in black ink; all the four edges of almost every fol. more or less worn out; condition not satisfactory; this Ms, contains both the text and the commentary ; both complete ; fol. ra blank. Age.-- Samvat 1697. Author of the commentary.- Dvija Parsvadeva Gami. Subject. The text consists of s gathas only. The Sanskrit con mentary throws light on the yantras and mantras pertaining to them.

Page #226
781.} III. 4 Mulasutras Begins -- ( text ) fol. 1" uvasaggaharaM etc. as in No. 767. -- (com) fol. 1h 35 dharaNeMdra namaskRtya / zrIpArzva munipuMgavaM / upasarga hara stotravRttiM vakSye samAsataH // 1 // praNatasurAsuralalATavinyastamukuTazreNisamAzritameva ca / etc. Ends.~~~( text ) fol. 63 iya saMdhuo etc. up to pAsa jiNacaMda as in No. 767. -( com.) fol. 66 sarvakalyANaM saMpakarI yaMtraM bhavati // cha // dvijapArzvadeva gaNiviracite yatkimapi dharaNeMdrapArzvayakSaH padmAvatIpramukhAni svadevatAbhima kSamitavyamiti // yaJca kiMcidviru (Da) yaMtra maMsita ( ) sarvasya mithyA duSkRtamiti // cha // iti zrIuvasaggaharastotrasya vRtti samAptaM // saMvatsare zrIvikramanRpatau saptanaMdakAyabhU (1693 ) yute / varSe AzvinamAse zukapakSe dugrgA ( ga ) STamyAM tithau || liSitaM jagajIvanarSiNA svAtmahetave // kalyANamastu / bhAvyaM bhavatu / akkharamattAhINaM / jaM maya (yA) lihiyaM ayANamANeNaM / taM Sa (kha)mahamujja sAmI / jiNaMdamuhAneggayA vANI // 'zAladurge' sthite sati / leSakapAThakayorjayaH // cha // 6 189 Reference.-- Edited by me and published in the D. L. J.P.F. Series as No. 80, along with Priyankaranrpakatha etc. This Ms. is there designated as kha. upasarga hara stotra TIkAsahita No. 781 Extent. - fol. 23 to fol. 3b. Description. Both the text and the commentary complete; the For other details see Namas former contains five verses. karamantra with vrtti No. 740. Upasargaharastotra with tika Author of the commentary.-- * Siddhicandra Gani, pupil of Bhanu candra. For details see p. 163. 885 (b). 1892-95.

Page #227
190 Jaina Literature and Philosophy 1781. Subject.-- The text and its explanation in Sanskrit. Begins.-- (text) fol. 2" udhasaggaharaMpAsaM etc. as in No. 779. , --(com.) fol. 24 atha paMcAzItyadhikazatAkSaramAnasya / upasargaharastotra syeyamAdyAM gAthAmAha / uvasaggeti / ahaM zrIpAca pArzvanAthaM vadAmi abhi Taumi vaduGa abhivAdanastutyoriti dhAto rUpa etc. Ends.-- ( text) fol. 3* iya saMthuo etc. up to pAsajiNacaMda / 5 / as in No. 780. This is followed by ityupasa[va]gaharastotra / ,, -( com. ) fol. 3deg sAmAnyakevalinasteSu caMdra iva caMdrastasya saMbodhanaM he jinacaMdra tatpuruSaH / tvaM arthAnmahyaM bodhi ratnatrayaprAptiM pretya jinadharmAvAptiM vA dehi pravitaretyarthaH / kasmin bhave bhave janmani janmani / yAvanmokSa na prApnomIti bhAvaH / idaM stotraM dharaNedrapadmAvatIpArzvayakSairadhiSThitamiti pakSe teSAM vyAkhyAnaM tu vRhadvattito draSTavyaM / 5 / iti pAdazAhazrIakabarajallAladInazrIsUryasahasranAmAdhyAyakazrI zatraMjaya' tIrthakaramocanasarvatragovadhanivartanAdyaneka sukRtavinirmApakamahopAdhyAyazrI bhAnucaMdragaNiziSyayugapadaSTottarazatAvadhAnacamatkRtapAdazAhazrIakabarajallAladInapAdazAhazrInUraddInajihAMgIrapradatta Suzphahama nAdirajjamAM dvitIyAbhidhAna mahopAdhyAyazrIsiddhicaMdragaNiviracitAyAM saptasmaraNaTIkAyAM upasargahara stotraTIkA samAptA // cha / Reference.--- Published see No. 767. upasargaharastotra Upasargaharastotis vRttisahita with vrtti No. 782 384 (d). 1871-72. Size.- Iot in. by 4g in. Extent.- fol. 63* to fol. 654. Description.--- Complete. For other particulars see sadayavatsasAvaliGgI N _384 (a). kathA No. 1871-72. Author of the commentary.-- Not mentioned. Subject.- The text is here looked upon as the 2nd smarana. Iti explained in Sanskrit.

Page #228
783.1 III. 4 Mulasutras Begins.- ( text ) fol. 634 uvasaggaharaMpAsaM etc. as is No. 767. ( com. ) fol. 63 atheti smaraNaM padArthoM lI (li )khitAnI(ni) ahaM pArzva pArzvanAthaM vaMde namaskAromi ( mI ) ti etc. Ends. -- ( text ) 65 iya saMthuo etc, up to bhave bhave pAsa jiNacaMda as in KHy 23 --- No. 767. ( com. ) fol. 65(c) caturdazadharapraNItatvAt sUtravat jJeyamiti dvitIya smaraNam 5 upasarga hara stotra avacUrisahita " iti zrIupasarga hara stotravRtti samAptam graMthAgraMtha samasta 1275 che yA pustakaM dRSTvA tAdRzaM likhitaM mayA yadi su (zu) ddhamasu (zu) ddhaM vA mama doSo na dIyate 1 saM. 1911 nA varSe zrAvaNasUda 1 vAra buddhe likhitaM paM. rAjavijayagaNI paM. uttamasatkatazISya munInIta vijayapaM rAjasatkapaThanArtha paropagArAya zrIdharmanAthajI prazAdAt zreyaM No. 783 Size. 10 in. by 43 in. Extent-- ( text ) 3 folios -- ( com. ),, "" ; 10 Description.- Country paper thick, rough and grey; Jaina Devanagari characters with gears; borders ruled in two lines in red ink, whereas edges at a distance of one inch from them in three lines in the same ink; the text occupies the central place, and the commentary, the space all around; this is a pacapATI Ms. ; red chalk used; edges of the foll very slightly damaged; both the text and the commentary complete; condition very good. Age.- Old. Author of the commentary. - Not mentioned. Subject. The text as before. The Sanskrit commentary though small is lucid and throws light on the mantras and yantras connected with the five gathas forming the text. " 191 7 lines to a page ; 40 letters to a line. [[" " " Upasargaharastotra with avacuri ; 50 643. 1892-95. >> "" "" 33

Page #229
192 Jaina Literature and Philosophy 1783. Begins.--( text ) fol. I' uvasaggaharaM etc. as in No. 767. ,, -(com.) fol. 11 stotrasyASTAtiriktaM zataM yaH kuryAjApaM paMcagAthAtmakasya / tasyAvazyaM maMca nazyati vighnA ___ staM niHzeSA vRNvate siddhayazca / / " (atra hi prathamagAthAyAM jagadvAllabhyakara etc. Ends.- (text ) fol. 3deg iya saMthuo etc. as in No. 767. ,, ---- ( com. ) fol. 3' prAkRte pAsajiNAya padmAvatI tAM caMdanyAhlAdayatIti __ tasyAmaMtraNa dIrghahasvau mitho vRta(ttau) iti hasvatre pAsajiNacaMdeti siddhaM / / iti upasarga( hara )stvaavcuuriH| upasargaharastotravRtti Upasargaharastotravrtti 1241 (b). No. 784 1884-87. Extent.- fol. Is to fol. 20. Description.- Complete; only the gates of the text are given. For other details see Namaskaramantravyakhya No. 744. Author.-- Harsakirti Suri. Subject.--- Sanskrit commentary on Upasargaharastotra, the 2nd smarana. Begins.- fol. 1 atha dvitIyasmaraNaM vyAkhyAyate upasargaharamiti idaM ca smaraNaM varAhamiha( hi )rakRtazrIsaMghopadvanivAraNArtha zrIbhadrabAhubhiH kRtaM ya0 zrIbhadrabAhusvAmino bhrAtA varAhamiha(hi)raH sa ca dIkSAM gRhItvA caMdraprajJaptisUryaprajJaptipramukhAdikaM zAstramadhItavAn etc. Ends.- fol. 20 ihAnye'pyarthAH saMti tathA pArzvayakSapakSe'pyanyo'rtho'sti para vistarabhiyA noktAH kiMtu mUlArtha eva vyAkhyAto'sti n This verse occurs by way of it juotation in Tarsukorti Suri's Upasanga stotravrtti on p. 14.

Page #230
785.1 upasarga hara stotravRtti No. 785 iti zrI dvitIyasmaraNaM samAptaM 2 Reference. This work is edited with this commentary by me, and it is published in Anekartharatnamanjusa (pp. 13-24) which is published in Sheth D. L. J. P. F. Series as No. Si in A. D. 1933. III. 4 Malasutras upasargaha (ra) stotre vRttiM zrIharSakIttiririmAM kRtavAn sukhAvabodha (dhAM) maMdamatInAM hitArthAya Begins. fol. 14 atha dvitIyaM smaraNaM vyAkhyAyate / Extent. fol. 1a to fol. 32. Description. Complete. For other details see Namaskaramantravyakhya No. 745. Ends. 193 Upasargaharastotravrtti 42 (b). 1874-75. gaumgciafa z? a etc., as in No. 784. fol. 3 seAnye'pyarthA: etc. up to hitArthAya practically as in No. 784. This is followed by fa fareHIngia: 12 || N. B. For other details see No. 784. 11

Page #231
194 prArthanAsUtra [ jaya vIyarAya ] No. 786 T Extent. fol. 190a. Description. Complete though it may appear to end abruptly. For other details see No. 1220 (I). 1884-87. Author. A Jaina saint. Subject. Jaina Literature and Philosophy This small work in Prakrit is a prayer to one who is free from attachment and aversion. It contains only two verses. Begins. fol. 190a Ends. fol. 190a I [786. Prarthanas tra [ Jaya viyaraya] 1220 (30). 1884-87. jaya bIyarAya jagaguru hoU ( u ) mama / tuhampabhAvao bhayavaM bhavanio maggANusAra ( ri ) yA iphalasiddhI / Reference. Published. See any printed edition of Pratikramanasutras where an additional portion containing two gathas and a Sanskrit verse is generally given. logaviruddhacA (cA) o | gurujaNavUyA paratthakaraNaM ca / sugura (ru) jogo tantrayaNasevaNA AbhatramakhaMDA / iti caityavaMdanaM // cha // For an extract containing these two gathas and the interpolated matter see B. B. R. A. S. vols. III-IV, pp. 398-399. This work is recently edited by me along with the Sanskrit rendering and Gujarati translation, and is publi shed together with an illustration indicating the posture to be taken up while reciting it, in "The Fifth Kiranavali" (Arhatajivanajyoti) on p. 94. Sec pp. 134 and 152.

Page #232
787.1 195 There are only two gathas (just given here in Pancasaka (IV, v. 33-34) in Caityavandanasatra (p. 114) commented upon by Haribhadra Suri, in Yogasastrd (III, p. 233 ), and in Acaradinakara (p. 271b). In the edition of Sravakanusthanavidhi (p. 31) containing Vandaruvrtti, we have these two gathas plus two other gathas and one verse in Sanskrit. In Santi Suri's Ceiyavandanamahabhasa (v. 846-849) we have, however, 4 gathas, the first commenc ing with grade and the last with vArijjai and the middle ones being those which are given here (i. e. in No. 786). For vivarana see Lalitavistara (pp. 114-1152), the svopajia vrtti (p. 233b) of Yogasastra, Abhayadeva Suri's vrtti (pp. 81 and 82) on Pancasaka, Acaradinakara ( p. 271 ), Vandaruvrtti (p. 32) and the svopajna vrtti (p. 164a ) on Dharmasamgraha. prArthanAsUtra Ill. 4 "Ubersicht uber die Avasyaka-Literatur" (p. 2) may be consulted. No. 787 Malasutras Extent. fol. 3a. Description. Complete. For other details see No. 734. Begins and Ends.-fol. 3a Prarthanasutra 1270 (10). 1887-91. jaya bafers (r) ctc. up to AbhavamakhaMDA // cha // as in No. 786 This is followed by iti zakrastava // cha // N. B.- -For additonal information see No. 786. I It is rather a strange thing that in the landarelli we have explanation of the first two gathas only. 2 This is a wrong nomenclature for this sutra.

Page #233
196 laina Literature and Philosophy 1788. Prarthanasutra prArthanAsUtra No. 788 1106 ( 9). 1891-95. Extent.- fol. 2a to fol. 2b. Description.-- Complete ; 2 verses in all. For other details see Namaskaramantra No. 736. Begins and Ends. - fol. 20 AT a Thig etc. , up to Hard as in No. 786. This is followed by a line as below: 2 iti praNidhAnadaMDaka' N. B.- For additional information sec No. 786. prArthanAsUtra l'rarthanasutra No. 789 1269 ( 21 ). 1887-91. Extent.-- fol. 26. Description. Complete. Herein we have one additional verse. For other details see Namaskara mantra No. 735. Begins and Ends.- fol. 26 Hu aturar etc. up to 34THATT ll as in No. 786.. This is followed by the verse as under :-- vArijai jai vi niyameNa baMdhaNaM / vIyarAya tuha samae / TE LE HA ESTAT Ha Palarg agro 113 11 N. B.--- For additional information sec No. 786. I Sec p. 134 where it is styled as Pranidhanasutra.

Page #234
790.1 III. 4 Malasatras 197 IryApathikIsUtra Iryapathikisutra (TriTTIETET) (Iriyavabiyasutta ) No. 790 1220 (8). 1884-87 Extent.--- fol. 1894. 1220 ( 1 ). Description. - Complete. For other details see No. 1884-87. Author.-- A Jaina saint. Subject. -- A Prakrit composition dealing with alocana. Begins. -- fol. 1892 ZECIFITT HERE inaa TITTEN TICH ATTAI icchaM / icchAmi paDikkamiDaM / iriyAbahiyAe / virAhaNAe : gamaNAgamaNe / TESTTEHU I ERUWHU I etc. Ends.--fol. 1892 STPEHTI up to ao PNEET A CHI Il etc. as in No. 794. Reference.- Published. See any printed edition of Pratikramana sutras. This work is edited by me, along with the Sanskrit rendering and Gujarati translation, and is published by Jivanalal Panalal in "The Fourth Kiranavali (Arhatajivanajyoti) on pp. 71-72. Haribhadra Suri's commentary (p. 573a) on Avasvakasutra, Yogasastra (III) and its svopajna commentary (pp. 2139-214a ), Acaradinakara (pp. 277-278a) and Vandaruvitti (p. 24 ) may be consuted. For an extract see B. B. R. A. S. vols. III-IV, p. 398. For the gates of this work and its explanation etc. in verses in Prakrit see Ceiyavandanamahabhasa ( v. 366-381 ). The svopajna commentary on Dharamasamyraha (pp. 1428-143) may be also consulted. See also" Ubersicht uber die Avasyaka-Literatur" (p. 2).

Page #235
198 Jaina Literature and Philosophy 1791. IyaryApAthakIsUtra Irvapathikisutra 1106 (11). No. 791 1891-95. Extent.-- fol. 2". Description.- Complete. Tor other details sce Namaskaramantra No. 736. Begins.--fol. 20 galardo Ferhe ctc. as in No. 790. Ends.---fol. 25 FEH241 etc. up to a practically as in No.794. This is followed by g N. B.- For additional information see No. 790. IryApathikIsUtra Irvapathikisutra 1269 (2). No. 792 1887-91. Extent.- fol. 16. Description.- Completc. For other details sec Namaskaramantra No. 735. Begins.-- fol. 1" ESTA TIChi ctc. as in No. 790. Ends.--fol. 1" S T alt etc. up to JIH ASTA E !!! !! 3 practically as in No. 790. N. B.-- For additional information see No. 790. IyApathikIsUtra lryapathikisitra No. 793 1270 (12) 1887-91. Extent.-- fol. za to fol. 3o. Description.-- Complete. For other details see No. 734. Begins.-fol. 3a Fazl Tio etc. as in:No. 790. Ends - fol. 3a. SIA(? )ar ctc, up to ata ZiH GET ! Z is in No. 794, N. B.-- lor additional iniormation sec No. 790.

Page #236
794. III. 4 Malasutras 199 IpithikIsUtra Tryapathikisutra 77 ( ). No. 794 1880-81. Extent.--- leaf 124* to leaf 1246. Description.- Complete. For additional particulars see Aganiikn 77 (I). vastuvicarasara N '' 1880-81.. Begins. -lcat 124* icchAmi paDikkamiu igyiAvahiyAe / virAhaNAe / gamaNA ___ gamaNe / pANakkamaNe / bIyakamaNe / etc. Ends. --- laet 124 antri(bhihayA vattiyA (lesiyA) saMghAiyA saMghaTTiyA ThANAo ThANaM saMkAmiyA jIviyAo vavaroviyA tassa micchA mi dukkaDaM

Page #237
200 Jaina Literature and Philosophy | 796. uttarIkaraNasUtra [ af TI ] No. 795 Uttarikaranasitra [Tassa uttari ) 77 ( ). 1880-81. Extent.-- leaf 124a. 77(1). Description.- Complete. For other details see No. 1 ! 1880-81.. Author.- Not mentioned. Subject. --A formula in Prakrit for further preparation to purify the defiled soul. This is styled as "Ummaggakaranasutta" (Unmargakaranasutra ) in Ceiyavandanamaljabhasa (v. 382'). Begins and Ends.--leaf 124a tassuttarIkaraNeNaM / pAyachi(ciTa )ttIkaraNeNaM / visohIkaraNeNaM / bisalI Frotai grarut I FFATUT I PAJETTUTEIS E ETA FISFIUTI Reference.--- Published in any of the editions of Pratikramanasutras noted on p. 138. This work is edited by me, along with the Sanskrit rendering and Gujarati translation, and is published in "The Fourth Kiranavali ( Arbatajivanajyoti ) on p. 73. For an extract see B. B. R. A. vols. III-IV, p. 398. Haribhadra Suri's commentary ( p. 779") on Avasyaka - sutra, Yogasastra and its svopajna vitti (p. 2149-2140), Acara linakara (p. 2782 ) and Devendra Suri's Vandaruvrtti (p. 27) are worth consulting. For vivarana in verses in Prakrit see Ceiyavandanamahabhasa ( v. 383-387). The svopajna comme:itary (p. 1440-144") on Dharmasamgraba may be also consulted. 1 This runs as under : "iriyAvahiyAsuttaM ettiyamettaM ao para sesaM / SFATTETUT SUR# 11 307 11

Page #238
1998. ] 111. 4 Malasatras 200 uttarIkaraNasUtra Uttarikara nasutra 1220 ( 9 ). No. 796 1884-87. Extent. -- fol. 189a. 1220 ( 1 ). Description.- Complete. For other details see No. CC NO. 1884-87. Begins and Ends.- fol. 1892 grupet etc. up to' JIH 515FATA I practically as in No. 795. N. B.--- For further particulars see No. 795. . uttarIkaraNasUtra Uttarikaranasutra No. 797 1106 (12). 1891-95. Extent.- fol. 2b. Description.- Complete. For other details see Namaskaramantra No. 736. Begins and Ends.- fol. 2' tata)ssuttarIkaraNeNaM etc. up to ThAmi EFTE#( FR )si as in No. 795. This is followed by : N. B.-- For additional information see No. 795. uttarIkaraNasUtra Uttarikaranasutra 1269 (3). 1887-91. No. 1798 Extent.- fol. 16. Description.- Complete. For other details see Namaskarainantra No. 735 Begins.-fol. 16 Apa UTU etc. up to JIA #13F I as in No. 795. N. B.-- For additional information see No. 795.

Page #239
202 Jaina Literature and Philosophy ( 799. uttarIkaraNasUtra Uttarikaranasutra No. 799 1270 (13) 1887-91. Extent.-- fol. 36. Description.- Complete. For other details see No. 734. Begins and Ends.- fol. 3b Gratatuto etc. up to ah #13# # ]ooi! as in No. 795. N. B.- For other details see No. 795.

Page #240
800.1 III. 4 Malasatras 203 kAyotsargasUtra Kayotsargasutra ( 37773] [ Annattha ] No. 800 1220 (10). 1884-87. Extent.- fol. 1892. Description. Complete. For other details see No. 1815. 1220 (1). Author. - A Jaina saint. Subject.-- This small work composed in Prakrit explains how one is going to act-what allowances he will make-during the kayotsarga posture. Begins.fol. 1899 sayaAGOT IS THAT GOT I FTATUT I GO AHEGOTI gyvu i arafaremoto I HATEST TETT I etc. Ends.-- fol. 1898 ET A 415#()FTTT I Fra SE aru aid FANATO na ppa(pA)remi tAya kAyaM / ThANeNaM / / mA(mo)jeNaM / jhANeNaM / appANaM vosirAmi 11 711 Reference.-- Published. See any printed edition of the Pratikra manasutras. For the text, its chaya, Gujarati translation and the posture see my fourth Kiranavali (pp. 74-75). Haribhadra Suri's commentary (p. 7798 ) to Avasyakasutra, Yogasastra (III) and its svopajna commentary (pp. 2146-2156), Acaradinakara (p. 311-3110 ) and Vandaruvstti (pp. 155 to 166 ) may be consulted. For an extract see B. B. R. A. S. vols. III-IV, p. 398, and for explanation in verses in Prakrit see Ceiyavandanamahabhasa ( v. 427-497). The svopajna commentary (pp. 144-1459) on Dharmasamgraha may be also consulted. ! See p. 134.

Page #241
204 kAyotsarga sUtra No. 801 Begins. fol. 2 Ends. fol. 2b -- Jaina Literature and Philosophy Extent. fol. 2b. Description. Complete. For other details see Namaskaramantra No. 736. fag etc. as in No. 800. hujja 'me kAusa (ssa) ggo etc. up to appANaM vosirAmi chaH practically as in No. 800. [ 801. Kayotsargasutra 1106 (13). 1891-95. N. B. For additional particulars see No. 800. kAyotsarga sUtra No. 802 Extent. fol. 3b. Description. Complete. For other details see No. 734. Begins. fol. 3 fg etc. as in No. 800. Ends. fol. 30 hajja me kAusa ( sa )ggaM / etc. up to N. B. For additional particulars see No. 800. avvANaM vosirAmi // cha // as in No. 800. Kayotsargasutra 1270 (14). 1887-91. kAyotsarga sUtra No. 803 Extent. fol. rb. Description. Complete. For other details see Namaskaramantra No. 735. Kayotsargasutra 1269 (4). 1887-91.

Page #242
8os.] III. 4 Mulasatras 205 Begins.-fol. I' annattha (U)sasieNaM etc. as in No. 801. Ends.-fol. I" hoja me kAusa(ssa )ggo etc. up to appANaM vosirAmi // // practically as in No. 801 N. B.- For additional information see No. 800. kAyotsargasUtra Kayotsargasutra No. 804 1269 (8) 1887-91. Extent.- fol. 2'. Description.- Complete but mostly abbreviations are given. For other details see Namaskaramantra No. 735. Begins and Ends.-fol. 2 annatthUsasieNaM nI khA. chI0 jaM. u0 vA. bha. pittamucchAe 4 su su su eva 5 kAussaggo 6 jAva na pAromi / 7 tAva vosirAmi ||ch| ___N. B.-- For additional information see No. 800. kAyotsargasUtra No. 805 Kayotsargasutra 17 ( ). 1880-81. Extent.--- leaf 1216 to leaf 1228. Description.- Complete. For other details see Agamikavastuvicara _sara No. ___77 ( 1 ). Sara No. 1880-81.. Begins.- fol. I21' annatthusasieNaM etc. Ends.-fol. 122 abhaggo avirAhio hoja me kAusa( ssa )go / jAva arhNtaannN| bhagavaMtANaM / namokkAreNaM na pAremi tAva kAya ThA(ThANeNaM / moNeNaM / jhANeNaM appANaM vosirAmi // cha / N. B.- For further particulars see No. 800.

Page #243
206 Jaina Literature and Philosophy kAyotsarga sUtrapratIka No. 8061 Extent. fol. 4" to fol. 4b. Description. Kayotsargasutrapratika 1270 (17). 1887-91. Only a off is given. For other details see No. 734. Subject. Begins and Ends.-fol. 4a to fol. 4b annatthUsasiNamityAdi // N. B. For further particulars see No. 800. [ 806. The Kayotsargasutra is referred to by its opening words. kAyotsargasUtrapratIka No. 807 Extent. fol. 190". Description. Only a at is given. For other details No. 1220 (1). 1886-87. ' Begins and Ends.-- fol. 1901 annanbhUsasieNamityAdi // cha // N. B. For additional particulars see No. 806. Kayotsargasutrapratika 1220 (24). 1884-87. 1 This and the following numbers up to 813 do not deserve to be counted as separate works; but, even then, a separate serial number is given to them to point out the nature and continuity of works treated in the corresponding Mss. see

Page #244
810.) 111. 4 Malasatras 207 kAyotsargasUtrapratIka Kayotsargasutrapratika No. 808 1270 ( 23 ) 1887-91. Extent.-- fol. 5a. Description.- Only cares are given. For other details see No. 734. Begins and Ends.- fol. 5* BERTOTI ACUACAT N. B.- For additional particulars see No. 806. kAyotsargasUtrapratIka Kayotsargasutrapratika 771 ). No. 809 1880-81. Extent.--- leaf 124". Description.-- Only a state is given. For other details see NO. 1880-81.. Begins and Ends.-- FHOR TATT EFTIR I I I N. B. For further details see No. 806. No. 77 (1). kAyotsargasUtrapratIka Kayotsargasutrapratika No. 810 1269 ( 15). 1887-91. Extent.-- fol. 22. Description.- Only a gata is given. For other details see Namas karamantra No. 735. Begins and Ends.-fol. 20 part gronie II N. B.- For additional information see No. 806.

Page #245
208 kAyotsarga sUtrapratIka No. 811 - Extent. fol. 3a. Description. Begins and Ends. fol. 34 annattha UsasieNaM ityAdi N. B. For additional particulars see No. 806. kAyotsarga sUtrapratIka No. 812 Jaina Literature and Philosophy kAyotsarga sUtrapratIka Only a cha is given. For other details see No. 736. -- Kayotsargasutrapratika 1106 (16). 1891-95. Extent. fol. 3. Description. Only as are given. For other details see Namaskaramantra No. 736. Begins and Ends.-- fol. 30 annattha Usa ityAdi 0 N. B.-- For further particulars see No. 806. No. 813 Extent. fol. 189b. Description. No. [ 811. Kayotsargasutrapratika 1106 ( 22 ). 1891-95. Kayotsargasutrapratika 1220 (19). 1884-87. Begins and Ends.-- fol. 189 annatthUsasiNamityAdi // cha // N. B. For additional particulars see No. 806. Only a res is given. For other details see 1220 ( I ). 1880-87.

Page #246
814] III.4Malasalras 209 nAmastava Namastava [ logassasutta] [ Loyassasutta] 1220 (11). No. 814 1884-87. Extent.- fol. 1894. 1220(I). Description.- Complete. For other details sce No. - 1884-87.. Author.- A Jaina saint. Subject. -- This sutra composed in 7 verses in Prakrit culogizes the 24 Tirthainkaras of this avasarpini cycle of time. It is hence styled as Cauvvisattho (Sk. Caturvimsatistava ). This sutra forms a part of the Avasyakasutra. Begins. --fol. 189a logassujo(jjo yagare / dhammatitthayare jiNe / arahate kittaissaM / cauvIsa pi kevalI // 1 usabhamajiyaM ca vaMde / saMbhavamabhinaMdaNaM ca sumaI ca paumappu(ppa)haM suppA(pA)saM jiNaM caya(ca)dappahaM vaMde // 2 // etc Ends. -- fol. 1892 caMdesu nimmalayarA / Aiccesu ahiyaM payAsa(ya)rA / sAgaravaragaMbhIrA / siddhA siddhiM mama disaMtu // 7 Reference.- Published. See any printed edition of the Pratikra manasutras and my third Kiranavali (pp. 54-56). For a learned discussion in German see " Ubersicht uber die Avasyaka-Literatur" (pp. 6-7). Herein the text is given in Roman characters. An edition containing Haribhadra Suri's commentary (p. 786a ) to Avasyakasutra, an cdition having Malayagiri Suri's commentary (pp. 591-599 ) to the same, Yogasastra (pp. 224-228a ), Acaradinakara (pp. 2674-268a) and Vandaruvrtti (pp.40-13) may be consulted. Fo: an extract see B. B. R. A. S. rol. III-IV, p. 398. For explanation Ceiyavandanamahabhasa ( v. 515-638) may be referred to. See also Mulacara v. 539 and No. 818. -

Page #247
210 nAmastava No. 815 No. 734. Begins. fol. 3b Ends. fol. 4a Extent. fol. 3b to fol. 4a. Description. Complete; 7 verses in all. For other details see nAmastava No. 816 Jaina Literature and Philosophy gs etc. as in No. 814. N. B.-- For additional information see No. 814. Ends. fol. 1b caMdesa (su) nimmalagarA / etc. up to mama disaMtu // 7 // [815. Namastava 1270 (15). 1887-91. nAmastava No. 817 Extent. fol. 2b to fol. 32. as in No. 814. Extent. fol. 1. Description. Complete; 7 verses in all. For other details see Namaskaramantra No. 735. Begins.-tol. 1b N. B. For additional information see No. 814. gian etc. as in No. 814. caMde nimmalayarA etc. up to siddhiM mama disaMtu // 7 Namastava 1269 (5). 1987-91. as in No. 814. Namasts va 1106 (14). 1891-95.

Page #248
818. ] III. 4 Malasutras 211 Description.- Complete ; 7 verses in all. For other details see Namaskaramantra No. 736. Begins.- fol. 2b TRUTH FFATTO etc. as in No. 814. Ends.-- fol. 3a etc. up to IFTI AR PERTU as in No. 814. N. B.-- For additional particulars see No. 814. nAmastava Namastava No. 818 77( ). 1880-81. Extent.--- leaf 122deg to leaf 1234. Description -- Complete. For other details see Agamikavastuvicara sara No. 77 (1). 0. 1880-81. Begins.-leaf 122a FINEP G ANT etc. as in No. 814. Ends.--leaf, 1234 faFagurt etc. up to FFI AH 10! . as in No. 814 N. B.- For further particulars see No. 814 and an edition con taining Caityavandanasutra and Lalitavistara (pp. 895-966) and Dharmasamgraha ( pp. 1551--198a).

Page #249
212 caityastava [ arihaMta ceiyANaM ] No. 819 Extent. leaf 121b to leaf 122a. Description. Complete. For further particulars see Agamika77 ( I ). 1880-81. vastuvicarasara No. Jaina Literature and Philosophy Author. A Jaina saint. Subject. This work is included in the Avasyakasutra. It is one of the Pratikramanasutras in Prakrit and constitutes the Caityastavadandaka. It is connected with the aradhana of Sthapanajina. This work mentions the reasons of doing so. Begins. - leaf 121 arahaMtaceiyANaM | karemi kAussaggaM / vaMdaNavattiyAe / jha(pU) paNavattiyAe / sakkAravattiyAe / sammANavattiyAe / etc. arataa Fnds.-- leaf 1222 si ( sa ) ddhAe / mehAe / dhIie / dhAraNAe / aNuppehAe / baDhamANIe / DAmi kAusaggaM No. 820 [819. Crityastava [Arihantaceiyanain] 77 ( ). 1880-81. Reference. Published. See any printed edition of the Pratikramanasutras. For chaya and Gujarati translation along with the text see my fourth Kiranavali (p. 76). Haribhadra Suri's commentary (p. 786a) to Avasyakasutra, Vandaruvrtti (pp. 36-37), Yogasastra and its commentary (pp. 223-2242), Ceyiavandanamahabhasa (v. 642-652) and an edition having Lalitavistara (pp. 76b-84b) may be consulted. For an extract see B. B. R. A. S. vols. III-IV, P. 398. Ubersicht uber die Avasyaka-Literatur (p. 2) may be also referred to. Extent. fol. 42. Description. Complete. For other details see No. 734. Begins. fol. 4 sie scgnaguoi etc. as in No. 819. Caityastava 1270 (16). 1887-91.

Page #250
823.] Mulasutras Ends. fol. 44 saddhAe mehAe etc. up to ThAmi kAusa (rasa)ggaM as in No. 819. N. B. For additional information see No. 819. caityastava No. 821 Extent. fol. 1896. Description. Complete. For other details see No. a?ataa No. 822 III. 4 #rama No. 823 Extent. fol. 2a. Begins. fol. 18ybar etc. as in No. 819. Ends. fol. 1896 sAe mehAe / dhI (i) e dhAraNAe / aNupe ( ppe ) hAe / vaddhamANIe / ThAmi kAusa (rasa)ggaM / N. B. For other details see No. 819. Caityastava 1220 (18). 1884-87. 1220 ( I ). 1884-87. 213 Extent. fol. 3a. Description. Complete. For other details see Namaskaramantra No. 736. Begins. fol. 3a edic aftenen etc. as in No. 819. Ends. -- fol. 3 saddhAe mehAe etc. up to ThAmi kAusa ( sa ) gaM as in No. 819. N. B. For additional particulars see No. 819. Caityastava 1106 (15). 1891-35. Caityastava 1269 (7). 1887-91.

Page #251
214 Jaina Literature and Philosophy [ 823. Description.- Complete. For other details see Namaskaramantra No. 735. Begins.- fol.2a stea agului etc. as in No. 819. Ends.-- fol. 2a FEIT ATIC etc. up to JIA FISH as in No. 819. This is followed by 2. N. B. - For additional information see No. 819. caityastava Caityastava 1269 (9). No, 824 1887-91. Extent.-- fol. 2a. Description. Only the opening line is given. For other de:ails sec Namaskaramantra No. 735. Begins and Ends.-- fol. 2a savvaloe arihaMtaceiyANaM karomi kAussaggaM vaMdaNavattiyAe ityAdi cha N. B.- For additional information see No. 819. caityastava Caityastava 1270 ( 20 ). No. 825 1887-91. Estent.-- fol. 46. Description --- Only a portion is actually mentioned. For other details see No. 734. Begins and Ends.--- corallarg i gorra Torg i Graf 113 11 N. B.-- For additional information see No. 819.

Page #252
829. ] #razaagai No. 826 Extent. fol. 189". Description. caityastavapratIka No. 827 caityastavapratIka No 828 I Only the as of this sutra are given. For details 1220 ( I ). see Pratyakhyananiryukti No. 1884-87. Begins and Ends. - fol. 1894 sabaloe arahaMtaceiyANamityAdi // It ends thus. acutagaia No. 829 III. 4 Malasatras Extent. leaf 123. Description. Only a ch is given. Begins and Ends. - leaf 1236 vaMdaNavattiyAe ityAdi // cha // N. B. For additional information see No. 819. Extent. fol. 3b. Description. 215 Caityasta vapratika 1220 (12). 1884-87. Extent. fol. 2a. Description. Only a t is given. For other details see Namaskaramantra No. 735. Begins and Ends. fol. 24 vaMdaNavattItyAdi // cha // N. B. For additional information see No. 819. Caityastavapratika 77 ( ). 1880-81. Caityastavapratika 1269 (12). 1887-91. Only a T is given. For other details see Namaskaramantra No. 736. Caityastavapratika 1105 (19). 1891-95. I The remark made (on p. 205) in connection with Kayotsargasutrap.atika holds good in the case of this and the willgnoof works 827 $29.

Page #253
216 [829. Jaina Literature and Fhilosophy Begins and Ends. -- fol. maT FROITE. N. B.-- For additional information see No. 819. zrutastava [ gata] No. 830 Srutastava [ Pukkbaravara ] 771 ). 1880-81. Extent.- leaf 123a to leaf 1236. Description. - Complete. For further particulars see No. 1880-81.' Subject.- One of the Pratikramanasutras in Prakrit. Sukhlal does not consider this sutra as a part and parcel of Avasyakasutra. For his remark see his prastavana (p. 45 ) to his edition of Pancapratikramana. This sutra consists of 4 verses in Prakrit. The first deals with salutation to the Tirthaikaras and the next three with the eulogy of srutadharma. Begins.-- fol. 1234 pukkharavaradIvar3e dhAyaisaMDe ya jaMu(bu )dIve ya HIETagfah I JEIGUTT HARIH IS etc. Ends.-- fol. 1236 siddhe bho payao Namo jiNamae naMdI sayA saMjame devanAgamuvannakinnaragaNassanbhUabhAvaccie / logo jattha paiTrio jagamiNaM telukkamaccAsuraM dhammo baTTAu sAsao / vijayao dhammottaraM vaDau // 4 Reference.- This work also known as Siddhantastava is published. See any printed edition of the Pratikramanasutras. Haribhadra Suri's commentary (p. 788a) on Avasyakasulra, the edition containing Caityavandanasutra and Lalitavistara (pp. 978-106") and Vandaruvitti (pp. 45-18) may be consulted. Also see Ceiyavandanamahabhasa ( v. 653-699). For an extract sec B. B. R. A. S. vols. III-IV, p. 398. The portion of the 2nd line of the last verse viz. aanuaoo is quoted by Jinaprabha Suri in his commentary (p. 10 ) to Upasargaharastotra. Vide D. L. J. P. F. Series, No. 81. "Ubersicht uber die Avasyaka-Literatur" (p. 2 ) may be consulted.

Page #254
833.1 zrutastava No. 734 Begins.fol. 4o gara etc. as in No. 830. zrutastava III. 4 Malasutras No. 831 Extent.- fol. 4. Description. Complete; 4 verses in all. For other details see No. 832 Extent. fol. 2a. Ends. fol. 4deg dhammo baDDo (DDU )o etc. up to dhammuttaraM bahuo / as in No. 830. This is followed by N. B. For additional information see No. 830. zrutastava 217 Srutastava No. 833 Extent. fol. 187 to fol. 190. Description. Complete. For other details see No. 1270 (18). 1887-91. Description. Complete; 4 verses in all. For other details see Namaskaramantra No. 735. Begins.--fol. 2a gara etc. as in No. 830. Ends.--fol. 2(c) dhammo baDDUo etc. up to dhammottaraM vaDUo as in No. 830 This is followed by 8. N. B. For additional information see No. 830. Srutastava 1269 (10). 1887-91. Srutasta va 1220 (20). 1884-87. 1220). 1884-87. Begins. fol. 1896 | etc. as in No. 830. Ends. fol. 1904 dhammo baDhau sAsao / vijayao dhammuttaraM bahuo as in No. 830. N. B. For other particulars see No. 830.

Page #255
218 zrutastaya No. 834 Jaina Literature and Philosophy | 834. Srutastava Extent. fol. 3a. Description. Complete; 4 verses in all. For other details see Namaskaramantra No. 736. 1106 (17). 1891-95. Begins. fol. 32 g etc. as in No. 830. Ends. fol. 34 dhammo baDUo etc. up to dhammottaraM bahuo as in No. 830. This is followed by 8. N. B. For additional information see No. 830.

Page #256
835. ] III. 4 Malasatras 219 siddhastava Siddhastava [Agroi garu) [ Siddhanai buddhanar ] No. 835 1220 ( 22 ). 1884-87. Extent.-- fol. 1904 Description. Complete ; 5 verses in all. For other details see No. 1220 ( 1 ). No. 1884-87. Author.--- A Jaina saint. Subject.- This small metrical composition in Prakrit is a hymn which praises the liberated. Begins.--fol. 1908 siddhANa buddhANaM / pAragayANaM paraMparagayANaM / ENTER( ? JU ATUT I TAET (TOT Heatergrant ut etc. Ends.- fol. 1902 cattAri aTU dasa do ya bNdiyaa| jiNavarA cauvIsaM / paramaniTriyaTTA siddhA siddhiM mama disaMtu // 4 (? 5) Reference.- Published. See any printed edition of the Pratie kramanasutras. Haribhadra Suri's coinmentary' (p. 789) to Avasyakasutra where the first 3 verses are explained, the edition of Caityavandanasutra with Lalitavistara 2 (pp. 106-118) and Vandaruvitti (pp. 49-51 ) may be consulted. For an extract sec B. B. R. A. S. vols. III-IV, p. 398. For different interpretations of the last verse given here, see my edition containing Bhava prabha Suri's Jaina. dharmavarastotra etc., published as No. 84 in the Sheth D. L. J. P. F. Series, in A. D. 1933. Sukhlal does not consider this sutra as a part of the Avasyakasutra. For his remark see his prastavana (p. 45) to his edition of Panca pratikramana. Ceiyavandanamahabhasa (v.711-771) and Ubersicht uber die Avasyaka-Literatur ( p. 2) may be consulted. a 1 On p. 789a, there is a remark as under : "aa: Ti fa ra, PT 2119 216, 2175 2 On p. 112b, it is stated that "N a it faguara, Fla 219:1" ei 316

Page #257
220 siddhastava No. 836 Extent. fol. 2a. Description. No. 735. Begins.-- fol. 2a Ends. fol. 2a siddhastava No. 837 Jaina Literature and Philosophy Ends fol sa cAri aTTa etc. up to mama disaMtu // as in No. 835. This is followed by ". N. B. For additional information see No. 835. Complete. For other details see Namaskaramantra for etc. as in No. 835. [836. Siddhastava Extent. fol. 4" to fol. 5a. Description. Complete. For other details see No. 734. Begins.--fol. 4b far etc. as in No. 835. canAri N. B. For additional information see No. 835. 1269 (13). 1887-91. Siddhastava 1270 (21) 1887-91. anu etc. up to a gas in No. 835.

Page #258
839.) siddhastava No. 838 Extent. fol. b. Description. No. 736. Begins. fol. 3b Ends.-- fol. 3b siddhastava No. 839 fr gero etc. as in No. 835. ill. 4 Malasutras Complete. For other details see Namaskaramantra cattAri aTTa etc. up to mama disaMtu / as in No. 835. This is followed by ". N. B. - For further particulars see No. 835. vastuvicarasara No. Begins. leaf 123b Ends. leaf 124a Extent. leaf. 123 to leaf 1242. Description. Complete. For additional details see Agamika 77 (1).. 1880-81. for etc. as in No. 835. 221 Siddhastava N. B. For additional information see No. 835. 1106 (20). 1891-95. cattAri aTu etc. up to a etc. as in No. 835 Siddhastava 77 ( ). 1880-81.

Page #259
222 Jaina Literature and Philosophy 1840. caityavandanasUtra (ceiyavaMdaNasutta) TabbAsahita Caityavandanasutra ( Ceiyavaydanasutta ) with tabba 690. No. 840 1892-95. Size.-- Io in by it in. Extent.---- 7 folios ; II lines to a page ; 40 letters to a line. Description.-- Country paper thin, tough and white ; Jaina Deva nagari characters with occasional pRSTamAtrAs; big, clear, uniform and good hand-writing; borders ruled in four lines in black ink ; white pigment used : foll. numbered in both the margins ; complete so far as it goes; condition very good. Age.-- Pretty old. Author of the text.- Not mentioned. ___, , , rabba.-, ,, Subject.---- This Ms. starts with the enumeration of 4 mangalas and 4 Saranas. Then follows the exposition of the charac. teristics of a Tirthamkara in verses in Prakrit. Namutthunam along with its explanation in Gujarati forms the succeeding topic. The distinguishing features of the liberated, the Acaryas, Upadhyavas and Sadhus make up the concluding portion of this Ms. Begins.-- ( text ) fol. I zrIvItarAgAya // cattAri maMgalaM / arihaMtA maMgalaM // siddhA maMgalaM // sAhu maMgalaM // kevala(li)pannatto dhammo maMgalaM // cattAri logutta(mA) // arihaMtA loguttamA // siddhA loguttamA / sAha loguttamA / kevalipannatto dhammo loguttamA // cattAri saraNaM pavvajjAmi // arihaMtA saraNaM pavvajjAmi // siddhA saraNa patvajjAmi / / sAhU saraNaM payajjAmi // keva(li)pannatto dhammo saraNaM pandhajjAmi / gaathaa|| cauraMgo jiNadhammo / na kayo cauraMgasaraNi jiNa na kyo| cauraMgo bhavachoho / na kayo tiNi hAriu jammo / dullaMbho mANuso jammo / dhammo savvannabhAsio / mAha sAhamIyANaM ca / sAmaggI puNa dullahA // 2ec.

Page #260
840. | III. 4 Malasatras 223 (text) fol. 10 jagamattha itthayANaM / vayasIlavaranANadaMsaNadharANaM / nANaM joyagirANaM // logami namo zrI(siri )jiNavarANaM // 18 // icchaM icchAmi khamAsamaNo baMdiuM // jAvANijjAe // nisIhiyAe / matha(ttha)eNa vadAmi // Begins.- ( tabba ) fol. I icchAkAreNa saMdimaha / bhagavana caityavaMdana karUM / nissIhaM // namotthu NaM / namaskAra hau // arihaMtANa / arihaMtanada / paNi kisyA chai te zrIarihaMta / jAtivaMta / kulavaMta / balavaMta // rUpavaMta / jJAnavaMta / zrutavaMta / saubhAgyavaMta / etc. ( tabba ) fol. 4" namo AyariyANaM / mAharau namaskAra zrIAcArya pratiI hau // paNi kisyA chaiM te zrIAcArya / je zrIAcArya paMca ghiddhi AcArU pratipAlai etc. Ends.- ( text ) fol. 58 paDirUvAI caudasa // ( kha )tIpamuhAI dasaviho dhammo / bArassa baMbhovaNAe / sUriguNA hu~ti uttIsA // 5 // paMciMdiyasaMvaraNo / nvvihbNbhcerguttidhro| cauvihakasAyamukko e aTArasaguNehiM saMjutto / / 6 / / paMcamahanvayajutto / paMcavihAyArapAlaNasamattho / paMcasamaI(? o) tigutto / chattIsaguNe( No) guma(rU) majjha // 7 // etc. ---- (tabba) fol. 7deg kummo vaha guttidie| puDhavI jima sambasahe / samudra jima gNbhiire| pukkhariNIpatra jima nirlepai / isyA chaiM je maadh|| bhagavatI dayA taNA pratipAlaka / bhagavatI ahiMsA sarvabhUtanaI pemakArI / mA(?)puruSa sapuruSi sevI / kAyara kAtara janiI pariharI / tehanA pratipAlaka / / anAtha jIvanA nAtha / apIhara jIvanAM pIhara / azaraNa jIvanAM zaraNa / sarvajJaputra sAdhu / nIrAga / nikaMcaNa / nirahaMkArI / ni( )parigrahI / niraarNbhii| zAMta dAMta / ratnatrayasAdhaka / aDhAI dvIpa mAhiiM je keI chaI sAdhu // te mavi huM mAdhu pratiI mAharu namaskAra / paMcAMga praNAma trikAla baMdana sadA sarvadA hau // iti zrI. caityavaMdanapAMcapadanavakAra samAptaH // zrIH / / cha / zrIH / /

Page #261
224 Jaina Literature and Philosophy [841 lalitavistarA Lalita vistara (caityavandanasUtravyAkhyA) ( Caityavandanasutravyakhya 1241. No. 841 1886-92. Size.-- 10 in. by 4 in. Extent.-- 38 folios ; 13 lines to a page : 45 letters to a line. Descriprion.-- Country paper tough and white ; Jaina Devanagari characters; big, legible, uniform and good hand-writing; borders ruled in three lines in red ink, and edges singly; fol. I blank ; so is the fol. 386 ; this Ms. contains the pratIka of the text : foll. numbered in the right-hand margin only; condition very good ; extent 1270 slokas. Age.- Samvat 1825. Author.- Haribhadra Suri (Yakinimahattarasanu ). See pp. 104-I0S and Weber II, p. 924, fn. 4. Subject. -- A very beautiful, important, interesting and instructive commentary (vyakhya) on Caityavandanasutra. This vyakhya also styled as vitti is at times mistaken for Lalita vistara, a Buddhist work. Begins.-fol. 1 9 namaH zrIvIrasvAmine / / praNamya bhuvanAlokaM mahAvIraM jinottamaM / caityavaMdanasUtrasya vyAkhyeyamabhidhIyate // 1 // anaMtagamaparyAyaM srvmetjjinaagme| mUtraM yato'sya kAtsnyena vyAkhyAM kaH kartumIzvaraH ? // 2 // etc. ityatrAha ciMtyamatra sAphalyaM caityavaMdanasyaiva niHphalatvAt ityatrocyate etc. Ends.-fol. 38 prakRtisuMdaraM ciMtAmaNiratnakalpaM saMvegakArya vaitari(di)ti mahAkalyANa virodhe na ciMtAmaNiratne(5)pi samyagjJAnaguNa eva zraddhAdyatizayabhAvato'vidhiviraheNa mahAkalyANasiddhiH ityalaM prasaMgena AcAryaharibhadreNa dRndhA sannyAyasaMgatA caityavaMdanasUtrasya vRttilalitavistarA // 1 // ya enAM bhaavytyuccairmdhysthenaaNtraatmnaa| savaMdanAM sabIjaM vA niyamAdadhigacchati // 2 //

Page #262
841.] III. 4 Malasutras 225 parAbhiprAyasaM(ma)jJAtvA tatkRtasya ca vstunH| guNadoSau satto(tA) vAcyau prazna eva tu yujyate // 3 // praSTavyo'nyaH parIkSArthamAtmano vA parasya ca / jJAnasya vA(cA)bhivRddhyartha tyAgArtha saMzayasya ca // 4 // (ka)tvA yadajitaM puNyaM mayainAM zubhabhAvataH / tenAstu sarvalokAnAM mAtsaryavirahaH paraH // 5 // lalitavistarA nAma caityavaMdanavRttiH samAptaH (tA) ||ch // kRtiriyaM yAkinIdharma sUnorAcAryaharibhadrasyeti graMthAyamanuSTupchaMdasA zloka zatAni dvAdaza saptatyA samanvitAni aMki(ka)to(s)pi / graMthAyazloka 1270 pramANamata (?) // saMvat 1825 mArgazira sudi 7 sAtima vAra zukre / paM0 bhu(bhU)pativijaya la(li )pIkRtaM // zrI sthaMbhatIrthe ' / cha etc. Reference. -- Published in D. L. J. P. Fund Series as No. 29 in A. D. 1915. This edition contains Municandra Suri's panjika which explains some portions of Lalitavistara. Over and above this, the following sutras are given in this edition : (a) Namutthu nam pp. 70-84. . (b) Caityastava p. 760. (c) Kayotsargasutra p. 84. (d) Caturvinsatistava pp. 896, 92, 93* and 966. (e) Srutastava pp. 97deg, 100deg, Ior, Ior' and 1024. (f) Siddijastava' pp. 1066 and 1092. (g) Prarthanasutra p. 114. These sutras along with Lalitavistara have been published by Rsabhadevaji Kesarimalaji Samstha, Rutlam, in A. D. 1934, since the above-mentioned edition: has been long sincu unavailable. For an additional Ms. see B. B. R. A. S. vols. III-IV ( pp. 123-424 ), and for a Ms. *of this Lalitavistari along with a supercommentary by Municandra see Keith's Catalogue No. 7496. ___Kielhorn's Report for 1880-81 (p. I4) may be also consulted. | Ouly 3 verses tre given

Page #263
226 lalitavistarA No. 842 Size. 10 in. by 4 in. Extent. 24 folios; 15 lines to a page; 60 letters to a line. Description. Country paper thin, rough and whitish; Jaina Devanagari characters with gears; small, legible and tolerably good hand-writing; borders ruled in two lines in black ink; foll. numbered in the right-hand margin just at its foot: ; tol. a blank this Ms. seems to be exposed to fire; several foll. less legible, on account of ink having spread out or perhaps due to the portion being sooty; bits of paper pasted to the last few foll; condition on the whole unsatisfactory; this Ms. contains only the gates of the text complete; marginal notes given in the 1st 3 foll, Age. Samvat 1473. Begins. fol. rb OM namaH zrIsarvajJAya // Jaina Literature and Philosophy Ends. fol. 24" fag ofcafazari No. 843 etc. up to far as in No. 841. This is followed by saMvat 1473 varSe azvana vadi 7 zanau zrI' pattane ' likhitaM // zubhaM bhavatu // cha // N. B. For additional information see No. 841. i etc. as in No. 841. [ 842. Lalitavistara 151. 1872-73. Size. 11 in. by 4 in. Extent. 20 folios; 17 lines to a page; 62 letters to a line. Description. Country paper thin, rough and greyish; Jaina Devanagari characters with TTS; small, legible and good Lalitavistara 1151. 1887-91.

Page #264
844.1 Age. Samvat 1489. Begins. fol. 1 a$?: daro | Ends. TIT. 4 Malasatras hand-writing; borders ruled in three lines in red ink; foll. numbered in the right-hand margin only; edges of a few foll. slightly worn out; condition on the whole good; complete; extent 1270 slokas. ---- etc. as in No. 841. fol. 200 prakRtisuMdaraM etc. up to caityavaMdanavRttiH samAptAH ( ptA) as in No. 841. This is followed by kRtirddharmmato yAkinImahattarAtUnorAcAryaharibhadrasyeti / cha | graMthAgramanuSTupa chaMdasAM zlokazatAni dvAdaza saptatyA samanvitAni graMthAgraM 1 70 // maM0 1489 bhAdrapada zudi 10 bhaume lekhitA // cha // N. B. For further particulars see No. 841. 227 sisafaxaci No 844 Size. 12 in. by 13 in. Extent. 60 to 143 plus some fragmentary leaves preceding the 60th; 2 to 4 lines to a leaf; 45 letters to a line. Description. Palm-leaf durable and greyish; Jaina Devanagari characters with gears; sufficiently big, legible and good hand-writing; this Ms. presents an appearance of the work having been divided into two columns, but it is not so; for, the lines of the first column extent to the second; borders of each of the columns ruled in black ink; red chalk used; leaves numbered in both the margins; in the right-hand one in numbers and in the left-hand one in letter-numerals e. g. 4 represented as a symbol given in Appendix IV (p.17) to part II of Vol. XVII (D. C. J. M.); leaves preceding the 60th in fragments; condition unsatisfactory; fragmentary leaves are kept separate. Lalita vistara 20. 1880-81.

Page #265
228 Jaina Literature and Philosophy 1844 Age.---Old. Begins.-leaf 60" tadbhakta ityucyate / na ca duSTetarAvagame vicAramaMtareNa vicArazca yuktigarbha ityAlocanIyAmatatUktapapatitodAharaNamapyudAharaNamAtra // nyAyA'nu papatteH tadudbhUtAderapi tathA darzanAbhAvAt etc. Ends.--- leaf 143deg mahAkalyANavirodhi na cintanIyaM / ciMtAmaNiratne(s)pi samyaga jJAtaguNa eva zraddhAdyatizayabhAvato()vidhiviraheNa mahAkalyANasiddharityalaM prasaMgena ||ch|| AcAryaharibhadreNa dRbdhvA sanyAyasaMgatA / caityavaMdanasUtrasya vRttilalitavistarA ||ch / ya enAM bhaavytyuccairdhrmsthenaaNtraatmnaa| sada(? ndatAM (su)bIjaM vA niyamAdadhigacchati // parAbhiprAyamajJAtvA tatkRtasya na vastunaH / guNadoSau sadA vAcyau / prazna egha tu yujyate // praSTavyo(s)nyaH parIkSArthamAtmano vA parasya ca / jJAnasya cAbhivRddhayartha tyAgArtha saMzayasya vA // kRtvA yajitaM puNyaM mayainAM zubhabhAvataH tenAsva(stu) sarvasattvAnAM mAtsaryavirahaH paraH ||ch / lalitavistarA nAma caityavaMdanavRttiH samAptAH // cha // kRtidharmato jAkinImahattarAsUnorAcAryaharibhadrasyeti // cha // graMthAgramanuSTupchaMdasA zlokazatAni dvAdaza saptatyA samanvitAni // maMgalaM mahAzrIH // zubhaM bhavatu // N. B.-- For further particulars see No. 841. lalitavistarApalikA Lalitavistarapanjika 1241. No. 845 1887-91. Size.-- 101 in. by 43 in. Extent.-- 37 folios; 16 lines to a page ; 67 letters to a line. Description.---- Country paper thin and grey ; Jaina Devanagari cha racters with pRSThamAtrAs; small, legible and good hand-writ

Page #266
845. ITI. 4 Malasatras 229 ing; borders ruled in four lines in black ink ; red chalk used ; white pigment used; fol. 356 blank ; complete ; the praNipAtadaNDaka ends on fol. 279; extent 2050 slokas ; condi tion very good. Age.- Seems to be pretty old. Author.--- Municandra Suri, pupil of Vinayacandra Suri and guru of the celebrated Vadi Deva Suri. See Peterson, Reports III, p. 244, v. 3. In Keith's Catalogue, in No. 7496 where both Lalitavistara and the Panjika are noted, Municandra is said to be the author of the former as such an erroneous statement is made by the scribe who wrote it. Of course, Gaikawar who has described (?)this Ms. has noted this mistake and has referred to Kielhorn's Report for 1880-81 (p. 14) where the correct entry is made. Subject.--- This is an elucidation of difficult phrases etc., occurring in Haribhadra Suri's Lalitavistara, a commentary explaining the Caityavandanasutra, up to Siddha-Mahaviradi-stava. Begins.-fol. IA ntvaa(s)nuyogddhebhyshcaityvNdngocraaN| vyAkhyAmyahaM kvacitkiMcittiM lalitavistarAM // 1 // A(yAM) buddhvA kila siddhasAdhurakhilavyAkhyAtRcUDAmaNi saMbuddhaH sugataH(ta)praNItasamayAbhyAsAccalaccetanaH / yatkartuH svakRtau punargurutayA cakre namasyAmasau ko hyenAM vivRNotu nAma vivittiM smRtyai tathA(s)pyAtmanaH // 2 zAstrAMtaradarzanataH svayamapyUhAd gurUpadezAt tu / kriyate mayaiSa durgamakatipayapadapaMjikAraMbhaH // 3 // tatrAcAryaH ziSTAcAratayA vighnopazamakatayA ca maMgalaM prekSAvatpravRttyarthamabhidheyaM saprasaMgaM prayojanaM sAmarthyagamyaM saMbaMdhaM ca vaktukAma Aha // praNamye tyAdi / tatra praNamya prakarSaNa natvA // etc. Ends.-.fol. 370 apunabaMdhakasyaiva lakSaNamAha bhargo(noDa)pi punabaMdhakocitasamAcArA skathaMcu(tri)ccyuto(5)pi / etadyannaliMgaH punazco( svo)citAcAraprayatnAvaseyo'punabaMdhakaH / AdidhArmika iti etaditi / idameva prakRtaM caityavaMdanavyAkhyAnamiti / mahetyAdi mahataH saccaityavaMdanAdeH kalyANasya kuzalasya

Page #267
230 Jaina Literature and Philosophy [845. virodhi bAdhakamatrajJAviplAvanAdi na naiva ciMtanIyamadhyavaseyaM kuta ityAha ciMtAmaNItyAdi sumaMgalaM // iti zrImuni caMdrasUriviracitAyAM lalitavistarApaMjikAyAM siddha mahAvIrAdistavaH samAptaH // tatsamAptau ca samApteyaM lalitavistarA - paMjikA / kaSTo graMtho matiranipuNA saMpradAyo na tAdRk / zAstra taMtrAtaramatagataM saMnidhau no tathApi / svasya smRtyai parahitakRte cAtmabodhAnurUpaM / nAgA mAgaH padamahAmiha vyAvRtazcittazuddhyA / / pratyakSaraM nirUpyAsya graMthamAnaM vinizvitaM / anuSTubhaM (bha) sahasre dve paMcAsa (za) dadhike tathA // 2050 // This is followed in a different hand by the lines as under : Reference. - Published along with Lalitavistara in the D. L. J.P.F. Series as No. 29. See Guerinot Bibliographie, p. 55. For additional works of this author and the Ms. see B. B. R. A. S. vols. III-IV, pp. 423-424. No. 846 HariaydA tapagaNapati vijayasenasrarINAM / zrIrAmavijayakRtinA citkoze pratiriyaM muktA // 1 // lalitavistarA paJjikA Size - 124 in. by rain. Extent.- 249 + 1 + 1 = 251 leaves; 2 to 4 lines to a leaf ; 45 letters to a line. Lalitavistarapanjika 21. 1880-81. Description.-- Palm leaf durable and greyish; Jaina Devanagari characters with pRSTamAtrAs; sufficiently big, legible, uniform and good hand-writing; this Ms. presents an appearance of the work having been divided into two columns, but really it is not so: each of the columns ruled in three lines in black

Page #268
846.1 III. 4 Malasutras 231 ink ; leaves numbered in both the margins ; in the righthand one as 144, 145 etc., and in the left-hand one as 5) 5) etc.; for some of the letter-numerals e. g. for 4, 6 TT and 9 see Appendix IV (pp. 17, 18 and 19 ) to Part II of Vol. XVII ; leaves in this Ms. start" with 144 and they go up to 392 ; complete ; condition very good ; there is one extra leaf both in the beginning and in the end. Age.- Fairly old. Begins.- leaf 144* a fatura! Par(s)autemT: etc. Ends. --- Icaf 391 3garuto etc. up 10 TOT TIETTEIT practically as in No. 846. Then we have: yAdRza pustakaM dRSTA tAdRzaM likhitaM mayA yadi zuddhamazuddha vA mama doSo na vidyate / / N. B.--- For additional particulars see No. 846.

Page #269
232 Jaina Literature and Philosophy [ 847. caityavandanamUtravRtti Caityavandanasutravrtti No. 841 1293 (8). 1886-92. Size. - 111 in. by 41 in. Extent.-- 20 folios ; 14 lines to a page; 45 letters to a line. Description. --- Country paper rough and white; Jaina Devanagari characters with occasional Tals; small, legible and very lair hand-writing: borders ruled in four lines in black ink; red chalk used; foll. numbered in the right-hand margin only; complete ; some of the foll. slightly wormcaten ; condition good ; this Ms. contains the following additional works: (I) vandanakavivaraNa foll. 60 to IO' ( No. 857) (2) pratyAkhyAnavRtti ,, 10deg ,, I4deg (3) kAyotsargadoSa fol. 14 (4) zrAddhapratikramaNasUtra laghuttisahita foll. I40 to 20. Age.-- Not modern. Author.- Sritilaka Suri. Subject.- A commentary in Sanskrit to Caityavandanasutra. Begins.-- fol. 1a zrIvIrajinavareMdra vaMditvA caityavaMdanAdIni / alparucikatvahetovivariSye gamanikAmAtraM // 1 ___ iha caityavaMdanAdInAM / vRttirArabdhapara iriyAvahiyAe / appaDikkaMtAe na kappai / kiMci ceiyavaMdaNa sajjhAyA ityAgamAta prathamamairyApathikI etc. Ends.-- fol. 6deg zubhaguruyogaH / tadvacanasevanA / Abhava AsaMsAraM / akhaMDA saMpUrNA idaM ca / praNidhAnAM na nidAnarUpaM / prAyeNa nisaMgAdibhilASarUpatvAt // cha / iti zrIzrItilakAcAryaviracitA caityavaMdanAvRtti samAptAH ||ch|| shrii||

Page #270
848. ] caityavandanasUtravRtti No. 848 III. 4. Malasatras Extent. fol. 1oa to fol. 13b Description. Complete. For other details see No. Begins. fol. 10a Caityavan danasutravrtti 200 (b). 1873-74. fr etc. as in No. 847. Ends. fol. 13 : etc. N. B. For further particulars see No. 847. 233 200 ( a ). 1873-74.

Page #271
234 Jaina Literature and Philosophy [ 849. Samsaradavanalastuti saMsAradAvAnalastuti No. 849 1220 (25) 1884-87. Extent.- fol. I90*. Description.-- Complete ; 4 verses in all in what is known as Sama-Samskrta i. e. in Sanskrit and Prakrit as well. For other details see No. __1220 (I). - 1884-87.. Author.- Haribhadra Suri, the Yakinimahattarasanu. For details about him see pp. 104, 105 and 224. Subject.- The Ist verse deals with eulogy of Lord Mahavira ; the 2nd, with a panegyric ot all the Tirthamkaras ; the 3rd, with salutation to the holy scriptures; and the 4th, with a stuti of Srutadevi. Begins.-fol. 1902 saMsAradApAnaladAhanIraM sa(somohAlIharaNa(Ne) samIraM / maayaarsaadaarnnsaarsiirN| namAmi vIraM girisAradhIraM // 1 // bhAvAvi(va)nAmasuradAnavamAnavena cUlAvilolakamalAvalimAlitAni / sNpuuritaabhintloksmiihitaani| kAmaM namAmi jinarAjapadAni tAni // 2 // Ends.-- fol. 1902 bodhAgAdhaM supadapadavInArapurAbhirAmaM / jIvAhiMsAviralalaharIsaMgamAgAhadehaM / / cUlAvelaM gurugamamaNIsaMkulaM duurpaarN| sAraM vIrAgamajalanidhiM sAdaraM sAdhu seve // AmalAloladhUlIbahulaparimalAlIDhalolAlimAlA jhaMkArArAvasArAmaladalakamalAgArabhUmAnivAse /

Page #272
851.] III. 4 Malasatras chAyAsaMbhAra sAre ! varakamalakare ! tAratA (hA )rAbhirAme ! vANIsaMdohadehe ! bhavavirahavaraM dehi me devi ! sAraM // 4 zrImahAvIrastutiH // cha // I Reference. Published. See any printed edition of the Pratitkramanasutras noted on p. 138. See Prathamajinastava and Parsvajinastava, each of which is a Padapurti-kavya of every carana of this Samsaradavanalastuti, and each of which is published in Jainastotrasamgraha (pt. I, pp. 65-69) in Yasovijaya Jaina granthamala, in Vira Samvat 2439 (2nd. edn.). For another kavya of this type sec pp. 64-69 of mAMDavagaDhakA mantrI athavA pethaDakumArakA paricaya" published as zrIvijayajI jaina phrI lAyanarI graMthamAlA puruSa 11 in Samvat 1979. saMsAradAvAnalastuti No. 850 Extent. fol. 3". Description. Complete; 4 verses in all. For other details see Namaskaramantra No. 736. Begins. fol. 3b Ends. fol. 3b #gramasizari etc. as in No. 849. bodhagari etc. up to deva (hi) me deva ( vi ! ) sAraM 4 as in No. 849. This is followed by iti zrIvarddhamAnastutiH N. B. For additional information see No. 849. saMsAradAvAnalastuti 235 Samsaradavanalastuti 1106 (23). 1891-95. Samsaradavanalastuti 1270 (28). 1887-91. No. 851 Extent. fol. 6a to fol. 6. Description. Complete; 4 verses in all. For other details see No. 734. I In No. 850, this work is styled as Sri-Varddhamanastuti.

Page #273
236 Jaina Literature and Philosophy 1851. Begins.- fol. 6a 11 Qoll. #arara1a7qreari 1 etc. as in No. $19. Ends.- fol. 6b humanu etc. up to ant a aia ! Fit 11 8 11 as in No. 849. This is followed by lagaitzaia: 11 g 11 N. B.- For further particulars see No. 849. saMsAradAvAnalastuti vyAkhyAsahita Samsaradavana lastuti with vyakhya 327. 1871-72. No. 852 Size.- 95 in. by 41 in. Extent.--- i folio ; 16 lines to a page; 43 letters to a line. Description.-- Country paper somewhat thick, tough and white; Jaina Devanagari characters; small, quite legible, uniform and very good liand-writing; borders ruled in two lines and edges in one in red ink ; yellow pigment used while making corrections ; there is only one fol., and it is numbered in the right-hand margin ; condition very good; both the text and its Gujarati commentary complete. Age.- Not modern. Author of the commentary. Not mentioned. Subject. -- The text together with its explanation in Gujarati. Begins.- ( text ) fol. 19 y coll wargaragarzari etc, as in No. 849.

Page #274
851.] III. 4 Malasatrar 237 Begins.--- ( com. ) fol. I ehanau artha e havau je zrIvIra varddhamAnasvAmi teha nai namuM namaskAra karUM kehavau chai zrIvIra saMsArarUpIyao je dAvAnala dAvAgni tehanA dAha bajhAivInai / nimitti nIra kahatA pANI tIyai samAna sariSao etc. Ends.--- (text ) fol. 1b bodhAgAdhaM etc. up to deva( vi! ) sAraM 4 as in No. 849. ,, -(com. ) fol. 1deg valI tAra kahatAM nirmala mo(mau)ktika tehanau je hAra maukti kalatA tiNai karI abhirAma manojJa chai balI vANI kahatAM bhagavatanI bhASA tehanau je saMdoha samUha tehija deha zarIra chai jehanao etalai virahA(hAM) kita zrIharibhadra mUrikRta stutinI vyAkhyA pUrNa thaI // 4 // zrI - -

Page #275
238 Jaina Literature and Philosophy 1853 vandanakasUtra (apen) Vandanakasutra ( Vandanayasutta ) No. 853 1220 ( 31 ). 1884-87 Extent. fol. 1906. Description.-- Complete. For other details see No. , 1220 (1). ** 1884-87.. Author.--. A Jaina saint. Subject. --- Vandana to a holy preceptor. It is hence called Vandanakasutra. See Vandaruvstii (p. 63). This sutra is recited while performing dvAdazAvartavandana. Begins.--fol. 190) EETTA FATHHOT(UTC) afes alata etc. Ends.-- fol. 1906 AR MATAHUN(TI) qfEATTA fatenfor OFETTA SPORTO TATTA 11 37 11 Reference.- Published. See any printed edition of the Pratikra manasutras. For one printed in Roman characters along with its translation in German see Ubersicht uber die Avasyaka-Literatur (pp. 7-8). Haribhadra Suri's commentary (p. 5462-546b) to Avasyakasutra, Yogasastra (pp. 2376-2402 ), Acaradinakara ( pp. 275-277a), Vandaruvrtti (pp. 63-66) and Dharmasamgraha ( pp. 1746-1806) may be consulted. For an extract see B. B. R. A. S. vols. III-IV, p. 399. vandanakasUtra Vandanakasutra 1270 ( 29 ). No. 854 1887-91. Extent.-- fol. 66 to fol. 7o. Description.- Complete. For other details see No. 734. Begins.--fol. 6" zegtfA (WATFAUT etc. as No. 853. Ends.- fol. 7" TFT CATHATT etc, up to a fer ll ll as in No. 853. N. B.- For further particulars see No. 853.

Page #276
857.1 vandanakasUtra No. 855 vandanakasUtra No. 856 III. 4 Malasairas Extent. fol. 2. Description. Complete. For other details see Namaskaramantra No. 735. Begins. fol. 2 etc. as in No. 853. Ends.--- fol. 2deg tasya (ssa) khamAsamaNo etc. up to appANaM vosirAmi // cha // as in No. 853. N. B. For additional information see No. 853. vandanakasUtra vivaraNa No. 857 239 Vandanakasutra 1269 (22). 1887-91. Extent. fol. 3 to fol. 4a. Description. Complete. For other details see Namaskaramantra No. 736. Begins. fol. 3 etc. as in No. 853. Ends. fol. 44 tassa khamAsamaNo etc. up to appA vosirAmi 1 as in No. 853 N. B. For additional information see No. 853. Vandanakasutra 1106 (24). 1891-95. Vandanakasutravivarana 1293 (b). 1886-92. Extent. fol. 6 to 10b Description.-- Complete. For details see Caityavandanasutra vrtti No. 847.

Page #277
240 Jaina Literature and Philosophy Author.- Sritilaka Suri. Subject.-- Explanation of Vandanakasutra. Begins.fol. 6b atha vaMdanakavivaraNaM / / iha ziSyo vidhivatpratilekhitamukha vastrikAtmadeho'dhijya ca pAvanatakAyaH // karadvayagRhItarajoharaNAdiravagrahAdvahi sthito vaMdanAyoyata evamAha || icchAmItyAdi / icchAmi abhilaSAmi etc. vandanaka sUtra vivaraNa No. 858 Ends.fol. 10deg prAghUrNaka(:) atithiH tasyApi vaMdanakaM dIyate ityarthaH / aSTAnavatimevaM yo dhyAyan sthAnazataM sadA datte vaMdanakaM sAdhuH zrAddho vA syAtsamiddhibhAkaH // cha // zrItilakAcAryaviracitA vaMdanakavRttiH // cha // bhadramastu // cha // 1857. Vandanakasutravivarana 200 (c ). 1873-74. Extent. - fol. 13b to fol. 162. Description.-- Complete. For other details see No. Begins. fol. 13 atha vaMdanakavivaraNaM etc. Ends. fol. 162 prAghUrNaka: atithiH etc. up to vaMdanakavRttiH as in No. 857. 200 (a) 1873-74.

Page #278
860. 1 Ill. 4 Malasairas 241 devasikAlocanAsUtra Daivasikalocanasutra (qaret 31 JUT] [ Devasiya aloyana] 1220 ( 32 ). No. 859 1884-87 Extent.- fol. 1906. 1220 ( 1 ). Description.- Complete. For other details see No. -- . 1884-87. Author.- A Jaina saint. Subject. -- Alocana in Prakrit. Hence this is named as Alocana sutra. See Vandaruvstti (p. 2 ). Begins.- fol. 1906 TITO FIShe war daffi TEIGIA I ESHT A FATASIT I 38(311)ET FEST I etc. Ends.- fol. 1906 ate() FraTUFAFT A SITI farligt att FEET A CET 113 11 Reference.- Published. See any printed edition of the Prati kramanasutras. Haribhadra Suri's commentary! (p. 7786) to Avasyakasutra, Yogasastra (pp. 244-2454) and Vandaruvrtti (p. 67) may be consulted. For an extract see B. B. R. A. S. vols. III-IV, p. 399. devasikAlocanAsUtra No. 860 Daivasikalocanasutra 1106 ( 25 ). 1891-95. Extent.- fol. 4*. Description.- Complete. For other details sec Namaskaramantra No. 736. Begins.-fol. 44 5314Thu Fiqht etc. as in No. 859. Ends.--tol. 4* (atthaETA FIATTEFFAT) # Pisa etc. up to af# fer ih us as in No.859. N. B.-- For additional information see No. 859. For comparison see pp. 571a and 571b:where a sutra pertaining to Daiva. sika aticara is given. Acaradipakara (pp. 278a-279b), too, may be consulted. 31 LLL. P.1

Page #279
242 Jaina Literature and Philosophy devasikAlocanAsUtra No. 861 Daivasikalocanasutra 1106 (26). 1891-95. Extent. fol. 4 to fol. 46. Description. Complete; owing to a dittographical error, it seems, this sutra is repeated. For other details see No. 736. f etc. as in No. 859. Begins. fol. 4 Ends. fol. 44 bArasavihassa etc. up to tarasa micchA mi dukkaDaM as in No. 859. N. B.- For additional particulars see No. 859. daivasikAlocanAsUtra No. 862 Extent. fol. 2b. Description. Complete. For other details see Namaskaramantra No. 735. [861. Daivasikalocanasutra 1269 (23). 1887-91. Begins. fol. 2 etc. as in No. 859. Ends. fol. 26 vArasAvehassa etc. up to micchA mi dukkaDaM as in No. 859. N. B.-- For additional information see No. 859. daivasikAlocanAsUtra No. 863 Extent. fol. 7a to fol. 7b. Description. Complete. For other details see No. 734. etc. as in No. 859. Daivasikalocanasutra 1270 (30). 1887-91. Begins. fol. 7 Ends. fol. 7 b bArasavihassa etc. up to micchA mi dukkaDaM // cha // N. B. For additional information see No. 859. as in No. 859.

Page #280
864.1 111. 4 Mulasutras 243 devasikAlocanAsUtra Daivasikalocanasutra No.864 1269 (27) 1887-91. Extent.- fol. 25 to fol. 34. Description.- Only the opening portion is given. For other details _see Namaskaramantra No. 735. Begins and Ends.- fol. 20 to 3 icchAmi paDikkamiuM / jo me devasio ___ aiyAro ko kAio ityAdi prAgvat / / cha / N. B.- For additional information see No. 859.

Page #281
244 Jaina Literature and Philosophy 1865. rAtrisaMstArakagAthA (rAisaMthAragagAhA) Ratrisarstarakagatha ( Raisantharagagaha ) No. 865 1174(d). 1887-91. Extent.--fol. 76 to fol. 8a. Description.- Complete ; a little bit of prose plus 20 verses in Prakrit. For other details see Sadavasyaksutra No. 730, Author.-- Not mentioned. Subject. - Holy reflections to be entertained before going to sleep a night. Begins.- fol. 7 zrI nisIhi nisIhi namo khamAsamaNANaM / goyamAINaM / mahAmuNINaM navakAra 3 karomi bhaMte 3 kahIyai aNujANaha paramagurU (guruguNa )rayaNehiM bhUsiyasarIrA bahupaDipunnA porisa rAIsaMthArae ThAmi 1 etc. Ends.--- fol. 8. sADU maMgalaM majju sAhaya majju devayA / sAhue kittaettANaM / vosarAmi tti yAvagaM // 18 // khAmemi samvajIve / samve jIvA khamaMtu me mittI me sababhUesu / vera maje na keNaI // 19 // evamahaM AloIa niMdia garahia dugaMchiaM samma tivihiNa pddikkto| vaMdAmi jiNe caudhIsa // 20 // iti rAIsaMthArAgAthA // Reference.- Cf. Santharaporise published in several editions of Pancapratik:amanasutras and the Mss. Nos. 633 (a) and 246 (b) 1371-72 1 which are not available at present for description and which will be hence described later on. 1895-98 and

Page #282
866.1 rAtrisaMstArakagAthA No. 866 111. 4 Malasutras 245 Ratrisamstarakagatha 1106 (52). 1891-95. Extent. fol. 15 to fol. 16. Description. Complete. For other details see No. 736. Begins. fol. 15 fadife 2 ami aerg$?mo nigaga az etc. as in No. 865. Ends. fol. 16b evamahaM etc. up to iti rAIsaMthAragAthA as in No. 865. This is the followed by samAptA. N. B. For further particulars see No. 865.

Page #283
246 gurukSAmaNAsUtra' [ abbhuTTio ] No. 867 Jaina Literature and Philosophy Extent. fol. 190. Description. Complete. For other details see No. Author.. - A Jaina saint. Subject. This small work in Prakrit furnishes us with an exemplary illustration of vinaya on the part of a sisya. Begins.fol. 190deg icchAkAreNa saMdisaha bhagavana ambhuTTio ahaM abhitaradevasiyaM khAmemi etc. - gurukSAmaNAsUtra No. 868 Ends. fol. 190deg jaM kiMci majjha viNayaparihINaM / sumaM vA bAyaraM vA / tumme jAha ahaM na jANAmi tassa micchA mi dukaDaM | cha // vaMdanakasUtraM samAptaM // cha // Guruksamanasutra [Abbhutthio ] 1220 (34). 1884-87. Reference. Published. See any printed edition of the Pratikramanasutras. For the text, its chaya, Gujarati translation and the posture see my third Kiranavali (pp. 52-53). Haribhadra Suri's commentary (p. 792) to Avasyakasutra, Yogasastra (pp. 245-246b), Acaradinakara (p. 286b), Vandaruvrtti (pp. 68-69 ) and Dharmasamgraha (pp. 1812-1822) may be consulted. For an extract see B. B. R. A. S. vols. III-IV, p. 399. This work is included in Sramanasutra, too. 867. 1220 (1). 1884-8. Extent. fol. 7. Description. Complete. For other details see No. 734. 1 The scribe has styled this as Vandanakasutra. Guruksamanasutra 1270 (32). 1887-91.

Page #284
870.1 III. 4 Malasutras 247 247 Begins.-fol. 7 TFTiu etc. as in No. 867. Ends.-fol. 76 FC etc. up to ata fatal fA qall ! as in No. 867 N. B.-- For additional information see No. 867. gurukSAmaNAsUtra Guruksamanasutra 1269 ( 25 ). 1887-91. No. 869 Extent.-- fol. 26. Description.- Complete. For other details see Namaskaramantra No. 735. Begins.-fol. 2b (Fido Ffe he as in No. 867. Ends.-fol. 2" jaM kiMci majjha etc. up to micchA mi dukkaDaM / / cha / / as in No, 867. N. B.- For additional information scc No. 867. gurukSAmaNAsUtra No. 870 Guruksamanasutra 1106 (27). 1891-95. Extent.-- fol. 46. Description.-- Complete. For other details see Namaskaramantra No. 736. Begins.-- fol. 4533(Aitor HPE etc. as in No. 867. Ends.- fol. 4 jaM kiMci majjha etc. up to tassa micchA mi dukkaDaM 1 as in No. 867. N. B.--For further particulars see No. 867.

Page #285
248 sAmAyika sUtra [ karomi bhaMte ] No. 871 Extent. fol. 191b to fol. 191b. Description. Complete. For other details see No. Jaina Literature and Philosophy Author. A Jaina saint. Subject. A Prakrit formula meant for a sravaka undertaking samayikavrata. Begins. fol. 1914 karemi bhaMte sAmAiyaM / sAvajjaM jogaM paccakkhAmi jAva niyamaM pajja (jju) vAsAmi duvihaM tiviheNaM / maNeNaM vAyAe kAraNaM na karemi / na kAravema / [ 871. Samayikasutra [Karemi bhante] 1220 (39). 1884-87. Ends. fol. 19tdeg tassa bhaMte paDikkamAmi / niMdAmi garahAmi appANaM vosirAmi // 1 sAmAyika sUtra No. 872 Extent. fol. 4. Description. Reference. Published. See any printed edition of the Pratikramanasutras or my fourth Kiranavali (p. 77) where its Sanskrit rendering and Gujarati translation are given. For the text in Roman characters and its German translation see Ubersicht uber die Avasyka-Literatur (p. 6). The edition containing Haribhadra Suri's commentary (p. 778b) to Avasyakasutra, Malayagiri Suri's commentary to the same (p. 556a) and Vandaruvrtti (p. 85) may be consulted. 1220 ( I ). 1884-87. For an extract see B. B. R. A. S. vols. III-IV, p. 399. The edition styled as sAdhuprAtikramaNAdisUtrANi and publish - ed by the Secretary of Sri Atmananda Jaina Sabha in A. D. 1921 contains practically this Samayikasutra. See its page 12. No. 736. Complete. For other details see Namaskaramantra Samayikasutra 1106 (28). 1891-95.

Page #286
874.1 III. 4 Malasatras Begins. fol. 4deg karemi bhaMte sAmAiyaM savvaM sAvajjaM jogaM paccakkhAmi etc. as in No. 871. Ends. fol. 4 tassa bhaMte etc. up to appANaM vosirAmi as in No. 871. N. B. For further particulars see No. 871. - sAmAyika sUtra No. 873 Extent. fol. 2. Description. Complete. For other details see Namaskaramantra No. 871. etc. as in No. 871. Begins. fol. 2b Ends.- fol. 2b tarasa bhaMte etc. up to vosirAmi // cha // as in No. 87: N. B. For additional information see No. 871. Begins. Ends.-- fol. 4 sAmAyika sUtra No. 874 Extent.- fol. 4. Description. Complete; here, too, it appears that there is a ditto graphical error as in the case of the Daivasikalocanasutra No. 861. For other details see No. 736. fol. 4 etc. as in No. 871. J etc. up to 249 Samayikasutra 1269 (26). 1887-91. followed by R. N. B. For additional information see No. 871. as in No. 871. This is Samayikasutra 1106 (29). 1891-95.

Page #287
250 Jaina Literature and philosophy [875. jaya mahAyazaH (jaya mahAyasa) Jaya mabayasah (Jaya mahayasa) 1220 (41). 1884-87. No. 875 Extent.-fol. 1916. Description. - Complete so far as it goes. For other details see No. 1220 (I). ____1884-87. . Author.--- A Jaina saint. Subject. - A verse in Prakrit eulogyzing the idol of Parsvanatha installed at Stambhanakapura. Begins and Ends. fol. 1910 jaya mahAyasa (jaya mahAyasa) jaya mahAbhAga / jaya ciMtiusahu phalai jaya samattha paramattha jANai / jaya jaya gurugarima guru / jaya duhatthasattA(Na) tANai / 'thaMbhaNaya driya pAsajiNa bhavI(vi)ya bhImabhavatthu bhayaava NaMtANaMtaguNaM tujjha tti(ti)saM(jha) nama. (mo)tthu // 1 Reference. -- Published with Hindi translation in the Appendix (p. 8) to Panca pratikramana, a work published by Sri Atmananda-Jaina-pustaka-pracaraka-mandala, Agra, in A. D. I923. jaya mahAyazaH Jaya mahayasah No. 876 ____1106 (32) 1891-95. Extent.- fol. sa. Description.- Complete. For other details see Namaskaramantra No. 736. Begins and Ends.- fol. 5 jaya mahAyasa etc. up to tujjhatti saMjha namatthu as in No. 875. This is followed by 2. N. B.-- For additional information see No. 875.

Page #288
877.] III. 4. Malasatras 251 AcAdikSAmaNaka Acaryadiksamanaka [ Ayariya uvajjhAe] [ Ayariya uvajjbae ] No. 877 1220 (43) 1884-87. Extent.- fol. 1926. Description.- Complete ; 3 verses in all. For other details see 1220 (I). No. 1884-87. Author.- A Jaina saint. Subject.--- A metrical composition in Prakrit whereby an acarya, an upadhyaya, a pupil, a co-religionist and the entire sramanasangha are requested to forgive the individual who has unnecessarily offended any one of them. Begins.-- fol. 1926 Ayariya uvajjhAe sIse sAha( ha )mmie kulagaNe ya / je me kiyA kasAyA savve tiviheNa khAmemi // 1 savvassa samaNasaMghassa / bhagavao aMjAja]liM kariya siise| savvaM khamAvaittA khamAmi saba(ssa) ahi(hoyaM pi // 2 etc. Ends.- fol. 1926 savvasa(ssa) jIvarAsa(sitsa / bhASao dhmmnihiyniycitto| savvaM khamAvaittA khamAmi savvassa ahi(ha)yaM pi // 3 Reference.- Published. See any printed edition of the Prati kramanasutras. This work is quoted by Haribhadra Suri, in his commentary ( p. 786 and 786b) on Avasyakasutra. In connection with this Ayariya uvajjhae, Sukhlal has made the following remark in his Hindi introduction (p. 45) to his edition of Panca pratikramana published by Sri Atmananda-Jaina-pustaka-pracaraka-mandala, Agra : "yadyapi Ayariya uvajjhAe, pukkharavaradIvaDe, siddhANaM buddhANaM ye maulika nahIM hai tathApi ve prAcIna haiN| kyoki una kA ullekha karake zrIharibhadra sUri ne svayaM una kI vyAkhyA kI hai|"

Page #289
252 Jaina Literature and Philosophy [ 878. AcAryAdikSAmaNaka Acaryadiksamanaka No. 878 1269 ( 29 ). 1887-91. Extent.-- fol. 49 Description.-- Complete ; 3 verses in all. For other details see Namaskaramantra No. 735. Begins.- fol. 4a BURU 38 stig etc. as in No. 877. Ends.-- fol. 4a TFF etc. up to 3tf() foil as in No. 877. N. B. - For additional information see No. 877. AcAryAdikSAmaNaka Acaryadiksamanaka No. 879 1106 (31). 1891-95. Extent.-- fol. 5a. Description.- Complete; 3 verses in all. For other details see Namaskaramantra No. 736. Begins.-- fol. 5a rufa gang etc. as in No. 877. Ends. fol. sa Fiath state(f)# etc. up to if()fu as in No. 877 N. B.- For further particulars see No. 877.

Page #290
881.] III. 4 Malasatras 253 zrIstambhanakapArzvanAthastuti SriStambhanaka-Parsvanathastuti (sirithaMbhaNayapAsanAhathui) (Siri Thambhanaya-Pasanahathui ) No. 880 1220 (44). 1884-87. Extent.- fol. 1932. Description.- Complete 'so far as it goes. For other details see N1220 (I). No.1884-87. Author.- A Jaina saint. Subject.- A metrical composition in Prakrit in two verses praising the idol of Lord Parsvanatha installed at Stambhanakapura. Begins.- fol. 6 siri thaMbhaNaya'Triya[ssa) / pAsasAmiNo sestitthsaamiinn(nn)| tityasamunnaya(i)kAraNa(Na) murAmurANaM ca savvesi // 1' Ends.-fol.60 esamahaM saraNatthakAusaggaM karemi ( sattIe) bhattIe guNamuTTiyassa saMghassa samunnaya(i)nimittaM // 2 karemi kAussaggaM cha / pratikramaNasUtraM // Reference.- Published with Hindi translation in the Appendix ( p. II ) to Paica pratikramana, a publication of Sri Atmananda-Jaina-pustaka-pracaraka-mandala, Agra in A. D. 1923. zrIstambhanakapArzvanAthastuti SriStambhanaka-Parsvanathastuti No. 881 1106 (41). 1891-95. Extent.- fol. 6. Description.- For other details see Namaskaramantra No. 736. ISee p. 137.

Page #291
254 Begins. fol. 6a Ends. fol. 6a Jaina Literature and Philosophy siri'thaMbhaNa' dviapAsasAmiNo etc. as in No. 880. samahaM etc. up to karemi kAusaggaM as in No. 880. This is followed by 1 iti zrIpratikramaNasUtraM samAptaM // N. B. For additional information see No. 880. [ 881.

Page #292
883.] sAmAyika pauSadhapAraNagAthA' ( sAmAiyaposahapAraNagAhA ) No. 882 Extent. fol. 5 to 6a. Description. Complete; 5 verses in all. For other details see Namaskaramantra No. 736. Begins.-- fol. 5b Ends. fol. 6a III. 4 Malasatras Author. A Jaina saint. Subject. A small metrical composition in Prakrit eulogyzing the saints and dealing with repentance. bhavaM dasannabhaddo etc. No. 883 sAmAyika pauSadhapAraNagAthA sAmAI posaha saMaissajIvassa jAi jo kAlo so saphala bodhasal so so saMsAraphalaheU 5 iti sAmAikaposahapAraNagAthA Extent. fol. 191. Description. Reference. Published with Hindi translation on pp. 6 to 8 of the Appendix to Sukhlal's edition of Panca pratikramana. Samayikapausadhaparanagatha (Samaiyaposahaparanagaha) 255 For other details see No. 1106 (40). 1891-95. Samayikapausadhaparanagatha 1220 (40). 1884-87. Complete so far as the 1st 4 verses are concerned. 1220 (1). 1884-87. 1 This is the 27th work noted on p. 134-the last work which constitutes Sadavasyakasutra No. 730.

Page #293
256 Begins.-- fol. 191b Jaina Literature and Philosophy bhavaM dasannabhaddo sudaMsaNo thUli (la) bhadda vaharo ya saphalIkayagihacAyA sAhU evaMvihA huMti // 1 sAhUNa vaMdaNeNaM nAsai pAvaM asaMkiyA bhAvA phAsu dANe nijjara ubaggaho nANamAINaM // 3 (12) (cha) umattho mUDhamaNo kittiyamitta pi saMbharai jIvo / jaM ca na bhumarAmi ahaM / micchA mi dukkaDaM tassa ( // 3 // ) jaM jaM maNeNa ciMtiyamasuhaM vAyAi bhAsiyaM kiMci / asU (su) haM kAraNa kiyaM micchA mi[ha] dukkaDaM tassa // 3 (24) // N. B. - For additional information see No. 882. [883.

Page #294
885.1 praNipAtasUtra [ khamAsamaNasutta ] No. 884 Extent. fol. 189. Description. Complete. For other details see No. Author. A Jaina saint. Subject. sutras. III. 4 Malasatras praNipAtasUtra No. 885 Pranipatasutra [Khamasamanasutta] This work styled also as Thobhavandanasutta and composed in Prakrit is included in the Caityavandanavidhi. It is a salutation to a guru. It does not occur in any of the Avasyakasutras. It is styled as laghuvandana by Anandasagara Suri (See Siddhacakra vol. III, Nos. 19 and last page). 20, Begins and Ends.- fol. 189a // 50 // OM namo vItarAgAyaH / icchAmi khamAsamaNo vaMdiuM jAvaNijjAe / nissIhiyAe matthe (tha) vaMdAmi Reference. Published in any printed edition of the Pratikramana 33 [J. L. P.] 257 1220 (7). 1884-87. 1220 (1). 1884-87. For the text together with its chaya, Gujarati translation and the posture see my third Kiranavali (p. 51). For an extract see B. B. R. A. S. vols. III-IV, p. 398. Extent. fol. 3a. Description. Complete. For other details see No. 734. Begins and Ends. fol. 32 icchAmi khamAsamaNe ( No ) etc. up to matthaya (e) as in No. 884. N. B. For additional particulars see No. 884. Pranipatasutra 1270 (11). 1887-91.

Page #295
258 Jaina Literature and Philosophy 1886. No. 886 1202 (b). 1887-91. praNipAtasUtra Pranipatasutra Extent.-- fol. 8a. Description.-- Complete. For other details see Paksikasutra NO.7887-91. Begins and Ends.-- fol. 8* FETTA TAIFATTET Frau(t)aig part hiyAe matthaeNa vNdaami| N. B.-- For further particulars see No. 884. No. 1202 (a). praNipAtasUtra Pranipatasutra No. 887 1106 (10). 1891-95. Extent.- fol. 26. Description.-- Complete. For other details see Namaskaramantra No. 736. Begins and Ends-- fol. 25 SZIA FAIFAT etc, up to STEITAI as in No 884. N. B. -- For additional information see No. 884.

Page #296
888.] bharatezvara bAhubalisvAdhyAya (bharahesarabAhubali sajjhAya ) kathAkoza tathA TabbA sahita No. 888 "" Size. 10 in. by 5 in. Extent. (text) 816 folios; 6 lines to a page; 32 letters to a line. (tabba) Age. Samvat 1905. Author of the text. "" 93 93 31543 37 Description. Country paper tough and white; Jaina Devanagari characters; this Ms. contains the text, its Sanskrit commentary and the interlinear tabba; big, legible and good hand-writing; borders ruled in three lines and edges in two, in red ink; foll. numbered in both the margins; fol. 12 and 816 practically blank; for, only the title etc. written on them; red chalk used; the first fol. slightly torn; condition on the whole good; the text, the commentary and the tabba complete; very incorrect; the commentary composed in Samvat 1539; extent 25625 slokas. wr 33 wr dr dr ,, com. III. 4 Malasatras dw Bharatesvara-Bahubalisvadhyaya (Bharahesara-Bahubalisajjhaya) with Kathakosa and tabba ;", dw 259 1307. 1886-92. tabba. Not mentioned. 29 39 A Jaina saint. Subhasila, pupil of Munisundara Suri of the Tapa gaccha. He seems to be an author of several works such as Vikramacaritra (14901), Punyadhananrpakatha (1496), Prabhavakakatha (1504), Satrunjayakalpa and its commentary (1518), Salivahananrpacarita (1540) etc.? "" 1 This and the other years mentioned in this para belong to the Vikrama era. 2 For other works see No. 896.

Page #297
260 Jaina Literature and Philosophy 1 888. Subject. Eulogy of the male and female saints in 13 verses in Prakrit together with their explanations in Sanskrit' and Gujarati. The male saints here mentioned are as under : J (1) Bharatesvara alias Bharata, (2) Bahubalin, (3) Abhayakumara, (4) Dhandhanakumara, ( 5 ) Sriyaka, ( 6 ) Arnikaputra, (7) Atimukta, (8) Nagadatta, (9) Metarya, (10) Sthulabhadra, ( 11 ) Vajrarsi, ( 12 ) Nandisena, ( 13 ) Simhagiri, (14) Krtapunyaka, (15) Sukosala, (16) Pundarika, ( 17 ) Kesin, (18) Karakandu, (19) Halla, (20) Vihalla, (21) Sudarsana sresthin, (22) Sala, (23) Mahasala, (24) Salibhadra, (25) Bhadrabahusvamin, (26) Dasarnabhadra, (27) Prasannacandra, (28) Yasobhadra Suri, (29) Jambusvamin, (30) Vankacula, (31) Gajasukumala, (32) Avantisukumala, ( 33 ) Dhanyakumara, (34) Ilaciputra, (35) Cilatiputra, (36) Yugabahu muni, (37) Aryamahagiri, (38) Aryaraksita, ( 39 ) Aryasuhastin, (40) Udayana, (41) Manaka, (42) Kalika Suri, (43) Samba, (44) Pradyumna, (45) Muladeva, (46) Prabhavasvamin, (47) Visnukumara, (48) Ardrakumara, (49) Drdhapraharin, (50) Sreyamsa, (51) Kuragadu, (52) Sayyambhava and (53) Meghakumara. Out of these 53 male saints, those numbered as I, 2, 5, 6, 9, 10, 11, 14, 26, 27, 35, 37, 38, 39, 40, 49 and 50 are alluded to in the following gathas of Avasyakaniryukti -- (a) 436, (b) 349, (c) 1248(?), (d) 1183, (e) 869-870, (f) 1284, (g) 736-739, (h) 846, (i) 846, (j) 1150, (k) 872-875, (1) 1283, (m) 775, (n) 1283, (0) 1185, (p) 952 and (q) 327. Saints numbered as 2 and 18 are referred to in Avasyakabhasya in gathas 32-35 (p. 153b) and 205 (p. 716b) respectively. Saints numbered as 5, 6, 10, 13, 14, 19, 20, 22, 23, 26, 32 and 34 are referred to on the following pages of the edition containing Avasyakasutra, its niryukti and Haribhadra's Suri's commentary: See No. 889 (description. '), p. 265. sa

Page #298
888.] III. 4 Malasatras (a) 693-695, (b) 688a-689a, (c) 695-698a, (d) 293, (e) 353, (f-g) 6792, (h-i) 286b, (j) 359, (k) 670-670 and (1) 3596. Saints numbered as 7, 31, 43 and 44 are mentioned in Antakrddasanga in the followiug places: 261 (a) VI, 15, (b) III, 9 and (c-d) IV, 6-7. Saints numbered as 16 and 35 are referred to in Jnatadharmakathanga in chapters 19 and 18 respectively. Saints numbered as 17 and 18 are alluded to in Uttaradhyayanasutra in chapters 25 and 9 respectively. Saints numbered as 41 and 52 are mentioned in Dasavaikalikaniryukti in gatha 14, and the saint numbered as 48, in Sutrakrtanga ( II, 6). The names of the female saints referred to in the text are as under :-- (1) Sulasa, (2) Candanabala, (3) Manorama, (4) Madanarekha, (5) Damayanti, (6) Narmadasundari, (7) Sita, (8) Nanda, (9) Bhadra, (10) Subhadra, (II) Rajimati, (12) Rsidatta, (13) Padmavati, (14) Anjanasundari, (15) Sridevi, (16) Jyestha, (17) Sujyestha, (18) Mrgavati, (19) Prabhavati, (20) Cellana, (21) Brahmi, (22) Sundari, (23) Rukmini, (24) Revati, (25) Kunti, (26) Siva, (27) Jayanti, (28) Devaki, (29) Draupadi, (30) Dharini, (31) Kalavati, (32) Puspacula, (33) Padmavati, (34) Gauri, (35) Gandhari, (36) Laksmana, (37) Susima, (38) Jambuvati, (39) Satyabhama, (40) Rukmini, (41) Yaksa, (42) Yaksadatta, (43) Bhuta, (44) Bhutadatta, (45) Sena, (46) Vena and (47) Rena. Out of these 47 female saints, those numbered as 2, 18 and 22 are mentioned in Avasyakaniryukti in the following gathas : -- (a-b) 520-521, and (c) 348 (p. 152a).

Page #299
262 Jaina Literature and Philosophy [ 888. Female saints numbered as 1, 13, 16, 17, 19, 20, 21, 26, 30, 32 and 41-47 are mentioned on the following pages of the edition of Avasyakasatra above referred to : (a)6764-676deg, (b)716deg-717deg, (c) 6769, (d) 6766-678, (e) 676', ( 1 ) 950 and 6764-6785, (g) 153', (h) 676", (i) 223", (j) 6886-689deg and (k-q ) 693". For female saints numbered as 10, 11, 18, 24, 25, 27, 29 and 33-40, the following works respectively may be consulted : (a) Dasavaikalikaniryukti v. 73-74, (b) Dasavaikalikavrtti by Haribhadra p. 964-96", (c) Dasavaikalikaniryukti v. 76, (d) Bhagavati XV, (e) Jnatadharmakathanga XVI, ( 1 ) Bhagavati XII, 2, (g) Jnatadeg XVI, and ( h*o ) Antakrd dasa V. Begins.-- (text) fol. 2a bharahesara bAhubalI abhayakumAro DhaMDhaNakumAro sirIyo aniAvRttau (to) aI(i)matto nAgadatto a ? ,,-- ( com. ) fol. 1 , zrI aha(hate namaH zrIsaMSezvarajI satya cha yugAdau vyavahArAdhvA sarbo yena prakAsi(zitaH sa zrIvRSabhayogAM(gI dau(dro) dadyAdvoya(? 'vya)yasaMpadaM ? vyaktvA cakrizriyaM sayo lalo(lau) yaH saMyamaMzriya sa zrIzAMtijino bhUyAja(ja)nAnAM zivazampa(ma)Ne 2 je(ye)nAsau cAvatAreNa yadU(du)vaMsa(zaH) pavitritaH ma zrInemIjinAdhIso(zo) bhUyAda'vyayasaMpade 3 yasya nAmazrutervighne zreNiryAti kSayaM kSaNAt sa zrIpArzvaprabhU(bhu)rdadyAtkalyANaM kamalAsatAM 4 sevate aMkamiSAsiho yaM balena parAjitaH sa zrIvIravibhU(bhurvaryazriye bhUyAccharIriNaM(NAM) 5 mahAtmAnyAM(?nAM) mumukSUNAM satInAM ca suyoge(gi)nAM namotkIrtanamAtreNa zivazrIrjAyate nRNaM(NAM)6 'tapAgacchAdvi(?dhi )pA zrImanmunisuMdarasuMgya tacchiSya zubhazIlAho bharatAdikathA vyadhAta 7 tathAhi etc.

Page #300
III. 4 Malasairas 263 Begins-(tabba) fol. 1 zrI arihaMtane namaskAra thAu zrIzaMSezvarajIneM namaskAra karUM dhuM yuga Adi vyavahAramAraga saghalo jeNeM pragaTa kIdho te zrIRSabhadeva yogeMdra tumaneM akSaya saMpradA prate 1 cakravarttinI lakSmI chAMDIneM sIghra leto havo je saMyamazrI prata te zrIzAMtinAtha thAu lokaneM mokSanAM sukha bhaNI etc. .- ( text ) fol. Ends. 888.1 " stars mahAsaio jayaMti akalaMkasIlakalilAo / ajja vi vajjai jAsiM jasapaDaho tihuyaNe sayale // 13 // ' ( com.) fol. 8144 tatazcyutvA bhavaM ( vAM)tare muktimapi gamiSyati tatastasyA zrImatyA sarva zrutvA (jA) tismRtirabhUta pazvAdbhavaM dRSTvA vizeSatastayA tapazva udyApanamapi kRtaM itI (ti) tapaH kRtvA zrImati devaloke gatAH tatazcyutvA rAjaputrI babhUva tata (to) vairAgyAtsaMyamaM prApya puNyapApaphalaM bhuktvA karmakSayAnmuktiM gatAH iti tapaviSaye zrImatIkathA samAptaH kAvya : zrI'caMdra' gacchAMbarabhu(bhU/pako ('bhU) ta 'tapA' gaNo bhAnuriveva (ddha) di (dI) tI / prabodhayan bhavyajanAMbujAnAM svagrete (go) vilAzai (sai)riva sAdhuvagai: 1 tatrAbhuvaJca guNagaNamaNIrohaNamahA (hI) dharaH pratimA paramagurusomasuMdara gu(ra) va [ra]: saMyamaramApatayaH 2 . tacchiSyA munI suMdaraguvo jayacaMdra ( sU ) rayo (S) bhu(bhU ) vana pAva (ra) gatAgamajalanidhApAraMgatA ruciraguNanI (ni) ca (la) yAH 3 (ta) cchiSyA vijayaMta (te) dadhataH zrI surI' maMtra mahimabharata (m) zrIyuktaratne (na) seSaragurava udayaMnaM disurIvarAH 4 lakSmIsAgarasUrIzA somadevAhna sUraya (:) vijayaMta (te) lasadvidyAvAddhimaMthana maMdi (da) ro (ra:) 5 zrImanmu (nIzamu) nI suMdarasurIrAjaH ziSyo manISizubhazIla iti pramukhya (:) etA (:) kathA vitanute sma navAMbareSu caMdra (1509) pramANasamaye kila vikramAkAMta 6 1 This verse is here reproduced from the printed edition as it has not been possible to trace it in the Ms. It must be however occurring just in the beginning of Silvatikatha,

Page #301
264 Jaina Literature and Philosophy [ 888 bharahesarabAibalivRttIH subhasIlavibuddhacitteyaM zodhyA suddhimadbhiH vibudhaiH kRtadApasarINa(? kUTApasAraNataH) 7 anAbhau(bho)gAdinA kiMcidyadevotsutraropaNaM cakre tadasti me mIthyA tamo(5)IdAdisAkSIkaM 8 iti zrImat tapAgacchAdhirAjazrImunisuMdarasurIzISyapaMDitazubhazIlagaNIviracite bharahesarabAhUbalivivRttI nAnI kathAkose dvitIyo mahAsatyadhikAro samAptaH // yAdRzaM pustakaM etc. bhagnapRSTI etc. jalA rakSe etc. This is followed by eier as under:jyahAM lage 'merU' aDaga he jyahAM lage zazI harasUra tyahAM lage A pothi sadA sadA rahe jo guNabharapUra 1 atita bhekha jaNameM base vace dije jIjIkAra hama tuma jesI prItaDI so jAnata he kiratAra 2 iti zrI saMpUrNa zlokasaMkhyA 25265 te TabArtha malI sudhAM saMvat 1905 nA varSe mAgasIramAse zuklapakSe tIthau 13 bhRguvAsare lapItaMga bhaTTArakazrIzrI1008 vijayasurendrasurIzvarajI tatpaTTe bhaTTArakazrIzrIvijayadhanezvara sUrIzvarajI celA gulAbacaMdavAcanArthe zubhaM bhUyAt zrI zrI etc. Ends.- (tabba) fol. 815 surIpradhAna lakSmIsAgarasUrInA isa somadeva nAmeM sUrI vijayavaMtA havA vidyAiM sAvadhAna zrImata zrImUnInA Isa zrImunIsuMdarasUrIrAjanA siSya paMDIta subhasIla iti nAmamuSya tAie kathA prateM vistAratA havA saMvat 1508 nA vara graMthanI racanA thaI rAja thaki 6 bharesarabAhUbalInI TIkA subhasIla paMhiteM e racI bhalI buddhiiM e TIkA karI 'jANatAM thakAM ihAM kAMI 'dhIkuM urle kAne mAtra laSANu hoI te micchA mI DUkaDaM bharahe. sarabAhUbalInI vRttI TavArtha saMpUrNa e keNe bhareMsaravRti karI zrImunIsuMdarasUrInA sISya paMDIta zubhasIla paMDIte raci che zrI zrI zrI saMvat 1905 nA vara mAgasIramAse zuklapakSe ekAdasI saumyavAsare 'muMbAInagareM e graMtha lakhyo che. Reference.- The text is published in several editions of Prati kamanasatras. In Sukhlal's edition of Pancapratikramana, he has given in short, paricaya of all the saints (53+47) and in several places, he has mentioned the sources, too.

Page #302
889.) III. 4 Malasatras 265 The text together with its Sanskrit commentary styled as Kathakosa is published in two parts as Nos. 77 and 87 respectively, in the Sheth D. L. J. P. F. Series, in A. D. 1932 and 1937 respectively. The second edition of a Gujarati translation of the Kathakosa is published by Maganlal Hathising, Ahmedabad, in A. D. 1902. For quotations see Peterson, Report IV, p. 110, and Mitra, Notices VIII, p. 163. For additional Mss. see B. B. R. "A. S. vols. III-IV, p. 444. bharatezvarabAhubalisvAdhyAya Bharatesvara-Bahubalisvadhyaya kathAkozasahita with Kathakosa 333. No. 889 1871-72. Size.- log in. by 41 in. Extent.-- 249 folios ; 13 lines to a page ; 48 letters to a line. Description.- Country paper tough and white; Jaina Devanagari characters with occasional carats ; small, legible and elegant hand-writing; borders ruled in two pairs of lines in black ink ; red chalk used; white paste, too; fol. 1a blank ; foll. 54-249 also numbered as 1, 2, etc. in the interlinear space; this Ms. contains the text as well as the commentary ; both complete; in the latter we have kathas of Silavati, Nandayanti, Rohini, Ratisundari and Srimati, though these female saints are not mentioned in the text; these kathas commence after the completion of those of the crowned queens of Ktsna ; edges of the first and last foll. slightly worn out; condition on the whole good. Age.- Fairly old.

Page #303
266 Jaina Literature and Philosophy [889. Begins- ( text) fol. I0 bharaesara bAhubalI etc. as No. 888. , - (com. ) fol. 11 I0 // nama(H) sarvajJAya // zrIzAradAyai namaH // yugAdau vyavahArA( dhvA) savoM yena prakAzitaH / sa zrIvRSabhayogIMdro dadyAdvo( 5 )vyayasaMpadaM / 1 / tyaktvA cakrizriyaM sadyo lalau yaH saMyamAzrayaM / sa zrIzAMtijino bhUyAjjanAnAM zivazarmaNe // 2 // Ends.- (text) fol. iccAi etc. ., - (com.) fol. 249% 'aduHkhadarzinIyA khyaM tapo yaH kurute tasya duHkhaM nAyAti tapasvarUpaM proktavyamatra udyApane pAlakaM rUpyamayaM kaMcanaputrikApuraH sthale zarkarAThyasthUlamodakarAzibhat tata etacchrutvA tayA tapaH kRtaM udyApanamapi kRtaM tayA dvijapanyA tasya tapasA(saH) prabhAvAnmRtvA(s)sau zrImatI jAtA kramAnmuktimapi bhavAMtare gamiSyati tatastasyAH zrImatyA etatkRtvA jAtisma(smR)tirabhUtpazcAdbhavaM dRSTA vizeSatastayA tapazcakre udyApanamapi kRtaM / iti tapaH tasminneva bhave saMyamaM prApya karmakSayAnmuktiM gatA iti aduHkhadarzinItyaparAkhyAzrImatIkathA tapasi samAptA ||ch| zrI'caMdra'gacchAMbarabhUSako(5)bhUt 'tapAgaNo bhAnuriveddhadIpti(:) prabodhayan bhavyajanAMba(bu)jI(? jA)lI svagovilAsairiva sAdhuvargaH 1 tatrAbhU( bha )tvA(va)nvaraguNagaNamaNirohaNamahIdharapratimA paramagurusomasuMdarazuru(ra)vaH saMyamaramApatayaH // 2 // tacchiSyA munisuMdaraguravo jayacaMdrasUrayo(s)bhUvan / pAraM(ra)gatAgamajalanidhipAraMgatA rucirgunnnilyaaH3| tacchiSyA vijayaMte dadhataH zrI mUri maMtramahimabharaM zrIyuktaratnazekharA(ra)gurava udayanaMdisUrivarAH 4 / lakSmIsAgarasUrIzAH somadevAhvasUrayaH vijayaMte lasadvidyAvArdhimaMthana maMdarAH' 5 / zrImanmunIzamunisuMdarasUrirAja ziSyo manISizubhazIla iti pramukhyaH

Page #304
890.1 III. 4 enAM kathAM vitanute sma navAMbareSu Malasatras caMdra (1509) pramANasamaye kila vikramArkAt // 6 // bharatezvara bAhubalisvAdhyAya kathAkozasahita bharahesarabAhubalIvRttiH zubhazIlavibudharaciteyaM / zodhyA subuddhimadbhirvibudhaiH kUTApasaraNataH // 7 // anAbhogAdinA kiMcidyadyatro sUtraropaNaM / cakre tadastu me mithyA tamo(s) rhadAdisAkSikaM // 8 // iti zrImat 'tapAgacchAvirAjazrI munisuMdarasUiizaSyapAMDitazubhazIlagaNiviracite bharahesarabAhubalIvRttinAmni kathAkoze dvitIyo mahAsatyadhikAraH // samApta // cha // saMpUrNa // cha. N. B. -- For additional information see No. 888. 267 Bharatesvara-Bahubalisvadhyaya with Kathakosa No. 890 Size.-- 93 in. by 44 in Extent. - 253+2-1254 folios; 15 lines to a page ; 44 letters to a line. 620. 1884-86. Description. - Country paper rough, brittle and grey ; Jaina Devanagari characters with occasional gears; small, legible and good hand-writing; borders ruled in three lives in red ink ; red chalk and yellow pigment used; foll. numbered in both the margins; fol. ra blank ; foll. 44 and 164 repeated ; fol. 101 appears to be missing but most probably foll. 102 etc. ought to have been numbered as ro1, 102 etc. ; fol. 206th wrongly numbered as 205, since the following foll. are numbered as 207 etc., and there is continuity of matter this Ms. contains only the 1st gatha of the text; rest referred to by ityAdi 13 ; Kathakosa complete ; a strip of paper pas ted to fol. r* ; condition very good Age.-- Samvat 1661.

Page #305
268 Begins. (text) fol. Ib "2 bharahesara bAhubalI etc. ---- - ( com. ) fol. 1 namaH / zrIsarvajJAya namaH // tarar etc. as in No. 888. Ends.--(com.) fol. 253a Jaina Literature and Philosophy N. B. For additional information see No. 888. 'aduHkhadarzanIyA' khyaM etc. up to mahAsatyadhikAraH samAptaH as in No. 889. This is followed by a line as under :saM0 1661 varSe mAgazirazudi // 1 // zukre // bharatezvara bAhubalisvAdhyAya kathAkozasahita No. 891 dr Begins. (text) fol. 1b Size. 10 in. by 4 in. Extent. 266 folios; 15 lines to a page; 41 letters to a line. Description. Country paper thin and white; Jaina Devanagari characters with occasional gears; bold, big, legible and fair hand-writing; borders ruled in two pairs of lines in black ink; red chalk used; 1st fol. slightly torn; its edges worn out; a corner of fol. 13th damaged; edges of fol. 266b slightly torn out; condition on the whole tolerably good; fol. 1 blank; numbers for foll. entered twice as usual ; this Ms. contains only the first gatha of the text; the rest indicated by ityAdi 13 gAthA : ; marginal notes added at times; Kathakosa complete. --- [890. Bharatesvara-Bahubalisvadhyaya with Kathakosa 413. 1879-80. Heer algasi etc. as in No. 888. 11 ( com. ) fol. rb N namaH zrIsarvajJAya || // zrIzAradAyai namaH // zrIgurubhyo namaH //

Page #306
89.] III. 4 Malasatras 269 yugAdau vyavahArAddhA sarvo yena prakAzitaH / sa zrIvRSabhayogIMdro dadyAdvo(5)vyayasaMpadam // 1 // etc. Ends.- ( com. ) fol. 266" iti tapaH kRtvA tasminneva bhAvasaMyamaM prApya karma kSayAnmuktiM gatA / iti adu:khadarzinIparAkhyAzrImatIkathA tapasi smaaptaa| // 10 // zrI caMdragacchAMbarabhUSako(5)bhUt __ 'tapAgaNI bhaanurivddhdiiptiH| prabodhayanbhavyajanAMbujAlI ___ svagovilAsairiva sAdhuvagaiH / 1 tatrAbhUvanvaraguNagaNamaNirohaNamahIdharapratimAH paramagurusomasuMdaraguravaH saMyamaramApatayaH / 1 tacchiSyA munisuMdaraguravo jayacaMdrasUrayo(5)bhUvan / pAragatAgamAgatAgama]jalanidhipAra(raM)gatA ruciraguNAnilayA 3 tacchiSyA vijayaMte dadhataH zrI sUri maMtramahimabharaM / zrIyuktaratnazekharagurava udayanaMdisUrivarAH / 4 lakSmIsAgarasUrIzAH somadevAhvasUrayaH vijayaMte lasadvidyAvArddhimaMthana mNdraa'| 5 zrImanmunIzamunisuMdarasUrirAja ziSyo manISizubhazIla iti pramukha(khyaH) etAM kathAM vitanute sma navAMbareSu caMdra(1509)pra(mA)Nasamaye kila vikramAM(mArkA)t / 6 / bharahisarabAhubalIvRttiH zubhazIlavibudharaciteyaM / zodhyA subuddhimadbhibabudhaiH kra(ka)TApasAraNataH 7 anAbhogAdinA kiMcidyadatrotsUtraropaNaM / ta(ca) tadastu me mithyA tamo(s)haMdAdisAkSikaM // 8 // iti zrImat 'tapAgacchAdhirAjazrImunisuMdarasUriziSyapaMDitazubhazIlagaNiviracite bharahasarabAhubalIvRttinAmni kathAkoze dvitIyo mahAsatyadhikAraH samAptaH // saMpUrNaH // // tatsamAptau samAptazcArya bharahesarabAhubalIvRttinAmA graMthaH lekhakavAcakazodhayitRvAcayitRzrotRRNAM ciraM vaM(naMdatAdetad graMthapustakaM vAcyamAnaM // graMthAgraM 10000 // cha / zubhaM bhavatu // idaM pustakaM paripUrNa // cha / N. B.- For additional information see No. 888.

Page #307
270 bharatezvara bAhubalisvAdhyAya kathAkozasahita No. 892 Jaina Literature and Philosophy line. "" Size. 93 in. by 4 in. Extent. 347+5=352 folios; 13 lines to a page; 35 letters to a Bharatesvara-Bahubalisvadhyaya with Kathakosa Description. Country paper rough, tough and white, Jaina Devanagari characters; sufficiently big, legible and tolerably good hand-writing; borders ruled in two pairs of lines in black ink; red chalk used; yellow pigment also; foll. numbered in the right-hand margin only; six foll. numbered as 172; the sixth 172a practically blank; only half a line is written on it; fol. 1 blank; edges of the first fol. slightly damaged; a careless attempt to separate the 68th and 69th foll. which must have stuck together owing to the presence of gum, has led to their tearing and thus damaging the Ms. ; similar is the case with foll. 121 and 122; condition on the whole good; the text complete so far as the 1st verse is concerned; fagar is complete; the narrative that follows viz. that of Srimati not complete; so Kathakosa thus ends abruptly, and that there is no colophon. Age.- Pretty old. Begins. -- ( com. ) fol. ht0 // zrIsAradAyai namaH // gara etc. as in No. 888. Ends. (com.) fol. 347b [892. (text) fol. rb bharahesara bAhubalI etc. up to nAgadatto ya // 1 // ityAdi 13 gAthA || 308. A. 1882-83. dRSTvA tatastasyA zrImatyA etatkRtvA jAtismRtirabhUtpazcAdbhavaM vizeSatastayA tapazrcakre / udyApanamapi kRtaM / iti tapaH kRtvA tasminneva bhave (This Ms. ends thus abruptly). N. B. For further particulars see No. 888.

Page #308
753. 894. ) III. 4 Malasutras 271 Hrasatacar Fate/T7 Bharatesvara-Bahubalisvadhyaya / kathAkozasAhata with Kathakosa No. 893 1875-76. Size.-98 in. by 4; in. Extent.-- 288-3=285 folios; 15 lines to a page; 39 letters to a line. Description.- Country paper thin and white; Jaina Devanagari characters with occasional ATAIS; big, legible and good hand-writing ; borders ruled in four lines in black ink; red chalk used and yellow pigment, too; numbers for foll. entered twice as usual; fol. 1a blank; edges of the ist and last foll. slightly damaged; this Ms. contains only the Ist gatha of the text, out of 13 ; foll. 179 to 181 lacking ; fol. roo numbered as 1001; foll. 162 to 193 worm-eaten; condition on the whole tolerably good; Kathakosa complete. Age.- Not modern. Begins. --( text ) fol. rb HEAT agoi etc. as in No. 888. >>- (com.) fol. roll a#: sihatan 11 gnier etc. as in No. 888. Ends.- ( com. ) fol. 2876 gra at: Esrar etc., up to AE(ETADETTU ETT guf: as in No. 891. Then follows: JH HTC 1 Bftea 1 N. B.- For further particulars see No. 888. bharatezvarabAhubalisvAdhyAya Bharatesvara-Bahubalisvadhyaya kathAkozasAhata with Kathakosa 1306. No. 894 1886-92. Size.- 99 in. by 43 in. Extent. --- 341 + 1 + 1 = 343 folios; 13 lines to a page ; 32 letters to a line.

Page #309
272 Jaina Literature and Philosophy [894. Description.- Country paper thin, rough and white; Devanagari characters with occasional gratis ; big, legible and tolerably good hand-writing ; borders ruled in two pairs of lines in black ink ; red chalk used; foll. mostly numbered in the right-hand margin only; fol. 203 repeated; so is the fol. 211; a piece of paper of the size of a fol. pasted to foll. ra and 3410; this Ms. does not seem to contain the complete text; only the ist verse can be easily noticed ;' Kathakosa complete ; some of the foll. slightly worm-eaten ; condition good. Age... Old. Commentator.- Subhasila, pupil of Munisundara Suri of the Tapa gaccha. He is an author of the works noted on p. 259. Furthermore, according to Jaina Granthavali etc. ? he has composed Pancastiprabodhasambandha, Danadikatha ( 1150 slokas in extent ), Punyasarakatha ( 1311 verses ), Silavatikatha 988 verses ), Snatrapancasikakatha, Bhaktamarama. hatmya, Unadinamamala and Pancavargasamgraha. For other details see No. 888. Kathakosa. Explanation in Sanskrit of Bharatesvara-Bahubalisva dhyaya along with about 100 narratives. These narratives depict lives of the male and female personages referred to in Bharatesvara-Bahubali-svadhaya and also those of s more. See p. 257. Begins.-- (text) fol. 1b HTEAT algazi etc. ( in the margin ) ,, -- (com. ) fol. 16 FH: FERETTI gugi aTTENTET etc. as in No. 888. Ends.-(com. ) fol. 340b3ngierrstarrei etc. up to Patut AETATE Frekre Frigof: as in No. 889. N. B.--- For other details see No. 888. 1 Others are probably not given. They seem to be alluded to, by the word CHIE. 2 See "upakrama '(p. 6a) of the 2nd part of Sri Bharatesvara-Bahubalivrtti (D. L. J. P. F. Series, No. 87).

Page #310
895.] 111. 4 Malasatras 273 mahAvIrasvAmistuti' Mahavirasvamistuti [ snAtasyAstuti] Snatasyastuti ] 1250 (29). No. 895 1884-87. Extent.--- fol. ga to fol. 76. Description.- Complete. For other details see Adinathamaha. 1250(I). prabhavakastavana No. 0. 1884-87.. Author.- Balacandra Suri, a pupil of Hemacandra Suri, the well known polygrapher. Subject. This metrical composition in Sanskrit is mostly recited on the 14th day of each fort-night by several Svetambara Jainas. The first verse deals with eulogy of Lord Mahavira, the 2nd with a panegyric of the Tirthamkaras, the 3rd with a stuti of holy scriptures and the 4th, with that of Sarvanubhuti yaksa. Begins.- fol. 70 snAtasyApratha(timasya 'meru'si(zi)khare sa(za)cyA vibhoH zaizave __rUpAlokanavismayAhRtaha(ra)sabhrAMtyA bhramaca(cakSuSA / unsRSTaM nayanaprabhAdhavalitaM kSIrodakAzaMkayA / vaktraM yasya punaH punaH sa jayati zrIvarddhamAno jinaH // 1 haMsAsAhatapadmareNukapizu(zokSIrArNavAMbhobhRtaiH kuMbhairapsarasAM payodharabharaprasparddhibhiH kAMcanaiH / yeSAM 'maMdara ratnazailazikhare janmAbhiSekaH kRtaH ___ sarvaiH sarvasurAsuresva(zva)rasu(ga)NaisteSAM nato(s)ha kramAta(n) // 2 Ends.- fol. 7 arhadvaktraprasUtaM gaNadhararacitaM / dvAdazAMgaM vizAlaM citraM bahvarthayuktaM / munigaNavRSabhairdhAritaM buddhimadbhiH mokSAgradvArabhUtaM vratacaraNaphalaM / jJeyabhAvapradIpaM / ___ bhaktyA nityaM prapadye zrutamahamakhilaM sarvalokaikasAraM / 3 niHppa(pokavyomanIladyutimalasadRzaM bAlacaMdrAbhadaMSTra maMmittaM ghNttaarvennu(nn)| prasRtamadajalaM pUrayaMtaM samaMtAt 1 This is the last work forming a part of Sadavasyakasutra described as No. 731.

Page #311
274 Jaina Literature and Philosophy 1895. ArUDho divyanAgaM vicarati gagane kAmadaH kAmarUpI / yakSaH sarvAnubhUtirdizatu mama sadA sarvakAryeSu siddhi // 4 // aSTamIcaturdazIstuti' // cha / Reference.-- Published. See any printed edition of the Prati kramanasutras noted on p. 132 etc. See also p. 145 where all these four verses are given. ____In Jaina-stotra-samgraha (pt. II, pp. 19-20), uc have Sri-Vira-jinastuti which is a padapurti of the first carana of each of the four verses of this Mahavirasvamistuti. In the Limbdi Catalogue, a Sanskrit work in four verses by Balacandra is noted as No. 1550 and is styled as Paksikastuti. So one may naturally like to know if these two works are the same as the one described here; but no definite answer can be given at this stage. mahAvIrasvAmistuti Mahavirasvamistuti 1269 (47). No. 896 1887-91. Extent.-- fol. 40% Description.- Complete ; 4 verses in all. For other details see ___No. 735. Begins.- fol. 40 snAtasyApratimasya 'merusa(zi )khare kSIrodakAzaMkayA (zacyA vibhoH zaizave) rUpAlokanavismayAhRtarasabhrAMtyA bhramaccakSuSA / unmRSTaM nayanaprabhAdhavalitaM kssiirodkaashNkyaa| vaktraM yasya punaH punaH sa jayati zrIvarddhamAno jinaH / 1 // etc. 1 It is styled in the subsequent Ms. (No. 896 ), as Mahavirastuti.

Page #312
896. ] Ends.- fol. 40* III. 4 Mulasutras N. B.-- For additional information see No. 895. niSpaM kavyomanIladyutimalasadRzaM bAlacaMdrAbhidaMSTraM / mattaM ghaMTAraveNa prasRtamadajalaM pUrayaMtaM samaMtAt / ArUDho divyanAgaM vya (vi) carati gagane kAmadaH kAmarUpI / yakSaH sarvAnubhUtirda (rdizatu mama sadA sarvakAryeSu siddhiM // 4 // iti mahAvIrastutiH / 271

Page #313
276 Jaina Literature and Philosophy 1897. namo'hat' No. 897 Namo'rhat 1220 ( 28 ). 1884-87. Extent.-- fol. 1904. 1220 ( 1), Description.- Complete. For other details see No. 2 1884-87. Author.- Siddhasena Divakara (according to the Jaina tradition), author of Sammaipayarana etc. Subject.--- Salutation to the five paramesthins. Begins and Ends.--- fol. 1902 F#(s)FHEITIUfatentTHIATEXT: 1 Reference.- Published. See any printed edition of the Prati kramanasutras. namo'hat No. 898 Namo'rbata 1270 (8). 1887-91. Extent. fol. 26. Description.-- Complete. For other details see Namaskaramantra No. 734. Begins and Ends.-- fol. 26 AH(s)kinerarioteeragamanyrt(:) 1 N. B.- For further particulars see No. 897. namo'haMda Namo'rhat No. 899 1269 (19) 1887-91. Extent.- fol. 22. Description.- Complete. For other details see Namaskaramantra No. 735. 1 This is same as the 8th work of Salavasyakasutra described as No. 734.

Page #314
900. ] III. 4. Malasatras Begins and Ends. fol. 22 namo'rhasiddhAcAryopAdhyAya sarvasAdhubhyaH / N. B.- For additional information see No. 897. namo'rhat No. 900 - Extent. Complete. For other details see Namaskaramantra No. 736. Begins and Ends. fol. 22 namo ( s) rhatsiddhAcAryopAdhyAya sarvasAdhubhyaH N. B. For additional particulars see No. 897. 277 Namo'rhat 1106 (7). 1891-95.

Page #315
278 Jaina Literature and Philosophy 1901. zrutasya bhagavataH Srutasya bhagavatah (ETFA HITAST) ( Suyassa bhagavao ) No. 901 1269 (11). 1887-91. Extent.-- fol. 24. Description. - Complete. For other details see Namaskaramantra No. 735, Subject.-- A formula to be uttered when one is about to perform kayotsarga in connection with sruta. Begins and Ends.-- fol. 2a GT Hat FRIA FTSFATT. Reference.- Published in any of the printed editions of Pancaprati. kramanasutra. Also published in the edition (p. 788a ) of Avasyakasutra containing Haribhadra Suri's commentary. zrutasya bhagavataH Srutasya bhagavatah No. 902 1270 (19). 1887-91. Extent.-- fol. 46. Description.-- Complete. For other details sec No. 734. Begins and Ends.-- fol. 46 Tita HITZ31 FRIA FISH(FH)=HT ! N. B.-- For further particulars see No. 901. zrutasya bhagavataH Srutasya bhagavatab No. 903 1880-81. Extent.-- leaf 1236. 77(1). Description.-- Complete. For other details see No. 27 1880-81.. Begins and Ends.-- leaf 1230 g ( T ) HT73TT EFTIA FISFATT N. B.-- For additional information see No. 901. This is same as the 19th work of Sadavasyakasutra described as No. 734.

Page #316
905.1 11). 4 Malasairas 279 zrutasya bhagavataH Srntasya Bhagavatah 1106 (18). No. 904 1891-95. Extent.-- fol. 3a to fol. 3". Description.-- Complete. For other details see Namaskaramantra No. 736. Begins and Ends. -- fol. 34 to 36 337# WEB FITA FIJIA. N. B. - For additional information sec No. 901. zrutasya bhagavataH Srutasya bhagavatah 1220 ( 21). No. 905 1884-87. Extent.-- fol. 1902. Description.-- Complete so far as it goes. For other details ser No 1220 ( 1 ) No. 1884-87 Begins and Ends.--- fol. 1902 UT HITT HITA FISFASO I N. B.-- For additional information see No. 901.

Page #317
280 l'rina Literature and Philosophy [906. vaiyAvRttyakarasUtra Vaiyavrttyakarasutra ( veyAvaccagarasutta) ( Veyavaccagarasutta ) No. 906 1220 (23). 1884-87. Extent.- fol. 190*. 1220 (1) Description.-- Complete. For other details sce No.. 1884-87. Author.-- Not mentioned. Subject.--- Propitiation of a certain class of celestials whose activi ties are beneficial to the Jaina church. Begins and Ends.-- fol. I90 veyAvaJcagarANaM saMtigarAgaM sammadiTrisamAhi garANaM karomi kAusa ssoggaM / Reference. - Published. See any printed edition of the Pratikra manasatras. Acaradinakara (p. 2710) and Dharamasamgraha (p. 163a) may be also consulted. Vandaruvstti (p. 53 ) may be also referred to. ____In the introduction ( p. 3' ) to the edition containing Caityavandanasutra and Lalitavistara published in D. L. J. P. F. Series as No. 29, there is a remark as under-- ___ "ye vaiyAvRttyakarANAmityAdisUtraM devatAkAyotsargastatstutizca navyA ityAkhyAya tA apalapanti teSAM paramAbhanizitaiva kevalA" vaiyAvRttyakarasUtra Vaiyavrtyakarasutra No. 907 77( ). 1880-81. Extent.-- leaf 124". Description.-- Complete. For other details see Agamikavastuvicarasara No. 77 (1). 1880-81. Begins and Ends.--- leaf 124deg veyAvaJcagarANaM saMtigarANaM sammadidvisamAhi garANaM karomi kAussaggaM / N. B.--For further particulars see No. 906.

Page #318
910.) III. 4 Malasatras 281 vaiyAvRttyakarasUtra Vaiyavrttyakarasutra No. 908 1269 ( 14 ). 1887-91. Extent.-- fol. 2a. Description.-- Complete. For other details sec Namaskaramantra No. 735. Begins and Ends.---fol. 20 veyAvaJcagarANaM etc. up to karomi kAussaggaM as in No. 906. N. B.-- For additional information see No. 906. M . vaiyAvRttyakarasUtra Vaiyavrtyakarasutra No. 909 1106 (21). 1891-95. Extent.-- fol. 3. Description.-- Complete. For other details see Namaskaramantra No. 736. Begins and Ends.-- fol. 36 21177 Tiro etc. up to FA FT3 #flasi as in No. 906. N. B.-- For additional information see No. 906, FOTO vaiyAvRttyakarasUtra Vaiyavrtyakarasutra 1270 (22). No. 910 1887-91. Extent.-- fol. 5a. Description.-- Complete. For other details see Namaskaramantra No. 734. Begins and Ends.-- fol. 5 veyAvaccagarANaM etc. up to karomi kAussaggaM as in No. 906. N. B.--- For additional information see No. 906.

Page #319
282 jaina Literature and Philosophy sarvasyApisUtra Sarvasyapisutra ( porta le 57) ( Savvassa vi sutta ) 1220 ( 33). No. 911 1884-87. Extent.-- fol. 1906. 1220 (1) Description.-- Complete. For other details see No. 1884-87. Author.- A Jaina Saint. Subject. This small sutra in Prakrit deals with repentance con cerning undesirable activities resorted to, during the day time. Begins and Ends.-- fol. 1906 Haan le qafari gigiay gehia giao Triya icchAkAreNa saMdisaha / icchaM tassa micchA mi dukkaDaM // Reference.- Published. See any printed edition of the Pratikra manasutras. For an extract see B. B. R. A. S. vols. III-IV, p. 399. The svopajna commentary on Yogasastra (pp. 245245b), Vandaruvitti (p. 68) and Dharmasamgraha (p. 181") may be consulted. sarvasyApisUtra' Sarvasyapisutra No. 912 1270 ( 31 ). 1887-91. Extent.-- fol. 7b. Description. - Complete. For other details see Namaskaramantra No. 734. Begins and Ends.- fol. 7 savyasa(ssa) vi etc. up to tassa micchA mi a 15 ll as in No. 911. N. B.- For further particulars see No.911. 1 This is the 31st work which forms a part of Sadavasyakasutra described in No. 734.

Page #320
915.] sarvasyApisUtra No. 913 adendea No. 914 III. 4 Malasatras Extent.- fol. 5. Description.-- Complete. For other details see Namaskaramantra No. 736. Begins and Ends. - fol. 5 savvassa vi devasia etc. up to tassa micchA mi dukkaDaM as in No. 911. N. B. For additional information see No. 911. sarvasyApisUtra No. 915 283 Sarvasyapisutra 1106 (37). 1891-95. Extent. fol. 2o. Description. Complete. For other details see Namaskaramantra No. 735. Begins and Ends. fol. 20 santrassa vi etc. up to micchAmi dukkaDaM // cha // as in No. 911. N. B. For additional information see No. 911. Sarvasyapisutra 1269 (24). 1887-91. Extent. fol. 52. Description. Complete. For other details see Namaskaramantra No. 736. Begins and Ends. fol. 52 savvassa vi 'rAIya duciMtiya dubbhAsiya da (du)cci - TTia icchAkAreNa saMdisaha icchaM tassa micchAmi dukkaDaM N. B. For additional information see No. 911. 1 The word rAjJya is here substituted for devasiya Sarvasyapisutra 1106 (38). 1891-95.

Page #321
284 munivandanasUtra [ aDDAijesusutta ] No. 916 ! Extent.- fol. 7. Description. Incomplete. For other details see No. 734. Author. A Jaina Saint. Subject. Salutation to the Jaina saints, no matter where they are found. The sutra given here occurs as a part of Sramanasutra. Jaina Literature and I hilosophy Begins and Ends. fol. 7 aDDAije(je) su / dIvasamuddesu | panara ( sa ) su / kamma bhUmI | jAti ke vi sAhU / rayaharaNagucchapa DiggahadhArA paMcamahavvayadhArA / (a) rasa ( sa ) sa ( sa ) sIliMgadhArA akho (kkho ) bayA (yA) raca. This ends here thus. zramaNopAsakaprati 1 kramaNasUtra (samaNovAsa gapaDikamaNasutta ' ) 1 No. 917 Reference. Published. See any printed edition of the Pratikramanasutras and that of Sramanasutra ( p. 25o). -- Munivandanasutra [Addhaijjesusutta] Extent. fol. 191b to fol. 192b. Description. Complete; 50 verses in all 1220 (I). 1884-87. No. [916. 1270 (33). 1887-91. Sramanopasakapratikramanasutra (Samanovasagapadikkamanasutta) dipika. 2 This is the name given in its Curni. Sec No. 924. For other details see Author. A srutastharvira according to Ratnasekhara Suri. See his Arthadipika. This is styled as Grhipratikramanasutra by Ratnasekhara Suri in his Artha 1220 (42). 1884-87.

Page #322
917.] 111. 4. Malasatras 285 Anandasagara Suri believes that this Vandittusutra is composed by one who has composed alapakas pertaining to the vows of a sravaka which are given in the Avasyaka sutra. Sce his prastavana (p. 19 ) of Arthadipika. Subject. - This is a metrical composition in Prakrit in so verses. It is usually known as Vandittusutra. It mainly deals with partial transgressions on the part of a sravaka and his repentances for the same. It also refers to 15 karmadanas in verses 22-23, which are treated in Avasyakasutra on p. 829a. The partial trangressions pertaining to the vratas here referred to in verses 6, 10, 12, 14, 16, 18, 19, 21, 24-26, 27, 28, 29, 30 and 33 respectively are mentioned in Avasyakasutra on pp. 811, 8182 and 8185, 820", 822deg, 8232 and 8236, 825, 8279, 828a, 8 304, 831", 834", 8356, 837a and 839a. Upasakadasangasutra, too, treats these topics (see the portion pertaining to the life of Ananda sravaka ). They are also treated in Tattvarthadhigamasutra in chapter VII in sutras 18, 20, 21, 22, 23, 24, 25, 30, 27, 28, 26, 29, 31 and 32. Pancasaka I. v. 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30 and 32 may be also consulted. The 48th gatha of Vandittusutra occurs as the 1271st gatha of Avasyakasutraniryukti, and its 49th and goth gathas are found in Sramanasutra, Begins.- fol. 1916 vaMditu sabvAsiddhe / dhammAyagare ya sabyasAhu yA icchAmi paDikkamiU(u) sAvayadhammAiyArassa [sAvagadhammAiyArassa] // 1 jo me vayAirassa(?) nANe taha dasaNe caritte ya / FEAT ATT(TT) A TIETTA 11 P etc. Ends.-- fol. 1926 khAmami satve jIvve(ve) savve jIvA khamaMtu me / mittI me sababhUesu bera majjha na keNai / / 49 / 1 This very verse with a variant 4 for 19 and the next with some variants occur in Avasyakasutra on p. 763a. The first verse may be compared with the following verse of Bshatpratikramana ( a Digambara work) : "khAmami savvajIve savve jIvA khamaMtu me|| mattI meM sababhUesa varaM majjhaM na kNnn||"

Page #323
286 Jaina Literature and Philosophy 917. evamAloiya niMdiya garahiya dAThiya (samma) tivihega paDikkaMto baMdAmi jiNe cauvIsaM / / 50 Reference.-- Published. See any printed edition of the Pratikra manasutra. Haribhadra Suri's commentary (p. 778b) to Avasyakasutra, Sraddhapratikramanasutra' (D. L. J. P. F. Series, No. 48 ) and Vandaruvstti (pp. 86-159 ) may be consulted. See also B. B. R. A. S. vols. III-IV, pp. 397 and 399. My article in Gujarati which is entitled as "FAUTIAINTpaDikkamaNasutta yAne baMdittasUtra" and which is published in Jaina satya prakasa ( vol. III, No. 7, pp. 256-258) may be consulted. zramaNopAsakapratikramaNasUtra Sramanopasakapratikramanasutra No. 918 1269 ( 28 ) 1887-91. Extent.-- fol. 3a to fol. 44. Description.-- Complete; so verses in all. For other details see Namaskaramantra No. 735. Begins.-- fo. 3a SET IT etc. as in No. 917, Ends.-- fol. 4* THE STOTTT etc. up to Hot Teata 11 40 11 as in No. 917. This is followed by the line as under : iti zrAvakapratikramaNasUtraM samAptaM // cha / / N. B.- For additional information see No. 917. In Arthadipika (pp. 2020-2038 ), its author Ratnasekhara Suri refers to the opinion of some who do not losk upon this work as genuine and old, since there is no niryukti on it.

Page #324
920.) 111. 4 Malasatras 287 4 (a). zramaNopAsakA SramanopasakapratikramaNasUtra pratikramanasutra No. 919 74 (i). 1880-81. Extent.- leaf 1934 to leaf 1976. Description. Complete; the last verse numbered as 53. For further particulars see Upadesamala No. 74 1880-81. Begins.-- leaf 1938 ICT FET etc. Ends.-- leaf 1976 Heath Fathia etc. up to Feata fq' 11 43 ll as in No. 877. N. B.- For additional information see No. 917. zramaNopAsaka SramanopasakapratikramaNasUtra pratikramanasutra 77 ). No. 920 1880-81. Extent.-- leaf 918 to leaf 966. Description.- Complete ; the last verse numbered as 53. For further details see Agamikavastuvicarasara No. 330-32: Begins.- leaf 9ra Die Haftreetc. Ends.- leaf 966 savvassa jIvarAsissa bhAvaM urva me nihIya nishcito| savvaM khamAvaittA khamAmi savassa tiviheNaM // 53 // // cha / N. B.- For additional information see No. 917. 1 This is the 3rd and the last verse of Acaryadiksamanaka. So it appears that the two preceding verses also must be belonging to the same work, and that through oversight, the scribe may have combined Vandittusutra ( verses so ) with this work. As the Ms. is not with me any more, I cannot say anything definitelv. The same remark holds goods for No. 920.

Page #325
268 Jaina Literature and Philosophy [921. zramaNopAsakapratikramaNasUtra Sramanopasakapratikramanasutra No.921 1106 (55). 1891-95. Extent.- fol. 144 to fol. 156. Description.- Complete; so verses in ail. For other details see No. 736. Begins.--- fol. 14 vaMdettu satyasiddhe etc. Ends.- fol. IS evamahaM Aloiya etc. up to zrAvakapratikramaNasUtraM samAptaM / / N. B.-- l'or additional information see No. 917. zramaNopAsakapratikramaNasUtra Sramanopasakapratikramanasutra 1270 (34). No. 922 1887-91. Extent.- fol. 10^ to fol. 106. Description.---The work begins abruptly with a concluding portion of the 20th verse, and it ends also abruptly with a por tion of the 38th verse. For other details see No. 734. Begins.-- fol. 109 (bI)yami guNavae niMde / 20 // saJcitte paDibu(ba)ddhe / appau(po)laduppau(ppo)la(li)yaM ca AhAre tucchosahibhakkhaNayA / paDikkame desiyaM savvaM / 21 / iMgAlI vaNasADI bhADI phoDI suvi(va)jjae km(mm)| vANija(jja) ceva daMtala(k kharasakesavisavisayaM / 22 // etc.

Page #326
923.] III. 4 Malasatras Ends- fol. Iob sammahiTI jIyo jai vi hu pAvaM samAyare kiMci / appo si hoi baMdho / jeNa na niddhaMdhasaM kuNai // 36 // taM pi hu sapaDikkamaNaM | sappariyAvaM sauttaraharu]NaM ca // khippaM uvasAmei / bAhi bba susikkhio vijo // 38 // jahA visaM ku(TagayaM). It ends thus. N. B.- For additional information see No. 917. zramaNopAsaka SramanopasakapratikramaNasUtra pratikramanasutra 1269 (18). No. 923 1987-91. Extent. - fol. 24. Description,- jAvaMti cejhyAI and jAvaMti(ta) ke vi sAhU are looked upon by the scribe as the ist two verses. So it appears that thesc two verses along with the two following ones given here form a fragment of Vandittusutra. Out of these, the first two are already here assigned Nos. 760 and 764 respectively. So nothing can be done now at this stage. For other details see Namaskaramantra No. 735. Begins and Ends.- fol. 20 cirasaMciyapAvapaNAsaNiya bhvsyshssmhnniie| cauvIsajiNaviNaggayakahAu volaMtu me dIhA // 3 // mama maMgalamarihaMtA | sa(siddhA sAhU suhaM ca dhammo ya / .. sammaTTiI devA ditu samAhiM ca bohiM ca // 4 N. B.--- For additional information see No. 917.

Page #327
290 zramaNopAsakapratikramaNasUtra cUrNisahita No. 924 - Jaina Literature and Philosophy Size.--- 11ss in. by 4g in, Extent. 83 folios; 15 lines to a page; 64 letters to a line. Description. Country paper very thin and white; Devanagari characters with pRSTamAtrAs; small, legible and good handwriting; borders ruled in three lines in red ink; yellow pigment used; foll. numbered in the right-hand margin only ; fol. 1(c) blank ; edges of the first and last foll slightly worn out; condition on the whole good; the text and the commentary as well, complete ; extent 4590 slokas ; the commentary composed in Samvat 1183. 31 Age.- Samvat 1525. Author of the curni - Vijayasimha Suri, pupil of Santi muni. Begins. - ( text ) fol. 2 Sramanopasakapratikramanasutra with curni Subject. The Vandittusutra along with a commentary mostly in Prakrit. The latter elucidates the former here styled as Samanovasagapadikkamanasutta (Sk. Sramanopasakapratikramanasutra ). [924. vaMdit savvasiddhe dhammAyarie ya savvasAhU ya / icchAmi paDikkAmeuM sAvagadhammAiyArassa / / Then runs the com. as under :--- 1212. 1887-91. divetti vadi abhivAdanastutyoH baMdaNaM pUyaNaM namasaNaM ( ( ti )ti / pajjAyA taM caM davvao karacaraNAIhiM muddAsannAso (1) bhAvao ya maNaso gatIkaraNaM (1) kriyAyAzva sAdhyaM karmmAha / savvasiddhe ityAdi gAthApUrvArddha yAvat atra sarvazabdo niHzeSArthaH // etc. --( com. ) fol, rb OM namo jinAya || siddhaM siddhatyaM suyadhammapayAsayaM syAloyaM / loyaNatulaM loyANa namaha sirimaM mahAvIraM // 1

Page #328
291 924.1 III. 4 Malasatras samaNovAsagapaDi(ka)maNasuttacunniM bhajAmi leseNa / maMdamaINa vibohaNaheDaM suttANusAreNaM // 2 mai vihava(? ya)mao itthaM avarajjhai no na yAvi suyadappo / kougadhammajjhANaM muttuM nanno ihaM heU // 3 tA uttamA vi nisuNaMtu kougA majjhimA vi bohAya / abasaddacchiddavihavaNabhaddayA hutu nIyA vi // 4 (jA!)ijammajarAmaraNanIraparipUriyAma bhIsaNavivAgamaNodhAyuveguruchalaMta. kohAvaikasAyavalayAmuhAipAyAlakalasasaMkkhunbhamANamajhami bIiparaMparAsaMghaDaNavihaDaNapaDimasaMjogaviogapauraMmi rAgahosavikhobhiyaMmi bahujaMtumagaramacchakacchavAiMmi aidullaMghaNIyamohamahAvattarumi saMsAramahAsamuiMmi / io tao ucchuduNa nibuduNappAyaM bhavajjhamA uccanIyAsa jAIsa kuNatehi bhinnapoehiM va pANIhiM kahavi saMpunapunnavasA pAvijae bhavanIranAhatAraNarakasaM dhammajANavattaM ti / taM pi salilapavesaghAehiM aiyArehiM viNAsabhAvajjamANaM AballAiussivaNasameNa AvassaeNa daDhIbhavai / ao paidiyahaM sAhuNA sAvaeNa ya sammattamahabbayANuvvayAiyAravisohikaraNanimittaM avassakaraNi jaMti aavssyN| etc. Ends.--( text ) fol. 83a evamAloie niMdiya garahiya duguMchiya (smm)| tivihiNe paDikato baMdAmi jiNe cauvvIsaM // 50 // -( com. ) fol. 834 kayA sabajIvarAsikhAmaNA saMpai paDikkamaNaM nima( ? )mite avasANamaMgalamAha // This is followed by the Soth verse noted above. Then we have : (com. ) fol. 83deg evamiti pratikramaNasUtraNitaprakAreNa Alocya niMditvA garhitvA ku(ju gupsitvA trividhena manovAkAyalakSaNena pratikrAMto nivRttaH / pratikrAMtavyAticAragocarAditi // jattha / / 'jo me devasiGa aiyAro kao kAito' iJcAiNA daMDageNa AlokaUNa micchAdukkaDakaraNeNa AloyaNArihaM pacchittaM bhaNiyaM / duJcitiya dubbhAsiya / duJciTriyamevamAiyaM bahaso uvautto vi na yANai je devasiyAi airaaii| samvesu vi bIyapae daMsaNanANacaraNAvarAhesu / uvauttassa visohIjaiNo AloyaNA bhaNiyA / niMdA pacchAyAvaruvA / garihA gurusamakkhaM sdutvriyaae| AloyaNA / tatazca / 'taM niMde taM ca garihAmi' / iti vacanoccAraNena niMditvA gahitvA ca kiM bahunA pratikramaNasarvasvamAha / tiviheNa pddikkto| jaM kiMci kayamajuttaM sahasA pamAyamAIhiM // maNavAyAkAehiM / tasmA(?mmA) haM naNu pddikkto|

Page #329
292 Jaina Literature and Philosophy uttarottaradharmavRddhyarthe maMgalamAha // vaMdAmi jiNe cauvIsaM // siririsahanAhapaDhamaM namAmi sirivaddhamANapajjaMte || asari titthaya diMtu sivaM maMgalaM aMte / evaM sammattA paDikkamaNasuttavRttI (? cunnI ) // cha // devayA bhagavaIe || namo jayai jiNasAsaNAmiNaM // jaMbhi nilINo suheNe (Na) bhaviyajaNA | laMgheti bhavaM bhImaM || jANeNa va jattiyA jalahI / jaya iha 'caMda'gaccho caMdo iva bhaviyakumuyabohayaro || udhasamajaNhapunno samaNajaNANaMdaNo sayalo || osisIla DAgo tavaniyamarahaMga saMgayasughoso || guNagaruo gaccharaho valehiva jehiM ujjU ( ? ) Dho || siriecara sirinemicaMdanAmadheyA muNIsarA guNiNo / hutthA tatthaM satthA tesiM sIsA mahAmaiNo // je pasamassa nidaMsaNamudahI dkkhinnv|rivaarss || karaNArohaNI khANI khamiNo abhiyatrANI | sirima saMtimuNiMde tesiM sIseNa maMdamaiNA vi || AyariyavijayasIheNa viraiyA esa cunniti // jaM kiMpi mae uttamiccharayaM maIe doccalA || taM me khamaMtu sohaMtu suyaharA juggahaM kAuM // egArasahiM saehiM tesIiahiehiM (1983) vikkamanivAo || samaicchiehiM citte mAsaMmi samatthiyA esA // cha // sAvagapaDikkamaNasutta cunnI [sa | samattA // cha // graMthAgra | zlokasaMkhyA / / 4590 / / // cha // saM0 1525 varSe phAlguNasudi 13 zukre laSitaM padamAkena || cha || zubhaM bhavatu // cha // Reference.- This curni is referred to, on p. 2034 of the edition containing Sraddhapratik ramanasutra and Arthadipika published in D. L. J. P. F. Series as No. 46. The pertinent line is as under: zrAddhapratikramaNasUtrasya ca vikrama 1983 varSe zrIvijayasiMhasUri - zrI jinadevasUrikRte cUrNibhASye api staH . 16 [924 ir It seems that this very curni is referred to, in the line zrAvakapratikramaNasUtra cUrNAvapyuktama" occurring on p. 1630 of this edition.

Page #330
925.) III. 4 Malasutras 293 zramaNopAsaka SramanopasakapratikramaNasUtra pratikramanasutra cUrNisahita with curni 199. No. 925 1873-74. Size.- 134 in. by 5 in. Extent.-- 44 folios ; 22 lines to a page ; 84 letters to a line. Description.- Country paper thin, rough, briitle and greyish ; Devanagari characters with TAS; very small, quite legible, uniform and good hand-writing ; borders ruled in four lines in black ink; red chalk used; yellow pigment, too; foll. numbered in the right-hand margin only; fol. 1a blank; edges of some of the foll. slightly worn out; condition tolerably good ; both the text and the commentary complete ; extent 4590 slokas. Age.- Pretty old. Begins.- (text) fol. 2* de waarheetc. as in No. 924. , (com.) ,, Ibil to 11 Faelfart !! F fhggai etc. as in No. 924. Ends.- (text) fol. 44 TAMIET etc. up to Feath as in No. 924. ,,- (com.) fol. 44deg kayA sabajIva etc. up to graMthAnaM zlokasaMkhyA 8480 as in No. 924. N. B.-- For further particulars see No. 924.

Page #331
394 zramaNopAsaka pratikramaNasUtra arthadIpikAsahita No. 926 Jaina Literature and Philosophy Age. Pretty old. Size. 101 in. by 4 in. Extent. 244 folios; 11 lines to a page; 42 letters to a line. Description. Country paper thin, rough and white; Jaina Devanagari characters with as; big, legible and good hand-writing; borders ruled in four lines in black ink red chalk rarely used; yellow pigment rather profusely; foll. numbered in both the margins; foll. 1a and 244 practically blank, except that the title etc., written thereon; edges of the first fol. and those of the last slightly worn out; condition on the whole good; both the text and the com. mentary complete; the latter composed in Samvat 1496; its extent 6644 slokas. Author of the commentary. [926. Sramanopasakapratikrama nasutra with Arathadipika 1213. 1887-91. Ratnasekhara Suri, pupil of Bhuvanasundara Suri, pupil of Somasundara Suri. He should not be confounded with the author of Sirisirivalakaha. I This is styled as tika, too. Our Ratnasekhara Suri is an author of Sraddhavidhiprakaranavrtti, Arthakaumudi and Vidhikaumudi referred to, on pp. 52, 188 and 203 of the edition containing Arthadipika. Subject. A religious sutra pertaining to the pratikramanakriya of sravakas along with its explanation (vrtti)' in Sanskrit. This explanation is called Arathadipika. There in the text is styled as Grhipratik ramanasutra, in the beginning and as Pratikramanasutra, Sravakapratikramanasutra and Sraddhapratikramanasutra in the end.

Page #332
926.] III. 4 Malasutras ___ 295 Begins. ~~~ (text) fol. 30 vaMdittu savvasiddha etc. as in No. 917. __ - (com.) ,, jayati satatodayazrIH etc. as in No. 928. Ends.-(text) fol. 2420 evamahaM AloIe etc. as in No. 918, , - (com.) ,, ,, evamAlocya niMditvA garhitvA jugupsitaM duzcikitsitaM kA aticArajAtaM samyak trividhena manovAkkAyalakSaNena pratikrAMtaH kRtapratikramaNa zvaturviMzatiM jinI(nA)n vaMde iti prAMtagAthArthaH 50 abAha paraH idaM pratikramaNasUtra kena kRtaM ucyate yathA'parapratikramaNasUtrANi zrutasthavirakRtAni tathaitadapi yaduktamAvazyakabRhavRttI 'akkharasannI ti gAthA( vyA )khyAne aMgapraviSTaM gaNadhararutamAcArAMgAdi anaMta(ga)praviSTaM tu sthavirakRtamAvazyakAdIni atha zrAvakapatikamaNasUtrasya yadyA. patvaM tadA kiM na tasya niyu(yu)ktibhASyAdIti cet tarhi Avazyaka-dazavaikAlikAdidazazAstrIvyatiro( re )keNa zeSANAM niyuktayabhAvAdaupapAtikAya( grupAM)gAnAM ca cUrNerapyabhAvAdanArSatvaprasaMgastasmAnna kicidetat / zrAddhapratikramaNasUtrasya ca vikrama 1183 vArSaH(rSe) zrIvijayasiMhamUrizrIjinadevasUrikRte cUrNi-bhASye api sto vRttayazca baDhyaH ataH zrutasthavirakRtatvena sarvAtIcArAvizodhakatvena ca zrAvakairetadupAdeyameva sAdhubhiH svapratikramaNasUtrAmiva evaM sati ye svakadAgrahamAtrAbhiniviSTadRSTayaH pAzcAtyena kenacikRtaM sarvathA'nupAdeyamidamiti bruvate na bidmAsteSAM kA gatiH sarvajJapraNItaprAcInasthavirAcaritasamyagmArgasyopamardanAt tadbha( dU)vo(ce) ranno ANAbhaMge ikka(kkuccia mi(ni)ggaho havai loe samvanA(nA)NAbhAM(bhaM)ge aNaMtaso niggahaM lhi| nanu zrAvakasya pratikramaNakara( Na )mevA'saMgataM dUre(s)stu pratikamaNasUtravicAraH tadapi pralApamA siddhAMte zrAddhAnAmanekatra tasyoktatvAyadanuyogadvArasUtraM " 'se kiM taM louttariuM bhAvAvassayaM jana samaNo vA samaNI ga sAvao vA sAdhiA vA tascine / jAva ubhao kAlaM AvasmayaM karei tti" tayA tatraiva ""samaNeNa sAvaeNa ya aghassavA(? kA )yavya havai jamhA aMto ahonisassA tamhA AvassayaM nAma / 1 I See p. 30of Anuogaddara ( Samiti edn. ). 2 Irid., p, pra.

Page #333
296 Jaina Literature and Philosophy [926. nayAMgavRttikadabhayadevamUri-kalikAlasarvajJazrIhemasUripramukhapUrvAcAryaraciteSu paMcAzakatti-yogazAstrapravRttiyatheSu na zrAddhAnAM pratikramaNa sAkSADhuktaM sarvaprasiddhameva tacca paMcabhedaM desikaM 1 rAtrikaM 2 pAkSikaM 3 vAturmAsikaM 4 sAMvatsarikaM 5 ceti eSAM kAlavidhyAdi mankRtavidhikaumudyA avadhArya cha vikhyAta'tapetyAkhyA jagati jagaccaMdrasUrayo'bhUvan / / zrIdevasuMdaragurUtamAzca tadanu krmaadviditaaH||1|| paMca ca teSAM ziSyAsteSvAdyA jJAnasAgarA gurava vividhAvacUrNilahariprakaTanataH sAnvayAhvAnAH // 2 // zrutagatavividhAlApakasamuddhRtaH samabhapaMzca sUrIMdrAH // kulamaMDanA dvitIyA zrIguNaratnAH tRtIyAzca // 3 // SaT(i)darzanavRttikriyAratnasamuccayavicAranicayasRjaH / / zrIbhuvanasuMdarAdiSu bheje vidyAgurutvaM ye // 4 // zrIsomasuMdaragurupravarAsturyA ahAryamahimAnaH / / yebhyaH saMtatiruccairbhavati dvedhA sudharmabhyaH // 5 // yatijItakalpa(vi)(ta)zva paMcamAH sAdhuratnasUrivarAH / / yairmAdRzo'pyaRSyata karaprayogeNa bhavapAt // 6 // zrIdevasuMdaraguroH paTTe zrIsomasuMdaragaNeMdrAH / yugavaravadvijayaMte teSAM ziSyAzca paMcaite // 7 // mArItyavamanirI( rA )kRtisahasranAmasmRtipravRttikRtyaiH / / zrImunisuMdaraguravAzciraMtanAcAryamAhama(bhU )taH // 8 // zrIjayacaMdramunIMdra(drA) nistaMdrAH saMghagacchakAryeSu // zrIbhuvanasuMdaravija(varA) dUrAvahArairgaNopakRtaH // 9 // ekAMgo( gA) apyekAdazAMginazca jinasuMdarAcAryAH / / nirgrathA graMthakRtaH zrImajinakIttiguravazva // 10 // eSAM zrIgurUNAM prasAdato'bde SaDaMkavizva14(9)6 mite / / zrIratnazeSa(kha)ragaNittimimAmakRta kRtituSTayai // 11 // cAturvidyodadhibhirdadhizuddhaparamaparabhAga / / . sA(5)zodhyata prayatnA( la )lakSmIbhadrAhvavibudhaiH // 12 // Si( bi )jJAvataMsavihitaprazaMsagaNisatyahasavibudhAyaiH / / su(e)rubhaktyA'syAH prathamAdarza sAnnidhyamAdhAyi // 13 // etasyAM TIkAyAmanuSTubhAmarthadIpikAnAmbhyAM // padaSTizatIccatvAriMzaccatu (ru)tarA'numitA // 14 // varacUrNivividhavRtyAyanusRtya kRteyamalpamatinA(5)pi // utsUtramatra vibudhaiH zodhyaM jIyAdiyaM ca ciraM // 15 //

Page #334
927.) III. 4 Malasutras 297 fat xftaar'sal( 971 ) HORTA ETIVATT: ## cha graM0 411 samApta(ptA ) ceyamarthadIpikAnAmnI zrAvakapratikamaNa sUtraTIkA cha sarvAgraM0 6644 // // Reference. - Both the text and Arthadipika are published in A, D. 1919 in D. L. J. P. F. Series as No. 48. In this edition we have Sanskrit introduction, a table of contents, an alphabetical index of quotations, and that of proper names, maxims etc., and laukika nyayas. For Mss. containing the text and Arthadipika see Limbdi Catalogue No. 2612. zramaNopAsaka SramanopasakapratikramaNasUtra pratikramanasutra arthadIpikAsahita with Arthadipika 817. No. 927 1895-1902. Size.- 104 in. by 48 in. Extent. -- 174 folios ; 15 lines to a page ; 40 letters to a line. Description - Country paper rough, thin and white ; Devanagari characters, big, clear and good hand-writing ; borders ruled in two lines and edges in one, in red ink; yellow pigment profusely used ; foll. numbered in the right-hand margin only ; fol. 1a blank ; a strip of paper pasted to fol. 1a ; edges of the first and last foll. slightly worn out; condition on the whole good ; both the text and the commentary complete ; the extent of the latter 6644 slokas Age.- Not modern. Begins -(text) fol. 3a ai@Jazarene u#1( a brey a etc., as in No. 91%. ,, -(com.) fol. 1BFTTETT A#: !! wafa Haitiaft: etc., as in No. 930.

Page #335
298 Jaina Literature and Philosophy [ 927. Ends -(text) fol. 1736 GTA SHITET etc., as in No. 917. , -com.) fol. 173b SaaroST fierar tigrar etc., up to ITU a fari as in No. 926. This is followed by the lines as under :iti zrI tapAgacchazrAddhapratikramaNasUtravRttau zeSAdhikAraH paMcamaH samAptA ceyamarthadIpikA nAmnIH // zrAvakapratikramaNasUtraTIkA samAptAH graMthAna 6988 ll 37 II a II N. B.- For further particulars see No. 926. DAM zramaNopAsaka SramanopasakapratikramaNasUtra pratikramanasutra arthadIpikAsahita with Arthadipika 767 No. 928 1899-1915. Size.-- 95 in. by 41 in. Extent.-- 217-8=209 folios ; 13 lines to a page ; 38 letters to a line. Description.- Country paper rough and white; Devanagari characters with quar ; small, legible, uniform and good hand-writing ; borders ruled in four lines in red ink ; red chalk used; foll. numbered in the right-hand margin only; unnumbered sides have a small disc in red colour, in the centre only; the numbered, in the margins, too; fol. ra decorated with a design in various colours ; foll. 40 to 47 missing ; otherwise both the text and the commentary complete ; foll. 123 to 136, 147 to 179 etc. slightly wormeaten ; condition tolerably good ; extent of the commen tary 6644 slokas. Age. Samvat 1697. Begins,-- (text) fol. 3h SE FORTA TATOTT etc., as in No. 917.

Page #336
929.] .4Malasatras 299 Begins.-- (com.) fol. 10 jayati satatodayazrIH etc., as in No. 930. Ends.-- (text) fol. 2170 evamahaM Aloia etc., as in No. 927. ,, -- (com.) fol. 217 evamAlocya niMditvA garhityA etc., up to samAptA ceyamarthadIpikAnAmnI zrAvakapratikramaNasUtraTIkA // cha / / gaMthAnaM 6644 as in No. 926. This is followed by the lines as under :-- yAvad vyomasara kroDarAjahaMsa virAjate // vibudhairvAcyamAnApi tAvannaMdatu pustikA // 1 // cha / saMvat 1697 varSe caitramAse zuklapakSe tritIyA ravivAre zrAddhapratikramaNasUtravRtti(:) samAptA || yAdRzaM pustakaM etc. N. B.- For additional information see No. 926. zramaNopAsakapratikramaNasUtra arthadIpikAsahita Sramanopasakapratikramanasutra with Arthadipika 679. 1892-95. No.929 Size.-- Iom in. by 4g in. Extent.-- 194-1 = 193 folios ; 12 lines to a page ; 35 letters to a line. Description.--Country paper rough, thin and white; Devanagari characters with pRSTamAtrAs; big, clear and tolerably good hand writing ; borders ruled in four lines in black ink ; this Ms. contains the text as well as its commentary ; foll. numbered in the right-hand margin only; edges of the first fol. slightly worn out; a portion of the second fol. gone ; fol. 159 to 168 have only the left-hand corner worn out, whereas fol. 169 to 194, the right-hand one as well ; condition unsatisfactory; fol. 166th missing ; both the text and the

Page #337
300 Jaina Literature and Philosophy [929. commentary incomplete; this Ms. contains 49 complete gathas of the text and 50th partly and the commentary pratically up to that of 49th gatha ; red chalk used; fol. r blank. Age.-- Old. Begins.-- (text) fol. 3 " (com.) " Ends.-- ( text ) fol. 1942 vaMdita saccAsiddhe etc. as in No. 924. Ib jayati satatodayazrIH etc. as in No. 930. khAmami savvajIce haM sabbe jIvA khamaMtu me / mitI me savvabhUre veraM majjha na keNai / / 49 / / ( evamahaM ) Aloia naMdia garahia This Ms. ends thus abruptly. ( com. ) fol. 194b uktaM hi jJAnAMkuze maniyA yadi janaH paritoSameti nanvaprayAsatito (? sulabho ) yamanugraho me / zreyorthinA (no ) hi puruSAH paratuSTito -- duHkha (khA) jjitAnyapi dhanAni parityajati // 1 // etc. evamanena prakAreNA'haM samyagAlocya This ends thus abruptly. N. B.-- For Mss. of the text see Limbdi Catalogue Nos 26172620. For additional information see No. 926. zramaNopAsaka pratikramaNasUtra arthadIpikAsahita No. 930 Size.-- ro++ in. by 4 1 See p. 2020 of the printed edition. in. Sramanopasakapratikramanasutra with Arthadipika 1307. 1891-95.

Page #338
930.] III. 4 Malasutras 301 Extent.-- 92 folios ; IS lines to a page ; 58 letters to a line.. Description.-- Country paper thin, rough and grey ; Devanagari characters with pRSTamAtrAs; neither too big nor too small, bold, clear and good hand-writing; borders rather carelessly ruled in two pairs of lines; the space between these pairs coloured red; preceding the first fol. there is a blank fol.; therein only the title of the Ms. is written ; so is the case with fol. 921), fol. 1a blank; unnumbered sides decorated with a small circular disc in red colour in the centre; the numbered, with two more, one in each of the two margins ; red chalk used ; incomplete ; for, it contains 27 gathas of the text and a commentatry of 26 gathas completely and that of a part of the 27th ; condition very good. Age.-- Pretty old. Begins.--(text) fol. 2b baMdittu savvAsaddha dhammAyarie a sabbasAhU a | icchAmi paDikkami sAvagadhammAiArassa // 1 // etc. ,, --(com. ) fol. xb // 60 // jayati satatodayazrIH zrIvIrajinezvaro'bhinavabhAnuH / kuvalayabodhaM vidadhati gavA(bAM) vilAsA vibhoryasya // 1 // etc... zrIsomasuMdaragurupravarAH prathitA stapA'gaNaprabhavaH / pratigautamataH saMprati jayaMti niSprAtamamahimabhRtaH // 3 // teSAM vineyavRSabhA bhAgyabhuvo bhuvanasuMdarAcAryAH / vyAkhyAnadIpikAdyagraMthairye nijayazo'yathnan // 4 // teSAmeSAM'tiSadaMtimaH kimayAdadhAti sukhbodhaaN| vRttiM svaparahitArtha gRhipratikramaNasUtrasya / / 5 / / etc ,, ,, fol. 90deg iti zrI tapA zrAddhapratikramaNasUtravRttau guNavatAdhikAra stRtIyaH / Ends.-- (text ) fol. 900 tivihe duppaNihANe aNavaTANe tahA sighihunne| sAmAia vitaha kae paDhame sikkhAvae nide / 27 /

Page #339
302 Ends.- ( com. ) fol. 92a Jaina Literature and Philosophy ballIo velAe phalati sayalAo coriA u layA / takkAlameva jAyai jIi mahi darido vi // 30 // tA kiM karissa minhi ahavA jaM hoi hou taM savvaM / coriMcAmi kaha jAe vilasAmi ( sacchaMda ? 31 ) It ends thus. N. B.-- For additional information see No. 926. zramaNopAsaka pratikramaNasUtra vivaraNasahita No. 931 Extent. -- fol. 14h to fol. 200. Description.-- Complete. For other details see Caityavandanavrtti No. 847. Author of the commentary.- Sritilaka Suri, pupil of Sivaprabha Suri, sucessor of Cakra Suri. -- rw Subject. The text along with its explanation in Sanskrit. Begins.--(text) fol. 14 b vaMdita savvasiddhe dhammAiyare savvasAhU a / icchAmi paDikkamiuM sAvagadhammAiyArasya // 1 - (com) fol. 14b prA (pra) NidhAye zrIvIraM / svalparucInAM kRte samAsena vivaraNamidaM kariSye gRhi pratikramaNasUtrasya / tatrAdau maMgalAbhidheyapratipAdikeyaM // etc. Ends. -- (text) fol. 200 eva (maha) mAloiya niMdiya garihaya durgAchiya (yaM samma) tiviheNa paDikato vaMdAmi jiNe cautrIsaM / / 50 / / I See p. 152a of the printed edition. [ 930. Sramanopasakapratikramanasutra with vivarana 1293 (e). 1886-92.

Page #340
932.] I11. 4 Malasatras 303 Ends.-- (com.) fol. 200 evaM pratikramaNasUtrabhaNitaprA(pra)kAraNAlocya niMditvA garhitvA jugu" psitvA vividhena prazaMti (saMprati ) jinAna(na) baMde nmskaa(k)romiityrthH| pratikramaNavivaraNaM // zrIcakrasUrigurupaTTamahodayAdri pradyotanopama(ma) zivaprabhasariziSyaH / zrIprAkpadastilaka'sUriradhIdhano')pi / zrAddhapratikramaNasUtramidaM vivave // 1 iti zrItilakAcAryaviracitA zlokazatadvayapramANA pratikramaNasUtralaghu vRtti(H) samarthayAMcakre // cha / Then in a different hand we have : kartA tilakasariH Reference.-- See Jaina granthavali (pp. 30-31 ). zramaNopAsakapratikramaNasUtravivaraNa Sramanopasakapratikramanasutra vivarana 200 (f). 1873-74. No. 932 Extent.-- fol. 185 to fol. 216. Description.-- Complete ; extent 200 slokas. For other details see No. 200 (a). 1873-74. Author.-- Sritilaka Suri. For particulars see p. 302. Subject. A small commentary in Sanskrit explaining the Van dittusutra. Begins.- fol. 186 // 6 // praNidhAya zrIvIraM svalparucInAM kRte samAsena / vivaraNamidaM kariSye gRhipatikramaNasUtrasya // 1 // etc. 1 This means Sritilaka. 2 This ought to be Sritilaka and not Tilaka.

Page #341
304 Jaina Lilerature and Fhilosophy [932. Ends.-- fol. 21 iti zrItilakAcAryaviracitA zlokazatadvayapramANA zrAvaka pratikamaNasUtravattiH // 200 graMthAgraM // cha / maMgalaM mahAzrIH // zubhaM bhavatu lekhakapAThakayoH // kalyANaM bhavatu kRtInAM / / N. B.-- For reference sec No. 931. zramaNopAsaka SramanopasakapratikramaNasUtra pratikramanasutrabAlAvabodha balavabodha 821. No. 933 1892-95. Size.-- 10 in. by 43 in. Extent.-- 18 folios ; 14 lines to a page; 46 letters to a line. Description.-- Country paper rough, tough and white; Devanagari characters ; big, clear and tolerably good hand-writing; borders ruled in two pairs of lines in black ink; the space between these pairs coloured red; yellow pigment used; foll. numbered in the right-hand margin only; the numbered sides have a small design in red colour at least in the centre ; condition excellent; this Ms. contains the - pratIkas of the text ; complete. Age.-- Old. Author.--- Not mentioned. Subject.-- An explanation in Gujarati of the Vandittusutra, based upon the commentary composed on it by Sricandra Suri. Begins.--- fol. I e 60 // vaMdittu satvasiddhe0 / ityAdi / vaMdittu bAMdI karI | etc. Ends.-- fol. 18' iti zrIcaMdrasUrikRtamahArthazrAddhapratikamaNavRttyanusAreNa vaMditta bAlAvabodhaH samAptaH / zreyase( 5 )stu lekhkvaackyoH|| Reference.-- For an anonymous balavabodha see Limbdi Catalogue No. 2618.

Page #342
934.] trividhAhAropavAsa Prentena (tivihAra- uvavAsapaccakkhANa ) No. 934 Extent. fol. 191a. III. 4. Malasatras Trividhaharopavasa pratyakhyana (Tivihara-uvavasapaccakkhana) 305 Description.-- Complete. For other details see No. Author. A Jaina saint. Subject.--A Prakrit formula representing a vow undertaken by one who wants to observe abhattha, a Jaina fast, but does not want to refrain from drinking water during the day time. granthisahita pratyAkhyAna ( gaThisahiya paccakkhANa ) 1220 (37). 1884-87. Begins.-- fol. 1914 mUre uggae abbhataGkaM paJcakakhAi tivihaM pi vA ( A ) hAraM / asaNaM pANaM khAimaM sAimaM / etc. 1220 (1).. 1884-87. Ends. fol. 191* sahasAgAreNaM mahattarAgAreNaM / samma ( ?vva ) samAhibattiyAgAreNa anarfa | 3qaleCEFEJO || 3 || Reference.-- Published. For a parallel extract see B. B. R. A. S. Vols. III-IV, p. 399. See Vandaruvrtti (p. 75 ). In the edition containing Pratyakhyana, Sarasavatavibhrama, Danasattrimsika, Visesanavati and Vimsatika, and published by Sri Rsabhadevji Kesarimalji Samstha, Rutlam in A. D. 1927, we have pratyakhyana-sutras. No. 935 Extent. fol. 4a. Description. Complete. For other details see No. 735. Granthisahita pratyakhyana (Ganthisahiya paccakkhana) 1269 (34). 1887-91.

Page #343
306 Jaina Literature and Philosophy [935. Subject. This is a pratyakhyana whereby every time one wants to take any kind of food, one has to untie a knot and after taking food one has to tie a knot again. Thus this is a sanketika pratyakhyana, one of the varieties of pratyakhyana noted on p. 312. Begins and Ends. - fol. 42 gaMThisahiyaM paJcakkhAmi caunvihaM pi AhAraM asaNaM 4 annattha / sahasA / mahattarA / savvasamAhi / bosirAmi // 4 Reference. Published practically in any edition of Pancapratikramanasutras. vikRtipratyAkhyAna (fangqzazio) No. 936 Extent. fol. 4a. Description. Complete. For other details see No. 735. Subject. This is a vow undertaken by one who wants to refrain from taking any of the vikrtis. Reference. Begins and Ends. fol. 42 vigaio paccakkhAmi annattha / sahasA | levAleveNaM gihatthasaMsiddheNaM | ukkhittavivegeNaM / paDucca makkhieNaM | pArihANiyAgAreNaM mahattarA / savasamAhi / vosirAmi // cha // 5 Vikrtipratyakhyana (Vigaipaccakkhana) ekAzanAdipratyAkhyAna (egAsaNAdipaJcakkhANa ) Published. This very pratyakhyana occurs in the svo pajna commentary (p. 189b) on Dharmasaingraha, with this difference that instead of paccakkhAmi and vosirAmi we have paccakkhai and vosirai respectively. No. 937 Extent. fol. 150b to fol. 191a. 1269 (35). 1887-91. Ekasanadipratyakhyana (Egasanadipaccakkhana) 1220 (35). 1884-87.

Page #344
938. III.4Malasatras 307 Description. Complete. For other details see No. 1882-87: an_1220 (1). Author. - A Jaina saint. Subject. -- A formala for taking a vow of abstaining from several articles of food etc. Perhaps this work is same as No. 935. Begins and Ends.--- fol. 190deg gaThisahiyaM paJcakkhAmi / cauvihaM pi AhAraM / asaNaM pANaM khAimaM sAima | annatyaNAbhogeNaM / sahasAgAreNaM / mahattarAgAreNaM savvasamAhivattiyAgAreNaM bosirAmi // // cha || ekAsaNAviniya(?). paccakhANaM // cha / Reference.- Published. An edition (p. 8534) containing Hari bhadra Suri's commentary to Avasyakasutra mentions this as a sutra of Avasyakasutra. Vandaruvrtti ( pp. 72-73) may by consulted. For an extract sce B. B. R. A. S, Vols. III-IV, p. 399. dvividhihAraikAzana DvividhaharaikasanapratyAkhyAna pratyakhyana (duvihAra-egAsaNa (Duvihara-egasanapaccakkhANa) (paccakkhana ) 1269 (36). No.938 1887-91. Extent.--- fol. 4deg. Description.-- Complete. For other details see No. 735. Subject. -- This is a pratyakhyana whereby meals can be taken only once, but water and svadima ( relishes), a number of times. It also includes Desavakasika vrata with all sorts of limita tions except those pertaining to dravya and sacitta. Begins and Ends.-- fol. 4 egAsaNaM paccakkhAmi duvihaM pi AhAra asaNa khAimaM / annattha sahasA / sAgAriyAgAreNaM AuMca(Ta)NapasAraNeNaM guruabbhuTrANaNaM / pAriTrA / maha savvasa dravyasacittadesAvagAsiyaM avabhoyaparibhogaM paccakkhAmi | anna | saha / mahatta savvasa / vosirAmi // cha / 6

Page #345
308 Jaina Literature and Philosophy 1938. Reference.-- Published practically in most of the editions of Panca pratikramanasutras. For comparison see p. 853a of the the edition of Avasyakasutra containing Haribhadra Suri's commentary. dvividhAhArakasthAna DvividhaharaikasthanapratyAkhyAna pratyakhyana (duvihAra-egahANa ( Duvihara-egatthanapaJcakkhANa) paccakkhana No. 939 1269 (37). 1887-91. Extent.-- fol. 48 to fol. 46. Description.- Complete. For other details see No. 735. Subject:- This is a pratyakhyana whereby meals can be taken only once and that, too, by keeping all other limbs except mouth and hand steady. It is permissible to drink water and to take svadima as many times as one pleases. Begins and Ends -- fol. 44 gatelui FETA DIRE for STTETE SHUI FISA 347) REI FUIT I 963 IGT I AF I ETF I TATIA I J 110 Reference.-- Published mostly in any of the editions of Panca pratikramanasurtas. abhaktArthapratyAkhyAna (377737010) Abbaktarthapratyakhyana ( Ablattatthapaccakkhana ) No. 940 1269 (38). 1887-91. Extent.-- fol. 46 Description.-- Complete. For other details see No. 735.

Page #346
94i.] III. 4 Malasutras 309 Subject.-- This is a pratyakhyana whereby one undertakes to observe a fast, and there too, to drink water after a specified interval. Herein is included Desavakasika vrata which ordinarily sets a limit in 14 ways, but here two of them are excluded. Cf. Nos. 934 and 938. Begins and Ends.- fol. 4 sUre uggae abhattaTuM paJcakkhAmi tivihaM pi AhAraM asaNaM khAimaM anna / sahasA / pAri / maha / svv| pANahAra gaMThisahiyaM paJcasvAmi / anna / saha / dravya / sacittaniyamudesAvagAsiya bhogaparibhoga / annattha / saha | savva / vosirAmi // 8 Reference.-- Published. For comparison see the pratyakhyana given in the commentary (p. 1886) on Dharmasangraha. divasacarimapratyAkhyAna Divasacarimapratyakhyana (divasacariyapaccakkhANa) (Divasacariyapaccakkhana) 1220 (38). No. 941 1884-87. Extent.-- fol. 1914. 1220 ( Description -- Complete. For other details see No. - 1884-87. Author.-- A Jaina saint. Subject. -- A Prakrit formula representing a vow undertaken by one at about sunset (that is why it is called divasacariyaM paJcakvANa) with a view to abstain from at least food and khadima. This means that there are three varities of this pratyakhyana viz. (1) caturvidhAhAradivasacarima, (2) trividhAhAradivasacArama and (3) dvividhAhAracArama. In the Ist variety all the four types of food are given up; in the 2nd all except drink, and in the third, all except drink and relishes. Begins.--fol. 191 divasacarimaM pnyckkhaami| duvihaM tivihaM caunvihaM pi AhAraM etc. Ends.-- fol. [9r anatthaNAbhogeNaM sahassAgAreNaM mahattarAgAreNaM savasamAhi vattiyAgAreNaM vosirAmi // cha / rAtripratyAkhyAnaM // cha / /

Page #347
310 Jaina Literature and Philosophy [941. Reference.--- Published. For an extract see B. B. R. A. S. Vols. III-IV, p. 399. Cf. Vandaruvrtti (p. 76 ). caturvidhAhAradivasa CaturvidhaharadivasacarimAdipratyAkhyAna carimadipratyakhyana (cauvvihAradivasa (CauvviharadivasacariyAipaccakkhANa) Cariyaipaccakkhana) No.942 1269 (39). 1887-91. Extent.-- fol. 46. Description.-- Complete. For other datails see No. 735. Subject.-- This is a formala meant for one who wants to observe Caturvidhaharapratyakhyana and Desavakasika as well. Begins and Ends.-- fol. 4 divasaca[2]rimaM paJcakkhAmi caunvihaM pi AhAra asaNaM / 4 anna / sa ma / savva / desAvagAsiyaM bhogaparibhoga paccakakhAmi / anna / saha / maha / savva samA / vosirAmi // cha / / 9||ch / zrI: Reference.-- Mostly published in some of the editions of Panca pratikramanasutras. sAkArabhavacarima SakarabhavacarimapratyAkhyAna pratyakhyana (sAgArabhavacarima (SagarabhavacarimapaccakkhANa) paccakkhana ) No. 943 75 (b). 1898-99. Extent.-- fol. 36. Description.--- Complete. For other datails see No. 407. Subject.- This is a pratyakhyana whereby fasts are undertaken till death, and that only water is allowed to be drunk. But under certain abnormal circumstances, one may not carry out this vow. Begins and Ends.--fol. 3" sAgArapaccakhANa gAthA / /

Page #348
945.] III. 4 Malasatras 311 jai me hujja pAo / 0 // bhavacAramaM pnycvkkhaaii| tivihaM pi AhAraM / asaNaM khAimaM sAimaM annatthaNAbhogeNaM / sahasAgAreNaM / 0 arihaMta sakkhiyaM / siddhasa devasa0 appasa vosirai / Reference. -- Published. sAkArapratyAkhyAna (sAgArapaccakkhANa ) No. 944 Extent. -- leaf 8ob to leaf 814. Description.-- Complete. For other details see Dasavaikalikasutra niryukti No. 711. Begins.- leaf 8ob Sakarapratyakhyana ( Sagarapaccakkhana ) 76 (15). 1880-81. sa karemi paNAmaM jiNavaravasahasta vaddhamANassa sesANaM ca jeNANaM sagaNaharANAM ca savvesiM / 1 etc. Ends.-- leaf 814 iti sAgArapratyAkhyAnaM samAptaM cha / cha || N. B. -- For additional particulars see No. 943. anAkArabhavacarima pratyAkhyAna ( aNAgArabhavacariyapaccakkhANa ) No. 945 Extent. -- fol. 3. Description.- Complete. For other details see No. 407. Subject.-- This is a pratyakhyana whereby one undertakes to refrain from all the varieties of food except drinks, and that too, even under adverse circumstances. Reference. - Published. Anakarabhavacarimapratyakhyana ( Anagarabhavacariya - paccakkhana ) 75 (c ). 1898-99. tivihAraanazanagAthA / bhavacAramaM nirAgAraM paJcakakhAi / cauvihaM pi AhAraM / savvaM asaNaM satyaM pANaM / savvaM khAimaM / satyaM sAimaM / annatthaNAbhogeNaM / sahasAgAreNaM mahattarAgAraNaM / savvasamAhivattIyAgAreNa vosirai | cha || // zrI // zrI //

Page #349
312 namaskArasahita pratyAkhyAna ( namukkAra sahiya paccakkhANa ) No. 946 Jaina Literature and Philosophy Extent. --- fol. 6. Description. Complete. For other details see Namaskaramantra No. 736. Subject. This pratyakhyana is one of the 10 varieties of Addhapratyakhyana. It means denial of taking any type of food, drink, etc. for 48 minutes. For details see the following table : mUlaguNa mUlaguNa (pazca mahAvrata) pratyAkhyAna 1 deza mUlaguNa (pazca aNuvrata, sarva uttaraguNa carima Beging and Ends.- fol. 6a I uttaraguNa deza uttaraguNa (3 guNavrata + 4 zikSAvrata) 1 1 1 anAgata atikrAnta koTisahita niyantrita sAkAra anAkAra parimANakRta niravazeSa 1 sAGketika aDA 1 namaskArasahita pauruSI purimArtha ekAzana ekasthAna AcAmla abhaktArtha Namaskarasahita pratyakhyana (Namukkarasahiya paccakkhana ) 1106 (49). 1891-95. [ 946. ! vikRti 1 See Avasyakasutraniryukti v. 1563-1565 and 1597. abhigraha atha dazapacacakkhANa likhyate uggee bhUre namu kArasahiyaM paJcakkhAi caubdhihaM pi AhAraM asaNaM pANaM khAimaM sAimaM annatthaNAbhogeNaM sahassAgAreNaM vosirai 1

Page #350
948.) 111. 4 Malasatras 313 Reference.- This very pratyakhyana is published in the svopajna commentary (p. 184") on Dharmasamgraha. Cf. Avasyakasutra (p. 8490). namaskArasahita Namaskarasalita pratyAkhyAna pratyakhyana No. 947 1269 (31). 1887-91. Extent.- fol. 4* Description.- Complete. For other details see No. 735. Begins and Ends.-- fol. 42 11 8011 JTITC FIEITHIEU T RAI caubvihaM pi AhAraM asaNaM pANaM khAimaM sAimaM / annatthaNAbhogeNaM sahasAgAreNaM vosirAmi // cha / 1 Reference.--In the svopajna commentary (p. 1846 ) on Dharma samgraha, this pratyakhyana is given, but instead of adhiff, there is a lihts. N. B.- For subject see No. 946. pauruSIpratyAkhyAna Paurusipratyakhyana (giferqeater) (Porisipaccakkhana) 1269 (32). No. 948 1887-91. Extent.- fol. 4*. Description.-- Complete. Through oversight this work is styled as Upavasapratyakhyana on p. 153. For other details see No. 735. Subject.-- This is a pratyakhyana whereby one binds oneself for refraining for one eighth of a day, from taking any kind of food whatsoever.

Page #351
314 Jaina Literature and Philosophy [948. Begins and Ends.-- fol. 4 porasiM paJcakkhAmi uggae sUre caubvihaM / pi [Api] AhAraM asaNaM // 4 annatthaNA (0) sahasA (0) pacchannakAleNaM disA moheNaM sAhuvayaNeNaM sabasamAhivattiyAgAreNaM vosirAmi // 2 cha Reference.- Published in several editions of Pratikramanasutras. See also p. 852b of the printed edition of Avasyakasutra containing Haribhadra Suri's commentary. Herein it is given as one of the sutras of Avasyakasutra. purimArthapratyAkhyAna Purimardhapratyakhyana (purimaDDapaccakkhANa) (Purimad dhapaccakkhana) 1269(33). No. 949 1887-91. Extent.-- fol. 4a. Description.-- Complete. For other details see No. 735. Subject.-- This is a pratyakhyana whereby one binds oneself to refrain from taking any article of food, drink etc., for the first half of the day. Begins and Ends.-- fol. 42 sUre uggae purimaDUM paJcakkhAmi caunvihaM pi AhAraM asaNaM / 4 annatthaNA / sahasA pacchanna / disA / sAhu / mahattarAgAreNaM sabasamAhivattiyAgAreNaM vosirAmi // 3 Reference. Published in several editions of Pancapratikramana sutras. AcAmlapratyAkhyAna Acimlapratyakhyana (AyaMbilapaccakkhANa) (Ayambilapaccakkhana ) No. 950 1220 (36). 1884-87. Extent.- fol. 19r. 122011). Description.-- Complete. For other details see No. 1884-87. Author.-- A Jaina Saint.

Page #352
951. ] II 1.4 Malasatras 315 Subject. -- A Prakrit formula pertaining to a vow to be undertaken by a person who wishes to observe a penance known as Acamla along with Desavakasika vrata. This Acamla resembles ekasana but there are limitations regarding the varieties of food etc. to be taken. Begins... fol. 1912 VIT E DITE gitag ar qaFETA I leag sa AhAraM / etc. Ends.-- fol. 1918 Chanera | HttafeHiTT I STUOTTHISTU I TERITO savvasamAhivattiyAgAreNaM vosirAmi // AMbilaM paccakkhANaM / / Reference.-- Published. Cf. B. B. R. A. S. Vols. III-IV, p. 399 and Vandaruvitti (pp. 74-75.). pratyAkhyAnasUtra Pratyakhyanasutra (72EA) (Paccakkhanasutta ) TabbAsahita with tabba 1273 No. 951 1891-95. Size.- 9. in. by 44 in. Extent. - 2 folios ; 6 lines to a page ; 42 letters to a line. Description.- Country paper thin, rough and greyish ; Devanagari characters with occasional years; this Ms. contains the text and its interlinear tabba; the latter written in a very small hand; clear and good hand-writing ; borders and edges ruled in two pairs of lines in black ink ; the space between the pairs coloured red; yellow pigment used ; foll. numbered in the right-hand margin, only; bits of paper pasted to fol. 26; edges of both the foll. slightly worn out ; condition tolerably good; complete ; various agaras etc. presented in a tabular form on tol. 2". Age.-- Old. Author of the text.-- Not mentioned. ,, ,, ,, tabba -- >> >>

Page #353
316 Jaina Literature and Philosophy 1956. Subject.- Sutras for the pratyakhyanas pertaining to upavasa, acamla, etc. in Prakrit along with their explanation in Gujarati. Begins.-- ( text) fol.x. 60 / uggae sUre nmukkaarshi| etc. , -(tabba ) fol. r* UgIyA sarija / eka pramANa muhUrta / etc. Ends. - (text) fol. 2' sabasamAhivittiyAgAreNa bosiraha |ch / iya paccakhANasuttaM sNpnnN| ,, - ( tabba) fol. 2' AhArAdi kacho / cha / saMpUrNa vaSANyau pacaSANa / iti / zrIsitapatre likhitaM vA jJAnamaMdi(?)gANa likhitaM / pratyAkhyAna (?) Pratyakhyana (?) TabbAsahita with tabba 745 (f). No. 952 1875-76. Extent.-- fol. 12* to fol. 12'. Description.- Complete. For other details see No. 11 __746 (a). 1875-76. Author of the text.-- Not mentioned. ,, , ,, tabba.--,, , Subject.- Denials to temptations in Prakrit along with their ex planation in Gujarati. Begins.- (text) fol. 12. cattAri do duvAlasa / vAsaM cAlIsa hoti ujjoyA / desaa rAiya pakkhiya / cAumAse a varise a|| 1 // etc. ,, - (com. ) cyAri logano kAusaga vijo0 12 logassa vIsaM comAsa. cAlIsa logasa 40 logasa ujoigare mAtalA Ends --( text ) fol. 120 devasia cAUmAsia | saMbaccharia esu paDikamaNamajjhe / muNiNo khAmijaM tti / tinni tahA paMca satta kamA // 4 // iti paccakkhANaM ti //

Page #354
92.] III. 4 Malasatras 317 Ends- (com. ) fol. 120 devasi paDIkamaNai caumAsI pratikramaNai saMvaccharI paDIkamaNA mAMhi munIvara sAdhu SAmijaI tina nima pAMca sAta anukramai joDavA 4 iti pacabhyANami 4 pacaSAMNa kahai. pAkSikakSAmaNAsUtra Paksikaksamanasutra (pakkhiyakhAmaNAsutta) ( Pakkhiyakhamanasutta ) No.953 750 (b). 1892-95. Extent.-- fol. 11b. Description.-- Hand-writing somewhat small ; complete. For other details see No. other details cc N 750 (2).. 1892-95. Subject. - One of the sutras recited at the time of the fortnightly pratikramana. This work consists of four parts. Out them the first part deals with an inquiry on the part of a sisya, regarding his guru's passing a fortnight in the way desired. The second part deals with salutation to the caityas and saints. The third part refers to the mithyadusksta on the part of the sisya in connection with outfit and study. The fourth part refers to the obligations of the guru. Begins.-- fol. II' icchAmi khamAsamaNo piyaM ca me jaMbhe haTTANaM tuTANaM appANaM kANaM abhaggajogANaM susIlANaM etc.. Ends.- fol. It' sAhaTTa nittharissAmi ttikaTTa sirasA maNasA matthaeNa vaMdAmi nitthAraga pAraga hoha iti guruvacanaM tataH ziSyavacanaM icchAmo aNusiddhiM 4 iti paakssikkssaamnnaasuutrN| Reference.--- Published in some of the printed editions of Panca pratikramanasutras. It is also published on p. 14deg of the edition of sAdhupratikramaNAdisUtrANi published by the Secretary of Sri Atmananda Jaina Sabha in A. D. 1921. Furthermore, this sutra is published in the edition (p. 7934 and 7935) of Avasyakasutra containing Haribhadra Suri's com mentary.' For a Ms. see Limbdi Catalogue No. 1545. 1 See p.135.

Page #355
318 pAkSikakSAmaNAsUtra Jaina Literature and Philosophy pAkSikakSAmaNAsUtra No. 954 Extent. - fol. 8b. Description.-- Complete. For other details see No. Begins. fol. 8deg icchAmi khamAsamaNo piaM ca me jaM me haTTANaM tuTTANaM appA etc. Ends.-- fol. 86 nittharissAmi tti kaTTu sirasA maNasA mattharaNa vaMdAmi / nitthArage pAraga hohA guruguNehiM baDhAhiM // iti pAkSikakSAmaNakaM // N. B.-- For further particulars see No. 953. No. 955 Extent. -- fol. rrb. [954. Paksikaksamanasutra 1174 ( h ), 1887-91. 1174 (a) 1887-91. Paksikaksamanasutra 1269(d). 1887-91. Description.-- Complete. For other details see Namaskarmantra No. 735. Begins-- fol. Irb icchAmi khamAsamaNo piyaM etc. Ends.--fol. 11(c) sAhaha (Da) dittharissAmi etc. up to nitthAraga pAragA (gga) hoha as in No. 954. This is followed by the lines as under:-- guruNo vayaNAI etc. pakhiyaM pakakhiyakhAmaNayA sammattA // pakhiyasuttaM saMmattaM || N. B. For additional information see No. 953. pAkSikakSAmaNAsUtra No. 956 Extent.-- fol. 4. Description. - Complete. For other details see No. 75 1 ( a ) 1892-95. Paksikaksamanasutra 751 (b). 1892-95.

Page #356
958.] III. 4 Malasutras 319 Begins.-- fol. 4deg icchAmi khamAsamaNo etc. as in No. 953. Ends.-- fol. 4' sAhaTTa nittha etc. up to baMdAmi as in No. 953. This is followed by the lines as under - ___ iti pAkSikakSAmaNakAni samAptAni likhitAni hasalAvaNya munipaThanAtha salaSare (?) saMvat 1540(1) N. B.- For further particulars see No. 953. pAkSikakSAmaNAsUtra Paksikaksamanasutra No. 957 1106 (52). 1891-95. Extent.- fol. IIs to fol. 124. Description.- Complete. For other details see Namaskaramantra No. 736. Begins.-- fol. II" icchAmi khamAsamaNo piaM ca me etc. as in No. 953. Ends.-- fol. 12' imAo cAuraMtasaMsArakaMtArAo sAhaTTa nitthara(ri)ssAmi etc. up to icchAmo'NusiSTriM 4 as in No. 953. This is followed by the line as under : iti pAkSa(kSi)kakSAmaNA samAptaM / / N. B.-- For further particulars see No. 953. pAkSikakSAmaNAsUtra Paksikaksamanasutra No.958 1282(b). 1891-95. Extent.--- fol. 46. Description.--- Complete. For other details see No. 1282 (a).. . 1891-95. Begins.--- fol. 4deg icchAmi khamAsamaNo piyaM ca me etc. as in No. 953. Ends.- fol. 4 imAo cAurata(ta)saMsAraka(ka)tArAo sAhaddha(TTa) nissa(ttha). rissA temi tikaTTa sirasA maNasA matthaaiNa dhaMdAmi // 4 iti 'pA0 kSAmaNA // cha // cha | ___N. B. For additional information see No. 953. 1 pAkSika.

Page #357
320 Jaina Literature and Philosophy [959. pAkSikakSAmaNAsUtra Paksikaksamanasutra 1174 (h). No. 959 . 1887-91. Extent.-- fol. 85, 1174 (a) Description.- Complete. For other details see No. 4 10. 1887-91. Begins.-- fol. 8b icchAmi khamAsamaNo piaM ca me etc. as in No. 953. Ends.- fol. 8b imAo cAurata etc. up to nitthAraNa pAragA hoha / guruguNehi ___vaDAhiM // iti pAkSikakSAmaNakaM // zrI // __N. B.--- For additional information see No. 953. pAkSikakSAmaNAsUtra Paksikaksamanasutra 1202 (0). 1867-91. No.960 Extent.-- fol. 8a to fol. 86. Description.-- Complete. 1202 (a). For other details see Paksikasutra No. 7887-91. Begins. fol. 82 icchAkAreNa saMdesaha bhagavan pakkhiA khAmaNA khAmuM icchaM icchAmi khamAsamaNo piaM ca me jaMbhe etc. Ends. fol. 8b sAha nittharissAmi etc. up to nitthAra(ga) pAragA as in No. 934. This is followed by the line as under :-- hoha tti iti pAkSikapratikramaNakSAmaNakAni sUtrANi likhitAni cha / N. B.-- For additional information see No. 953. pAkSikakSAmaNAsUtrAva cUrNi Paksikaksamanasutrava curni 1182 (c). 1884-87. No. 961 Extent.-- fol. 226 to fol. 22.

Page #358
III. 4 Malasutras 321 Description.-- Complete; condition tolerably good ; 2700 Slokas in extent; composed in Vikrama Samvat 1180. For other details see No. 728. Author.-- Yasodeva Suri. 962.] Subject. A small commentary in Sanskrit on Paksikaksamanasutra. Begins.-- fol.224 zrI0bha0 pUjyA nanu kathaM zrutAdhiSThAtRdevyA vyaMtarAdiprakArAyAH parakarmakSapaNe sAmarthya ? / ucyate tagocara zubhapraNidhAnasyApi smartuH / karmatvenAbhihitatvAt // cha // yadvA rAjAnaM puSpamANa 2 kA atikrAMte mAMgalyakArye bahu manyate / yadbhuta akhaMDitabalasya te kAle gate | anyo(s)pyeSameopasthitaH / evaM pAkSikaM vinayopacAraM dvitIyakSAmaNakasUtreNa tathAsthitA eva sAdhavaH / AcAryasya nu (ku) beti / taccedaM icchA. i. abhilaSAmi etc. Ends.-- fol. 220 saMsArasamudratIragAmino bhavata yUyamityAzIrvacanamiti // cha // iti kSAmaNAkAvacUrpiNaH // pAkSikastuti No. 962 zrI caMdrasUreH pAdapaMkaja sevanAt / dRbdheyaM prastutA vRttiH // zrIyazobhadrasUriNA // 1 ekAdazazatairadhikairazItyA vikramo ja ( ? gataH // dve sahasre zatairadhikaiH saptamairgrathamAnataH // 2 // cha // Extent. -- fol. 52. Description.-- Three verses in all. Fo other details see Namaskaramantra No. 736. Author.- Not mentioned. Paksikastuti 1106 (37). 1891-95. Subject. Hymns comprising 3 verses recited at the time of the fortnightly pratikramana. The first verse is a panegyric of Srutadevata, the second, that of Bhavanadevi, and the third, that of Ksetradevata.

Page #359
322 Jaina Literature and Philosophy 1962. Begins.--- fol. 5. kamaladalavipulanayanA kamalamuSI(vI) kamalagarbhasamagaurI kamale sthitA bhagavatI dadAtu zrutadevatA saukhyaM 1 jJAnAdiguNayutAnAM svAdhyAyasaMja(ya)maratAnAM vidadhAtu bhavanadevI zivaM sadA sarvasAdhUnAM 2 Ends.-- fol. sa yasyA(:) kSetraM samAzritya sAdhubhiH sAdhyate kriyA sA kSetradevatA nityaM bhUyAnme sukhadAyinI 3 ___ iti pAkSikastutiH Reference.-. Published in several editions of the Pancapratikra manasutras. In the Limbdi Catalague, Paksikastuti by Bala candra in four verses in Sanskrit is noted as No. 1550. But it is difficult to say for certain as to what this work is. namo'stu vardhamAnAya Namo'stu Vardhamanaya [vardhamAnastuti] [Vardhamanastuti] No. 963 1106 (41). 1891-95. Extent.-- fol. sb. Description.-- Complete; 4 verses in all. For other details see Namaskaramantra No. 736. Author.-- Not mentioned. Subject.-- A small work in Sanskrit in four verses. The first of them is a hymn praising Lord Mahavira alias Vardhamanasvamin ; the second praises all the Tirthamkaras; the third, the speech of the Ganadharas i. e. scriptures and the fourth, Srutadevi. Begins.-- fol. 5b namo'stu varddhamAnAya sparddhamAnAya karmaNA tajja(ja)yAvAptamokSAya parokSAya kutIrtha(rthi)nAM 1 etc. 1 This is the name mentioned by the scribe.

Page #360
964.] Ends.-- fol. 5b III. 4 Malasatras kaSAyatapAdita etc. up to bistaro girAM 3 as the 3rd verse. zvasiti surabhigaMdhAlubdhabhRMgI kuraMgaM mukhazazinamajasraM bibhratI yA bibharti vikacakamalamuccaiH sA (1) stvaciMtyaprabhAvA sakalasupa (kha) vidhAtrI prANibhAjAM zrutAMgI iti zrIvarddhamAnastutiH 1 Reference.-- The portion containing the 1st 3 verses is published in various editions of Pancapratikramanasutras. The succeeding verse does not seem to be a part and parcel of this work. zramaNasUtra (samaNasutta) -- There is a reference about this Namo'stu Vardhamanaya in Senaprasna where it is said that all recite the rest of this work after two verses are recited singly. 323 No. 964 Size. 10 in. by 4 in. Extent. --6 folios: 6 lines to a page; 26 letters to a line. Description.-- Country paper rough and white; Devanagari characters; this contains the text and the tabba to a certain extent; the former written in a bigger hand; clear and good hand-writing; borders ruled in two lines and edges in one, in red ink; foll. numbered in the right-hand margin only; the last fol. written in somewhat smaller hand-writing; condition very good; the text complete. Age. Not quite modern. Author. Not mentioned. Sramanasutra (Samanasutta) 251. 1871-72. Subject.-- This work seems to be varionsly named e. g. Sahupadikkamanasutta and Yatipratikramanasutra. The ending portion contains Addhaijjesu and the last two gathas occurring in Vandittusutra.

Page #361
324 Jaina Literature and Philosophy Sramanasutra deals with the following topics ( 1 ) tvagvartanasthAnAticAra, ( 2 ) gocarAticArapratikramaNa, (3) svAdhyAyapraticArapratikramaNa, ( 4 ) ekavidhAdipratikramaNa, ( 5 ) tIrthaGkaranamaskAra, (6) pravacanavarNana, ( 7 ) zraddhAnAdisvarUpa, ( 8 ) asaMyamAdityAga, ( 1 ) nandana and ( 10 ) sarvajIvakSAmaNa. " Out of these the 4th topic refers to the following sub-topics: ( 1 ) 3 daNDa, 3 gupti, 3 zalya, 3 gaurava and 3 virAdhanA ; ( 2 ) 4 kaSAya, 4 saMjJA, 4 vikathA and 4 dhyAna ; (3) 5 kriyA, 5 kAmaguNa, 5 mahAvrata and 5 samiti ; (4) 6 jIvanikAya and 6 lezyA; (5) 7 bhayasthAna; ( 6 ) 8 madasthAna; (7) 9 brahmacaryagupti; ( 8 ) 10 zramaNadharma (9) 11 upAsakapratimA; ( 10 ) 12 bhikSupratimA; (II) 13 kriyAsthAna; ( 12 ) 14 bhUtagrAma ( 13 ) 15 paramAdhArmika; ( 14 ) 16 gAthASoDaza - samayAdi adhyayana ; ( 15 ) 17 asaMyama; ( 16 ) 18 abrahma ( 17 ) 19 jJAtAdhyayana; ( 18 ) 20 asamAdhisthAna : ( 19 ) 21 zabala ; ( 20 ) 22 parISaha ; ( 21 ) 23 sUtrakRtAdhyayana; ( 22 ) 24 deva ; ( 23 ) 25 bhAvanA ; ( 24 ) ( 24 ) 26 dazakalpavyavahAroddezakAla; (25) 27 anagAraguNa ; (26) 28 AcAraprakalpa ; ( 27 ) 29 pApazruta ; ( 28 ) 30 mohanIyasthAna ; (29) 31 siddhaguNa ( 30 ) 32 yogasaMgraha and ( 31 ) 33 AzAtanA. Begins.~~~ ( text ) fol. ra zrIgurubho (bhyo namaH [964. icchAmi paDikkamiDaM pagAmasijjAe nigAmAsajjAe saMthArA ubaTa (Da)NA pariyaTTAe pasAraNAe AuMDa (Ta) NAe chappiyA saMghaTaNAe kuIekkakkarAIe chIe ja ( jaM) bhAie Amose svasarabA (kkhA)mose AulamAulAe (sa) vittayA etc. -- ( com. ) fol. 14 icchAmi paDika icchAmi kahatAM vAchau paDikkamivA bhaNi cyAri puhara suvaIkari naI aticAra lAgA huI ghaNi velA zuvaI karI je atIvAra lAgA huI saMthArA utAraNA TAli adhika upagaraNa ghAlivaI puMjyA pApahaM pAsA pheri tiNe karI DIlane aticAra lAgo huI etc. Ends.-- ( text ) fol. 6deg a(D)DhAije (jje) su dIvasamuddesu pannarasa kamA (mma bhu(bhU)(a) va sAhu (hU) rayaharaNagucchapa DigA (gga) hadhArA paMcamahA (vva) yadhArA aTTAra (sa) ha (sa) sIliMgadhArA akkhayAyArAce (caritA) te sarve (vve) sirasA ZMIT #297(297)m aaer(ft) ae

Page #362
965.1 4 Malasatras 328 kkhAmemi sava(ve)jIve savve jIvA khamaMtu me mittI me sava(va)bhUesu beraM majhaM(jjhaM) na keNai 1 evamahaM Aloiya niMdiya garIhia dukkha (ga)cchi(ya) samaM tiviheNa paDikato vaMdAmi jiNe cauviza(saM)2 iti zrIyatipra(ti)ka(maNa) samApataM zrI suratabaMdara madhe la(pitaM) Ends.- ( com.) fol. 3' lobha kaSAyeM karine paDika chu cihu saMjJAyaI karI je aticAra lAgu AhArasaMjJA karInaI bhayasaMjJA karI methunasaMjJAye karI ati cAra lA parigrahasaMjJAye karIne aticAra. It ends thus abruptly. Reference.-- This is an old satra to be found in the edition of Avasyakasutra containing Haribhadra Suri's commentary to it. See Agamodaya Samiti edition p. 573 ff. This work together with the balavabodha of Nayavimala Gani alias Jnanavimala Suri has been published in Dayavimala Jaina Granthamala as No. 6, in. A. D. 1917. The text is also published on pp. 20 to 4deg of the edition of sAdhupratikramaNAdisUtrANi published by the Secretary of Sri Atmananda Jaina Sabha, in A, D. 1921. For a Sanskrit commentary of Sramanasutra see "zrIzramaNapratikramaNasUtravRttiH " published in D. L. J. P. F. Series as No. 2 in A. D. 1911. Herein we have the vyakhya of karomi bhaMte ( Samayikasutra ) on p. 1. This is followed by the vyakhya of cattAri maMgala, cattAri loguttamA, cattAra saraNa, IryApAthakIsUtra styled as gamanAgamanAticArapratikramaNa etc. zramaNasUtra Srmanasutra No. 965 1106 (51). 1891-95. Fxtent.-- fol. 86 to fol. 11b. For other details see Namaskaramantra Description.-- Complete. No. 736.

Page #363
326 Jaina Literature and Philosophy [965. Begins.--fol. 8b ahaMto bhagavaMta indramahitA siddhAzca siddhisthitAH AcAryA jinazAsanonnatikarAH pUjyA upaadhyaaykaaH| zrIsiddhAntasupAThakA munivarA ratnatrayArAdhakAH paMcaite paremeSThinaH pratidinaM kurvantu no maMgalam // 1 // ' cattAri maMgalaM arihaMtA maMgalaM siddhAmaMgalaM sAhU maMgala kevalipannatto dhammo maMgalaM cattAri logUttamA arihaMtA loguttamA siddhA loguttamA sAhU loguttamA kevalipannato dhammo loguttamo cattAri saraNaM padhajjAmi arihaMte saraNaM pavajjAmi etc. Ends.-fol. II evamahaM Aloia niMdia garihia dugaMchia samma / tiviheNa paDikkato vaMdAmi jiNe cauvvIsaM / / 2 iti sAdhupratikramaNasUtraM samAptaM // N. B.---For further particulars see No. 964. zramaNasUtra Sramanasutra No. 966 1269 (40). 1887-91. Extent.-- fol. 46 to fol. 56. Description.- Complete. For other details see Namaskaramantra No. 735. Begins.- fol. 4 . icchAmi paDimiyaM pagAmasijjAe etc. as is No. 964. Ends.- fol. b aTADA)i(jje)su etc. up to cauvIsa || as in No. 964. __ This is followed by 40 iti sAhupaDikamaNasuttaM // cha etc. N. B.-- For further particulars see No. 964. 1 This verse is composed by Jinapadma Suri whose Nandimahotsava took place in Samvat 1389. This is what we learn from Ksamakalyanaka's Pattavali (p. 121 ) referred to by Muni Himamsuvijaya in his article on this verse published in " Jain" (28th March 1937).

Page #364
967.] III. 4 Malasairas 327 zramaNasUtra Sramanasutra 778. No. 967 1875-76. Size.-- Iog in by 4, in. Extent.--16 folios ; Io lines to a page ; 28 letters to a line. Description.--Country paper rough and white; Devanagari cha racters ; big, clear and good hand-writing; borders not ruled ; foll. numbered in the right-hand margin only, fol. Ii blank ; red chalk and yellow pigment used ; complete; condition very good. Age.-- Samvat 1863. Begins.- fol. I* namo arihaMtANaM etc. Ends.- fol. 16b evamahaM Aloiya niMdiya garahiya duggachiyaM savvaM / tiviheNa paDikkato vaMdAmi jiNe caundhIsaM // iti zrIsAdhupatikamaNasUtra' samAptaM / / saMvat 1863 kA mIti zrAvaNavadi 14 maMgalavAre liSataM vaktarAma laSageo madhye kalyANamastu / / N. B.-- For additional information see No. 964. I In the edition of Sadhupratikramanadisutrani referred to in No. 954 on p. we have the following works :-- (1) navakAramantra (p. 14 ), (2) karemi bhaMte (p. 10), (3) icchAmi ThAmi kAussaggaM jo me devasio (p. 10), (4) devatika aticAra (ThANe kamaNe caMkamaNe) (pp. 10-20), (5) rAtrika aticAra ( saMthArA uvaTTaNakI) (p. 24), (6) zramaNasUtra (pp. 22-43), (7) pAkSika aticAra ( pp. 43-64), (8) pAkSikasUtra (pp. 63-130), (9) pAkSikakSAmaNA (p. 142), (10) aticAranI gAthA ( sayaNAsaNannapANa, one verse, p. 140 ), (11) gocarInA 47 doSa in 7 verses in Prakrit along with an explanation in Gujarati ( pp. 14b-16b), (12) gocarI AlovavAno vidhi in Gujarati (pp. 16-172), (13) sthaMDilazuddhino vidhi (p. 17a ), (14) saMthArAporisIno vidhi (p. 170), (15) pAkSika, cAturmAsika athavA sAMvatsarika pranikramaNamAM koine chIMka Ave no tenI zuddhi karavAno vidhi (p2 17--184), (16) bArSika kAussamga karavAno vidhi (p.181) (17) savAranI paDilehaNA (p. 18-18b), (18) sAMjanI paDilehaNA (pp. 186-193), 19) porisIvidhi (p. 199) and (20) pratyAkhyAna pAravAno vidhi (pp. 194-20% )

Page #365
328 zramaNa sUtra No. 968 Extent. fol. 42b to fol. 46b. Description. Complete. For other details see No. 708. Begins -- fol. 42b Ends.- fol. Jaina Literature and Philosophy icchAkAreNa saMdisaha bhagavan uvaTTiomi / abhitarapakkhiyaM khAmi / panarasanhaM divasANaM panarasanhaM rAINaM etc. 466 N. B.- For further particulars see No. 964. zramaNa sUtra bAlAvabodhasahita No. 969 galig etc. up to as in No. 967. This is followed by the line :- zrIvidhisaMghabhaTTArakasya ciraM naMdatAt / 1968. Srmanasutra 1171 (c). 1887-91. Age.-- Pretty old. Author of the balavabodha.-- Not mentioned. Size.-- 10 in. by 4 in. Extent. 7 folios; 13 lines to a page; 32 to 42 letters to a line. Description.-- Country paper thin, rough and white; Devanagari characters with pRSThabhAtrA; this is a faret Ms.; the text written in a bigger hand; the commentary in a smaller one; legible and tolerably good hand-writing; borders ruled in four lines in black ink; fol. 1a blank; foll. numbered in the right-hand margin, only; condition very good; both the text and its Gujarati explanation complete. Sramanasutra with balavabodha 1292. 1886-92,

Page #366
970.] III.4Malasatras 329 Subject. The text in Prakrit together with its explanation in Gujarati, styled in the Ms. as laghuvrtti. In the text, we have in the beginning the indication of the sutras to be recited before the recitation of the Sramanasutra. Thus it tallies with the Sramanasutra published in the edition of sAdhupratikramaNAdisUtrANi noted on p. 325. Begins.-- ( text ) fol. IF namo arihaMtANaM karomi bhaMte cattAri maMgalaM icchAmi paDikamiuM iriyAvahiyAe / icchAmi (paDi)kamiuM pagAmasijAe nigAma sijjAe saMthArA uvvattaNAe etc. ,, -- (balaa) fol. I' pahilu navakAra pachai karemi bhaMte pachai cattAri maMgalaM pUru pachai icchAmi paDikamAuM pachai iriyAvahIyA kahAI etc. Ends.- ( text ) fol. 7 aDAijesu dIvasamudesau / etc. up to cauvvIsaM 50 as in No. 966. Then we have : iti pratikramaNAsUtra saMpUrNa / / / - (balan) fol. 7. sarva jIva hu~ khAmauM anai sarva jIva mAharaI kihasiuM nahI isI pariiMha(2) pApa AlouM naMdara AtmA sASi garahauM guru sASi valI valI niMdauM sAtha / ima mAni vacani kAya karI pApa thiku nivarta teha bhaNI cauvvIsaM jinaM vAMdauM mAMgalIka bhaNI 50 iti zrIsAdhUpratikamaNAsUtralaghU(ghu)vRtti samAptaH // cha / // cha / majhanaI khalu sarva jIvasuM majhanai maitrI huvayA - zramaNasUtra Sramanasutra 613 (c). 1884-86. No. 970 Extent.-fol. 21 to fol. 22b. Description.-- Complete. For other details see Paksikasutra No. 613 (a). 10.1884-86.. Begins.-fol. 214 60 e icchAmi paDikkamiuM / pagAmasijjAe / nimAmasijjAe uattaNAe / priattnnaae| etc. Ends.-- fol. 22b evamAloIa niMdia garihia dugaMcchia ( samma) tiviheNa paDikkato vaMdAmi jiNe cauvvIsaM / iti sAdhupratikramaNa samApta N. B.--For further details see No. 964.

Page #367
330 yatipratikramaNasUtra vyAkhyAna Jaina Literature and Philosophy No. 971 Size.-- 1o in. by 42 in. Extent.- 8 folios; 14 lines to a page; 44 letters to a line. Age.-- Samvat 1851. Author. --- Sritilaka Suri. Yatipratikramanasutravyakhyana Description.-- Country paper rough and white; Devanagari cha racters; small, clear, uniform and good hand-writing ; borders ruled in three lines and edges in two, in red ink; red chalk and yellow pigment used; foll. numbered in the right-hand margin only; fol. 1a blank; the first fol. partly worn out; otherwise the condition is good; complete. 1971. 217. 1873-74. Subject.-- A commentary in Sanskrit on Yatipratikramanasutra. Begins. fol. rb zrIvIrajinavareMdraM natvA stutvA ca svasya bodhakRte / vakSyAmi vyAkhyAnaM yatipratikramaNasUtrasya // 1 // iha sarve paMcaparameSTinamaskArapUrvakaM karmma kartavyamityAdau saMprapadyate samabhAvasthena pratikramitavyamityataH sAmAyikasUtraM karemi bhaMte ityAdi ucca etc. Ends.--. fol. 8b itthegaIyA ducceNaM bhavaggahaNeNaM sattaTTa bhavaggahaNAI nAikamaMti tasmAt pAmi pAlito ityapi paThatAM zreya eva manyate / iti zrItilakAcAryaviracitA sAdhuprAtikramaNasUtravRttiH samAptA // saMvat 1851 varSe zrIbena grAme likhitaM kamanaMdanamuninA zrIrastuH //

Page #368
973.] yatipratikramaNasUtravyAkhyAna III. 4 Malasutras Yatipratikramanasutravyakhyana No. 972 Size.--- 1o in. by 4g in. Extent.-- 11 folios; 13 lines to a page; 36 letters to a line. Description.-- Country paper thin, rough and greyish; Devanagari characters; big, legible but poor hand-writing; borders ruled in three lines in red ink; red chalk used; yellow pigment, too, but rarely; the last line on the last fol. written in red ink; condition very good; complete. Begins.-- fol. r* paMDi ( ta ) zrI zubhAvijayagaNigurubhyo namaH // zrIvIrajinavarendraM namasitvA svalpabuddhibodhakate / yatipratikramaNasUtravRtti No. 973 Age.- Does not appear to be old. Subject. A small commentary on Yatipratikramanasutra based upon the preceding work, if not identical with it. 331 802. 1892-95. vakSyAmi vyAkhyAnaM yatipratikramaNasya sUtrasya // 1 // etc. Ends. -- fol. 11 mucvaMti / parinivvaMti savvadukkhANamaMta karati / acchegaiyA duccaNa bhavaggahaNeNaM / sattadva bhavaggahaNAiM nAikamaMti tasmAt pAlemi / ityapi paThatAM / zreya eveti gamyate / iti yatipratikramaNasUtrAvacUrNiH // paMDita zrI 5 zubha vijayagaNiziSyANunA lAla vijayena lipIkatA / zubhaM bhavatu etc. Reference.-- See B. B. R. A. S. vols. III - IV, p. 397. Yatipratikramanasutra vrtti Size. - ro++ in. by 4g in Extent. - 6 folios; 19 lines to a page; 82 letters to a line. 646. 1884-86.

Page #369
332 Jaina Literature and Philosophy [973. Description.-- Country paper very thin, rough and white; Deva nagari characters with occasional gaa; very small, legible, uniform and good hand-writing ; borders ruled in four lines in black ink; the space between the pairs coloured red ; red chalk used; foll. numbered twice in the right-hand margin, once as 876, 877 etc. and once as 1,2 etc.; this Ms. contains the gates of the text; complete; condition very good. Age.-- Sarmvat I497. Begins.-fol. I || I0 / / aha / / natvA zrIvIrajinaM saMkSiptarucInanugrahItumanAH / sugamIkaromi kiMcid yatipratikramaNasUtramahaM // 1 etc. Ends.-- fol. 6deg samAptA ceyaM yatipratikramaNasUtravRttiH // cha / __iti sAdhupratikramaNavRttiH saMpUrNA // cha // zrI saMvat 1497 varSe mArgazIrSavadi 11 zukre zrI kharataraM gacche upAdhyAyazrIjayasAgarANAmupadezena sAdhupratikramaNavRttilikhitA || sA ciraM naMdatu || cha / zivamastu sarvajagataH parahitaniratA bhavaMtu bhUtagaNAH / doSAH prayAMtu nAzaM sarvatra sukhIbhavatu lokaH / / cha / / zrIrastu SaDAvazyakasUtra Sa davasyakasutra laghuvRttisahita with laghuvrtti 597. No. 974 1895-98. Size.- Io in. by 41 in. Extent.-- (text) 16 folios; 7(?) lines to a page ; 44 letters to a line. ,,-(com.) ,, ,, Io(?) lines to a page ; 6o letters to a line. Description.- Country paper rough, thin and grey; Devanagari characters with occasional pRSTamAtrAs; this is a tripATI Ms.; the hand-writing of the text is slightly bigger than that of the commentary ; borders ruled in four lines in black ink; yellow pigment used ; foll. numbered in the right-hand

Page #370
974. ] Age.-- Old. Author of the commentary. - Sritilaka Suri, pupil of Sivaprabha Suri, successor of Cakra Suri. See No. 975. III. 4 Malasutras 333 margin only; edges of a few foll slightly worn out ; a part of the last fol, torn; condition tolerably good; the text and the commentary complete; extent of the commentary 200 slokas. Subject. The pratikramanasutras commencing with Navakara and ending with Vandittusutra together with their explanation in Sanskrit. To mention in details, the sutras are as under: " Begins.--( text) fol. 1h Namo arihaMtANaM Namo siddhANaM Namo AyariyANaM Namo uvajjhAyANaM Namo loe savva sAhUNaM 1 icchAkAreNa saMdissaha bhagavana iriyAvahiyaM paDikkamAmi etc. - ( 1 ) navakAra, ( 2 ) iriyAvahiya, ( 3 ) tassa uttarI, ( 4 ) annattha, ( 5 ) namutthu NaM up to jiyabhayANaM, ( 6 ) logassa, (7) suguruvandanasUtra, ( 8 ) icchAkAreNa etc. jo me devAsao aiyAro kao etc., ( 9 ) abbhuTTio, ( 10 ) pratyAkhyAnas such as uggae sUre cauvi upavAsa, porisI, purimana, bigaIM, AyaMbila, ekAsaNa etc., and ( 11 ) baMdisUtra. (com) fol. rb arha || zrIvIrajinavareMdra vaMditvA caityavaMdanAdIni alparuci sattvahetorvivariSye gamanikAmAtraM 1 ' ss caityavaMdanAdInAM vRttirArabdhA || evaM iriyA vahIyAe || apaDikaMtAe / na kappai kiMci / ceIvaMdaNasajjhAyAityAgamAt || prathamaiyApathikIsUtrameva vyAkhyAyate / taccedaM icchAmItyAdi / icchAmi abhilakhA (SA )mi | pratikramituM nivarttituM / IraNaM IrSyA gamanaM / tadyuktaH paMthA IryApathaH / sUtrabhavA / airyApathikI virAdhanA etc. 1 Ends. -- (text) fol. 16b evamahaM AloIya niMdiya garahiya durgAcchiyaM sammaM / tiviheNa paDikkato vaMdAmi jiNe cavvIsaM 50 iti zrAddhapratikramaNasUtraM // 1 This very verse occurs in Nos. 847 and 848. 11

Page #371
334 Erds. Jaina Literature and Philosophy [ 974. (com) fol. 16b saMprati pratikramaNaM nigamayana paryata maMgalamAha / evamatyAdi / evaM pratikramaNasUtrabhaNitaprakAreNAlocya niMditvA garhitvA jugufeeder trividhena krAMtaH caturviMzatijinAna vaMde namaskaromItyarthaH // 50 // iti pratikramaNavivaraNaM // iti zrIzrItilakAcAryaviracitA || zlokazatadvayapramANA zrAvakapratikramaNasUtra laghuvRttiH samarthitA || SaDAvazyaka sUtra laghuvRtti No. 975 Size.-- 111/2 in. by 4g in. Extent.-- 18 folios; 15 lines to a page ; 48 letters to a line. Description.-- Country paper very thin, rough and white; Devanagari characters; small, clear and fair hand-writing ; borders ruled in four lines in red ink; red chalk and yellow pigment used; foll. numbered in the right-hand margin only; fol. 1a blank; edges of several foll. slightly damaged; condition tolerably good; complete ; this Ms. contains the safes of the text. Age.--Pretty old. Author.-Sritilaka Suri. Subject. A small commentary in Sanskrit, explaining some of the sutras. For comparison see Nos. 847 and 848. Begins. fol. 1 zrIjinAya namaH // zrIvIrajinavareMdra etc. as in No. 974. Ends. fol. 18b saMprati pratikramaNaM etc., up to pratikramaNavivaraNaM as n No. 974. This is followed by the lines as under : Sadavasyakasutralaguvrtti 136. 1872-73. samAptaM // zrIcakra sUrigurupaTTamahodayAdri pradyotanopamazivaprabhariziSyaH / zrIprapadastilakasUriradhIdhano ( 5 ) pi zrAddhapratikramaNasUtramidaM vavatre // / 1 iti zrItilakAcArya etc., practically as in No. 974.

Page #372
976. ] 111. 4. Malasatras 335 SaDAvazyakasUtra Sadavasyakasutra anuSThAnavidhi with Anusthanavidbi (vandAruvRtti)sahita ( Vandaruvrtti ) 1235. No. 976 1884-87. Size.- 11 in. by 48 in. Extent.- 50 folios ; 16 lines to a page ; s8 letters to a line. Description.-- Country paper thin, rough and greyish ; Devanagari characters with quarts; small, legible and good handwriting ; borders ruled in two pairs of lines in black ink; the space between these pairs coloured red; unnumbered sides have a small disc in red colour in the centre; the numbered, in each of the two margins, too; red chalk used; fol. ra blank ; edges of the first fol. slightly damaged ; condition tolerably good; both the text and the vytti complete. Age.- Samvat 1616. Author of the text.-- More than one saint. ,, ,, commentary.-- Devendra Suri, pupil of Jagaccandra Suri, originator of the Tapa gaccha. Over and above this Vandaruvstti, Devendra Suri has composed the following works :(1) Sraddhadinakstyavitti. 2 (2)3 Karmavipaka and its svopajna 4 commentary. Karmastava (4) Bandhasvamitva >> >> >> (5) Sadasiti >> >> >> (6) Sataka (7) Siddhapancasikasutravstti. I The scribe has noted this work as Sravakanusthanavidhi. It can be also styled as Upasakanusthanavidhi (vide v. I, p. 336), 2 This work is quoted on p. 2 in the svopajna commentary on Karmavipaka. There it is named as Dinakstyatika. Here the page-number refers to the edition mentioned on p. 336.. 3 Works 2-6 (text) are collectively known as 5 Navya Karmagranthas. They are mentioned in Gurvavali (v. 117 ) and in Gurugunaratnakarakavya ( v. 40). 4 Svopajna-Karmavipaka is alluded to on p. 67 in the svopajna commentary on Karmastava, and svopajna Karmavipakatikon p. 79 of the svopajna commentary on Karmastava as well as on pp. 164 and 183 of the svopajna commentary On Sadasiti,

Page #373
336 Jaina Literature and Philosophy [976. (8) Dharmaratnaprakaranabrhadvstti. (9) Sudarsanacaritra. (10) Caityavandanadibhasyatraya. (11) Siri-Usabha-Vaddhamanaitthava. (12) Siddhadandika. (13) Cattari-attha-dasagathavivarana. According to Gurvavali ( v. 147 ) Devendra Suri died in Samvat 1327. He must have been made a Suri in a year not earlier than Samvat 1285. Vijayacandra Suri seems to have been made a Suri after his suripada. See Gurvavali ( v. 107). For his life in Gujarati see "Prastavana" (pp. 16-20) to four Karmagranthas and their commentaries published by Jaina atmananda Sabha, in A. D. 1934. Subject.-- A number of sutras meant to be recited by a Jaina while performing the religious duties. They are explained in Sanskrit along with narratives. In this explanation" are quoted several gathas from the Caityavandanabhasya and Guruvandanabhasya. Begins.- ( text ) fol. 10 AT STGaro etc. >> --( com. ) fol. 10 11 6011 TA: FETT II. vaMdAruvaMdArakavRMdavayaM praNamya vIraM jitmaarviirN| upAsakAnAmupakAraheto. vakSyAmyanuSThAnavidhi subodhaM // 1 iha tAvacTrAvakeNApi pratyahaM bIna paMca sapta vA vArAn darzanavizuddhayartha ureganauat ll etc. Ends.-- (text) fol. sobrang etc., up to fhut sati Il yo ll as in No. 984. ,, - (com. ) fol. 5ob wista tia SA TIETTAAETheTa etc., up to EIT 971991 gratia: 1 as in No. 983. This is followed by the lines as under : - This is based upon Brhadyrtti and Curni. See p. 342.

Page #374
977.) It i. 4 Malasatras 337 377.1 II. 4 Malasatras 337 yaM0 2728 // saM0 1616 barSe kArtika zu. 1 bhaumavAsare zrI ahimadanagara vAstavyamahaM zrIlaTakaNabhAryApUtali zrutamahaMnAthAbhAnAyakahe jJAtAdharmakathAMgapustikA uddharitA // Reeference.-- The text along with Vandaruvstti is published in A. D. 1912 in the D. L. J. P. F. Series as No. 8. It is again published with this very commentary in A. D. 1928 by Rsabhadevaji Kesarimalaji Samstha, Rutlam. The sutras given in the text of this Ms. occur in one or the other printed edition of Pancapratikramanasutras noted in No. 730. For description of Mss. having the text and Vandaruvrtti, see B. B. R. A. S. vols. III-IV, pp. 399-400. SaDAvazyakasUtra anuSThAnavidhisahita Sa davasyakasutra with Anusthanavidhi 1347. 1886-92. No. 977 Size.-- 101 in. by 43 in Extent.- 58 folios; 15 lines to a page ; 54 letters to a line. | Herein we find the followirg 27 sutras :-- (1) navakAramaMtra (p. 2), (2) IryApathikI (p. 24), (3) tassa uttarI (p. 27 ), (4) annattha (p. 27), (5) praNipAtadaNDaka ( zakastava ) (p. 29ff.), (6) caityastavadaNDaka (arihaMta ceigaNaM) (p. 36), (7) caturvizatistava (p. 40 ), (8) pukravaravara (p. 45 ), (9) siddhANaM buddhANaM (p. 49), (10) veyAvaccagarANaM (p. 53), (11) jaya vIyarAya (p. 54), (12) vandanakasUtra (suguruvandana ) ( p. 63 ), (13) daivasikAle canA (p. 67 ), (14) savvassa vi (p. 68 ), ( 15 ) abbhuhio (p. 68 ), (16 ) uggae sUre paccakkhANa (p. 71), (17) porisIpaccakravANa (p. 72 ), ( 18 ) purimaTTapaccakvANa (p. 73 ), (19) egAsaNa. paccakkhANa ( p. 73 ), (20) egaTTANapaccakkhANa (p. 74), (21) AyaMbilapaccakravANa (p. 74 f), (22) abbhaTrapaccakravANa (p. 75 ), ( 23 ) divasacariyaMpaccakravANa (p. 76), (24) aMguTrasahiyapaccakvANa (p. 76), (25) vigaipaccaravANa (p. 76), (26) karomi bhaMte ( p. 85) and ( 27 ) baMdittu ( p. 86ff). 43 [J.L. P.]

Page #375
338 Jaina Literature and Philosophy (977. Description. - Country paper thin, rough and white; Devanagari characters with occasional gearst; very small, legible, good and uniform hand-writing; borders ruled in four lines in black ink; foll. numbered in the right-hand margin only; fol. 1a blank; both the text and the commentary complete ; condition very good; fol. 58b practically blank; for, only siga r afa etc. written on it ; extent 2720 slokas. Age. -- Pretty old. Begins.-- ( text ) fol. 3deg HAN Stearof etc. as in No. 976. ,, -- ( com. ) ,, FAE Gatti | ginecraqaa etc. as in No. 976. Ends.---( text ) fol. 58a garg etc., up to 75eait ll yo il practi cally as in No. 976. >> -- (com.) ,, ,, #871: tar etc., up to praranasa as in No. 982. This is followed by Telaet 311754 ITE: 3 a graMthAnaM 2720 cha etc. N. B.- For further particulars see No. 976. SaDAvazyakasUtra Sadavasyakasutra anuSThAnavidhisahita with Anusthanavidhi No. 978 199. 1873-74. Size.-- 104 in. by 41 in. Extent.-- 63 folios ; 15 lines to a page ; 46 letters to a line. Description -- Country paper very thin, rough and greyish ; Deva nagari characters with occasional Teatars; small, legible and good hand-writing; borders ruled in four lines in black ink; red chalk and yellow pigment used; foll. muinbered in the right-hand margin ; fol. 1a blank; so is the fol. 63; edges of the first and last foll. slightly damaged ; strips of paper pasted to fol. 636; condition on the whole good; both the text and its commentary complete ; extent 2778 (?) slokas.

Page #376
979. ] III. 4 Malasutras 339 Age.-- Pretty old. Begins.-- ( text ) fol. s A sifgaro etc. as in No. 976. ,, (com. ) fol. Ib FA Harad stoThreat It aileanTE etc. as in No. 976. Ends.-- (text ) fol. 63a TTHE STIGT etc; as in No. 976. ,, -- ( com. ) fol 63a 'A 961#etc., up to zrorasa 11 3 11 as in No. 977. This is followed by the line as under :-- za 10legralata: Il Turu PURUC (? ) 11 EI! etc. N. B.-- For additional information see No. 976. SaDAvazyakasUtra Sadavasyakasutra anuSThAnavidhisahita with Anusthanavidhi 405. No. 979 1880-81. Size.-11 in. by 43 in. Extent.-- 50 + 1 - 8 + 1 = 44 folios, 15 lines to a page ; 67 letters to a line. Description.- Country paper thin and grey; Devanagari characters with qafas ; small, clear and good hand-writing ; bor. ders ruled in two pairs of lines in black ink; the space between these pairs coloured red; red chalk used; numbers for foll. entered twice in one and the same margin, once as 1, 2, etc. and once as 703, 704 etc. ; a piece of paper of the same size as the fol. pasted to fol. ra ; edges of the first few foll. more or less worn out ; unnumbered sides decorated with a small circular disc in red ink in the centre; the numbered, with two more, one in each of the two margins; the 3rd fol. repeated; foll. s to 12 lacking; fol. 735 repeated ; the last fol. numbered as 751 and so as well; a piece of paper of the size 1 Letters grig are gone owing to the corresponding portion of the paper worn out.

Page #377
340 Jaina Literature and Philosophy 1979. of a fol. affixed to the last fol. extent 2720 slokas; condition fair. Age.--- Seems to be old. Begins.-( text ) fol. 1 THI Targi etc. ,, --( com. ) fol. 15 y& o ll alwaarme il 1914 aita etc. as in No. 976. Ends.-- ( text ) fol. 556 evamahaM Aloiya niMdiya garahiya dugaMchiyaM smm| tiviheNa paDikkato baMdAmi jiNe caunvIsaM // 50 / / ,, -- ( com.) fol. 510 Ecdan harga talaatuar etc., up to arziuasa as in No. 977. This is followed by grat zrISaDAvazyaka vRttiH saMpUrNA / graMthAnaM 2720 // N. B.-- For further particulars see No. 976. SaDAvazyakasUtra Sadavasyakasutra anuSThAnavidhisahita with Anusthanavidhi 300. No. 980 A. 1883-84. Size.-- 10.1 in. by 4; in. Extent.-- 61 folios; 15 lines to a page ; 48 letters to a line. Description.- Country paper thin and white; Devanagari chara cters with DFAETIS; bold, small, legible and good handwriting ; borders ruled in four lines in black ink ; red chalk used; numbers for foll. entered twice as usual; the 10th fol. slightly torn; on fol. 2PSa there is a tabular representation of the lengths of shadows in different months ; foll. 41 to 43 and so and si damaged in three places; a bit of paper pasted to fol. 5ox; condition tolerably good ; both the text and the commentary complete. Age.- Appears to be old.

Page #378
981. 1 III. 4 Malasatras Begins. (text) fol. 5b at angari etc., as in No. 979. etc., as in No. 976. etc., as in No. 976. - ( com. ) fol. 612 ityevamalparuci etc., up to cUrNitazva as in No. 977. This is followed by the line as under :-- SaDUvidha Avazyaka vidheH // evaM graMtha 3725 // N. B. For further particulars see No. 976. (com.) fol. br Ends.--(text) fol. 65a garg "" 39 SaDAvazyaka sUtra anuSThAnavidhisahita 11 Age.-- Samvat 1737. Begins. rw No. 981 Size.--9 in. by 4 Extent.-- 78 folios; 15 lines to a page; 36 letters to a line. Description.-- Country paper thin, brittle and grey; Devanagari characters; bold, big, clear and good hand-writing; borders ruled in three lines in red ink and edges singly; numbers for foll. entered twice as usual; a piece of paper of the same size as the fol. pasted to fol. 1a and one similarly affixed to fol. 78b; red chalk and yellow pigment used; both the text and the commentary incomplete as the Ms. ends abruptly; the text goes up to the 47th verse of Vandittusutra. 39 in. Ends. - ( text ) fol. 794 mama maMgalamarihaMtA // 47 // 341 Sa davasyakasutra with Anusthanavidhi (text) fol 1b aar afgari etc., as in No. 976. -- - ( com. ) fol. r' sakalapaMDitapuraMdarapaM0 zrI zrIlakSmI vijayagaNicaraNebhyo namaH / praNaumi mahimAmeyaM vAmeyaM taM jagadguruM / IpsitArthapradAtAraM zrIma'jjIrapurI' prabhuM // 1 // etc., as in No. 980. 347 A. 1882-83. - ( com. ) fol. 794 ihApi jIvayogyatAyAM satyAmapi tathA tathA pratyUhavyUhanirAkaraNena devA api yakSAMbAprabhRtayaH samAdhibodhidAnena samarthA bhavaMti tAryAdirityaMto na nirarthakA tatprArthane. This Ms. ends thus. N. B.-- For further particulars see No. 976.

Page #379
342 Jaina Literature and Philosophy [982. SaDAvazyakasutra Sa davasyakasutra anuSThAnavidhisahita with Anusthanavidhi 1233 No. 984 1891-95. Size.-- 101 in. by 42 in. Extent.-- 47 - 12 - I = 34 folios; 17 lines to a page; 54 letters to a line. Description.--Country paper very thin, rough and greyish; Devanagari characters with pRSThamAtrAs; small, legible, and good hand-writing ; borders ruled in two lines in black ink ; red chalk and yellow pigment used; foll. numbered in the right-hand margin ; fol. I blank ; this Ms. contains the text as well as the commentary ; foll. 17 to 28 and 36 missing ; otherwise complete; a bit of paper pasted to fol. 476; edges of the first and last foll. slightly worn out; condition tolerably good ; extent 2720 slokas. Age.-- Samvat 1469. Begins.-- ( text ) fol. b namo arihatANaM 1 namo siddhANaM etc. as in No. 981. , -- ( com.) fol. Ib // 6 // OM namaH zrIsarvajJAya __vaMdArubaMdArakavRMdavaMdyaM etc. as in No. 976. Ends.-- ( text ) fol. 47 evamahaM Aloiya / niMdi0 / 50 / " -- (com.) fol. 470. ityevamalparucisatvavibodhanAya zrAddhapratikramaNasUtravivRttireSA | kiMcinmayA prakaTitA(5)tra tu vistarArthoM jJeyo vRhadvivRtito varacUrNitazca paTTi 4 // Avazyakavidhi // graMthAgraM // 2720 saMvat 1469 varSe ASADhasudi 2 gurau liSita N. B.--- For further particulars see No. 976.

Page #380
983. J SaDAvazyaka sUtra anuSThAnavidhisahita No. 983 Size.-- 11++ in. by 44 in. Extent. - 31 - 2 = line. Age. -- Sarvat 1524. Begins. -- ( com. ) fol. 3 " 13 Description.--- Country paper thin and white; Devanagari characters with occasional pRSTamAtrAs; small, clear and good handwriting; borders ruled in four lines in black ink; red chalk used; black ink used instead of yellow pigment; numbers for some of the foll. entered twice in the righthand margin ; foll. 1 and 2 lacking ; otherwise both the text and the commentary complete; condition very good. I ill. 4 Malasatras Ends-- ( text ) fol. 3rb 29 folios ; 21 lines to a page; 70 letters to a Sadavasyakasutra with Anusthanavidhi mastiSTA mumuca sAdhakaM / anenApakRtaM kiM te kathaya zlathaya kudhaM // 72 // Tere raise cikIrSurmA vaze (S) dya tat / saptarAtrakSudhArttena mahAmAMsaM mayA (S) || 73 // etc. - ( com. ) fol. 6h adhunA caityavaMdanA sA tridhA // navakAreNa jahannA daMDagathuijuyalamajjhimA neyA / saMpannA ukkosA vihiNA khalu vaMdanA vivihA || evamahaM Aloya niMdiya garahiya durgAchiya sammaM / tiviNa paDikaMto vaMdAmi jiNe cauvIsaM // 343 This is same as Vandittusutra. ityevamaparuci sattvavibodhanAya / 'zrAddhapratikramaNasUtra vivRttireSA || 676 1875-76. ( com. ) fol. 31deg sAMprataM pratikramaNAdhyayanamupasaMharannavasAne maMgalapradarzanArthamAha / This is followed by the verse noted above. Then we have : kaMThyA / navaraM durgAchiya sammaM ti ! jugupsitatvAtsamyagiti ||

Page #381
344 Jaina Literature and Philosophy kiMcinmaya prakaTitA ( 5 ) tu vistarArtho jJeyo bRhadvivRtito varacUrNitazca // 1 // iti zrIzrAvakAnuSThAnavidhiH samAptaH / graM0 2720 // akSaramAtra etc. zrIzramaNAdicaturvidhasaMghazreyo'stu / saM0 1524 varSe Azvinavadi 2 maMgale / N. B. For other details see No. 976. SaDAvazyaka sUtra anuSThAnavidhi tathA TabbA sahita No. 984 "" r. Size.- 97 in. by 41 in. Extent. (text) 228 folios; 12 lines to a page; 36 letters to a line. ; 2) -(tabba) Description. Country paper thick and white; Devanagari characters; bold, big, clear and good hand-writing; borders ruled in two lines in red ink and edges singly; red chalk used; yellow pigment rarely; fol. 1a blank; this Ms. contains the text, its commentary in Sanskrit and its explanation in Gujarati; a piece of paper almost of the same size as the fol. pasted to an edge of fol. 228b; on this is written the table of contents of some of the narratives like sRgAvatIkathA, naravarmakathA etc. ; the commentary furnishes us with many stories illustrating the different vows; all complete, condition very good. Age. Samvat 1781. Author of the tabba- Devakusala. Subject. dr dw Sa davasyakasutra with Anusthanavidhi and tabba rw dr 44 ; dw [ 983. "" 403 1880-81. dr dr The pratikramanasutras for a Jaina layman together with their elucidation in Sanskrit and their explanation in Gujarati. ""

Page #382
985.1 Begins.-- ( text ) fol. 2 93 " "" III. 4 Malasntras namo arihaMtANaM / namo siddhANaM etc, - - ( com. ) fol. 5 zrIzAradAya namo namaH // vRMdAravRMdAraka davayaM / praNamya vIraM jitamAravIraM // upAsakAnAmupakArato nuSThAnAvadhi (dhi) subodhaM // 1 // etc. -- ( tabba ) fol. 52 vadavAno zIla chaI jehanUM ehave devatAI samUhaI vAMyA chaI etc. Ends. - ( text ) fol. 2284 evamahaM AloIya niMdIya garahIa durgAcchiya sammaM // tiveheNa paDikaMto vaMdAmI jiNe covIsaM // 50 // -- (com) fol. 2284 ityevamaparuci sattvavibodhanAya zrAddhapratikramaNasUtravivRttireSA kiMcinmayA prakATetA'tra vistarArtho yo bRhadvitito varacUrNitazva Sar3avidha Avasyaka vitta IvaM saMgha 270020 jinasAsanAya sarvAbhitsumatijJAneMdukAMtivirAjamAna sarvAgAvayavaya suMdara bhaTTArakazrI somatilakapAdaziSpalavena laSitamasti iti zrIvRMdArakavRtyasUtra saMpUrNa samAptaH saMvat 1781nA varSe jeSTa sudi 13 ravau ghAre sakalapaMDitabhI 108 pragharakavikulAlaMkArasugaDAmaNipaMDitazrIsaMghacaMdragaNiziSyapaMDita zrIlAla caMdragaNitat ziSya paM0 maMgaladgaNicelA mANakacaMdapaThanArtha cIraMjIvI || zrIgoDIjI - prasAdAt zrI' pattanna' nagare // bAlAnAM suhitArthAya devAdikuzalo budhaH / vRMdAruvRttisUtrasya TabArtha liSyate mayA // 345 ( tabba ) fol. 228 e cha prakAra Avazyakano vidhi kahio graMthAgra 270020 / TabArthena kRtA buddhe devakusalena liSitA paM. devakusalena 'jIrNadurga madhye sUtrArtha kRtyate saMvatsaMjama sararasa ( 1756 ) mite hi varSe sumAghasite pakSe dazamIzuM vau pUraNau liSitaM 'jIrNadurage' (s) smin 'velAula baMdare graMthAgraMtha sarva malIne 3250 cheM jI / jehabuM dIDhaM tehavuM labhyaM chai / iti zrIvRMdAruvRttasUtraTavo saMpUrNa samAptaH paM0 maMgalacaMdreNa laSitaM gaNimANakacaMda paThanArthe // N. B. -- For additional information see No. 976.

Page #383
346 Jaina Literature and Philosophy [985. 769 SaDAvazyakasUtra Sadavasyakasutra anuSThAnavidhi with Anusthanavidhi tathA dabbA sahita and tabba No. 985 1875-76. Size.- Io in. by 4g in. Extent.- (text ) 181 folios ; 7 lines to a page ; 34 letters to a line. , -(rabba)., , , , , , , , , , , , Description.- Country paper tough and white ; Devanagari cha racters; this Ms. contains the text as well as the tabba ; the former written in a very big hand whereas the latter in a very small one ; legible and tolerably good hand-writing ; borders ruled in three lines and edges in one, in red ink ; red chalk used ; yellow pigment, too ; foll. numbered in both the margins as usual ; foll. 19 and 1810 blank; fol. 126th wrongly numbered as 125 in the right-hand margin ; similar is the case with fol. 179th ; the text, the tika and the tabba complete ; extent 2700 slokas. Age.- Samvat 1801(?). Author of the tabba-Pandita Devakusala. See No. 984. Subject.- The text and a Sanskrit commentary to Sadavasyaka sutra together with an interlinear explanation in Gujarati. Begins-( text ) fol. I' namo arihaMtANaM etc. ,, --- (com. ) fol. I // 60 // zrIgurubhyo namaH khaMdArukhaMdArakarUMdavaMyaM praNamya vIraM jitamAravIraM upAzakAnA vikSAmyanuSThAnavidhi subodhaM / / etc. , - (tabba ) fol. I. // 6 // zrIgurubhyo namaH / / bAlAnAM suhitArthAya devAdikuzalo budhaH vRMdAruvRttisUtrasya TabAthai laSIte mayA 1 etc. Ends.- (text ) fol. I790 evamahaM Aloiya nadiya garIhIya dugaMcchIya savaM tivIheNa paDIkaMto / vaMdAmi jaNe couvIza 50

Page #384
986.] lIi. 4 Malasutras Ends-- ( com. ) fol. 1790 navara durgAhiya zammaM ti jugupsitvA samyagatiM ityevamalparucisattvavibodhanAya zrIzrAddhapratIkramaNasUtrartireSA kaMcinmayA pragaTitA atra vIstaratArathe jJeyo vRhadvivRtito varacUrNitava || - ( tabba ) fol. 179deg Sadva AvasyakavRtti idaM saMbaMdhaM paM0 devakuzaleNa TArthataM paropakArAyaH // graMthAgraMtha zlokasaMkhyA satAvIse 2700 viza 20 // zlokasaMSyA kRtaM // iti zrIvRMdAravRtagraMtha samAptaM sapUrNa bhavati || 1801 mUnA varSe vesASavada 13 dine vArabudhe nakSatra azvani yoga sobhAgya paMcamo 5 vRSTikaraNe kRSNapakSe uSNamAse || zrIzejayakara mokSyanAya aneka zukratakAraka mahoupAdhyAya zrI zrI 19 zrI bhAnucaMdragaNI tataH sIdhyapaMDitazrIzrI zrIbhAvacaMdragaNI tatzISyapaMDitazrI zrI kanakacaMdragaNI tataH sISyapaMDitazrIzrIkapUracaMdragaNI tatziSyapaMDita zrI zrI mayA caMdragaNI tatzISyapaMDitazrIbhakticaMdragaNI tatziSya paM. zrI udayacaMdragaNI tatzISagaNI uttamacaMdalapata Atamai paThanArthaM / zrImahAvIraprasAdAt zrI 'DIsA' nagare zrIrastu kalyANamastu || 347 yAdrIsaM pustakaM..... jatnena paripAlayet 3 fol. 180 e chae prakAre Avazakano vidha kahIu chiM || e zaMbaMdha vRMdAravRtano paM. devakuzale bA'rthanI racanA karI hi // pArakA upagArani dete karI chiM graMthAgraMthazlokasaMkhyA 2700 viza 20 * zlokanI e zaMSyA kRtAM iti zrIvRMdArasapUrNa samAptA saMpUrNa bhavati saMvat 1892 nA varaSe jeSTha zuda 2 dane vAra cAme laSu puru thayo chi sahI // vRta anuSThAna vidhi ( vandAruvRtti) No. 986 Size.- 1o++ in. by 43 in. Extent. - 48 folios ; 17 lines to a page; so letters to a line. Description.- Country paper thin, rough and white, Devanagari characters ; small, legible and good hand-writing; borders ruled in three lines in red ink; yellow pigment used; foll. numbered in the right-hand margin; this Ms. contains mostly the safes of the text; complete; edges of the first and last few foll. slightly worn out; condition tolerably fair ; extent 2720 (?) Slokas. Anusthanavidhi (Vandaruvrtti) 641 1884-86.

Page #385
348 Jaina Literature and Philosophy [987. Age.- Pretty old. Author.- Devendra Suri. For details see No. 976. Subject. - An explanation of Sadavasyakasutra. Begins.-- fol. 1b // ja0 // OM namaH zrIsarvajJAya dAruDhedArakavaMdA ___ praNamya vIraM jitamAravIraM / upAsakAnAmupakAraheto rvakSyAmyanuSThAnavidhiM subodha // 1 // etc. Ends.-- fol. 48b ityevamalparucisattvavibodhanAya zrAddhapratikramaNasUtrAvittireSA kiMcinmayA prakaTitA / a(s)va tu vistarArthoM bRhapRttito varacUrNitazca jJeyaH // cha / iti SaDvidhAvazyakavidhiH samAptA // cha / graMthAgaM 720 (1)||ch / zubhaM bhavatu // cha / Reference.- Published. See No. 976. SaDAvazyakasUtra Sadavasyakasutra vandAruvRttyavacUrNi with Vandaruvitty sahita avacurni No. 987 1346 1886-92. Size.- Iog in. by 41 in. Extent.-- (text) 22 folios ; s lines to a page ; 28 letters to a line. , -(com.), , , 16 , , , , , 44 , ,, Description.- Country paper thin and greyish ; Devanagari cha racters%3; bold, clear, big and good hand-writing; borders ruled in four lines in black ink and edges in two in red ink; this is a pazcapATI Ms. ; red chalk used ; yellow pigment, too; fol. r* blank; a small strip of paper pasted to fol. 18; edges of the first and the last foll. worn out; condition fair; the text and its commentary complete so far as they go. I It appears that this line should be as under: "jJeyo bRhadvivRtito paracUrNitazca"

Page #386
988. ] Age. -- Pretty old. Author of the avacurni. -- Not mentioned. Subject. The text along with a small commentary on Devendra Suri's Anusthanavidhi alias Vandaruvrtti. Begins.- ( text ) fol. 1 namo arihaMtANaM etc., as in No. 981. 22 Ends. " III. 4 Malasutras - - ( com. ) fol. 1 iha tAvadAstikenApi nityaM trIn vArAn sapta paMca vA vArA (na) darzanazuddhyai caityavaMdanA vidheyA / yadAha sAhUNa satta bArA ityAdi / etc. ( text ) fol. 22deg evamAloiya etc., up to iti zrAddhapratikramaNasUtra. This is followed by the lines as under :-- aDAijje dIvasa mudde paMnarasa kammabhUmIsa etc. akkhayAyAra caritA te sabve sirasA maNasA matthaeNa vaMdAmi // cha // (com.) fol. 22b ityevamalparuci sattvAvibodhanAya / zrAddhapratikramaNasUtra vivRttireSA | kiMcinmayA prakaTitA'tra tu vistarArtho / jJeyo bRhadvivRtito varacUrNitazva | iti zrIdeveMdrasUrikRtavRtteravacUrNiH samAptA / This is followed by the comments on the concluding verse which run as under : SaDAvazyaka sUtra vRttisahita No. 988 manasA aMtaHkaraNena mastakena vaMde vAcA vaMde iti kriyApadamAvRttyA yojyaM / ityavacUrNi ( : ) pratikramaNasUtrANAM / N. B.-- For further particulars see No. 976. 349 Size.-- 11 in. by 4g in . Extent. -- 133 folios ; 14 lines to a page ; 62 letters to a line. Sadavasyakasutra with vrtti 1234. 1884-87.

Page #387
350 Jaina Literature and Philosophy [988. Description.- Country paper thin, rough and greyish ; Devanagari characters with occasional Capists; small, clear and good hand-writing ; borders ruled in four lines in black ink; red chalk used ; a piece of yellowish paper pasted to foll. 1* and 1335; edges of some of the foll. slightly worn out; condition tolerably fair ; foll. numbered in both the margins ; in the left--hand margin in a big hand and in the right-hand one in a small hand just at the foot of the fol. ; so, in some cases the numbering is worn out ; this Ms. contains the text as well as its explanation with the colophon ending abruptly. Age.--- Pretty old. Author of the commentary.- Tarunaprabha (c. Samvat I4II ). Subject.--- Salavasyakasutra together with its explanation in Gujarati. Several quotations in Prakrit enhance the importance of this explanation. At times narratives are given with a view to elucidate some of the topics. The text starts with Navakara and ends with Vandittusutra. Begins.-- (text) fol. 6. namo arahaMtANaM namo siddhANaM etc., as in No. 979. , --(com.) fol. I arha // zrIgautamasvAmine namaH // surAsurAdhIzamahIzanamyaM praNamya smygjinraajviirN| subodhamartha dinakRtyasatkaM likhAmyabuddhipratibodhanAya // 1 paDhamaM nANaM tao dayA evaM ciTrai svvsNjue| annANI kiM kAhI kiMvA nAhI cheya pAvayaM // 2 pahilau jJAnutanu pAchai dayA jIvaM viSai kRpA evaM iNi krami cidrai / kisau argha rahai / kauNa rahai guNazreNi isau A pahe jANivau / kauNa mAhiM savvasaMjae / / saMjao duviho sabvasaMjao sAhU desasaMjao sAva o| sabasaMjatahI mAhi desasaMjatahI maahi| annANI kiM kAhI kiMvA nAhI cheya pAvayaM vi / ajJAnu kiM kariSyati / kiM sau karisihi / kiMvA jJAsyati / athavA kisau jANisii / cheu puNyu / pAvayaM pApu / iti / supuNi jJAnu yogya rahaI dIjai | ayogya rahaI na dIjai / jogya zuzrAvaku jeha mAhi ekavIsa guNa hyii||

Page #388
351 988.1 III. 4 Mulasalras dhammarayaNassa juggo akkhudo 1 rUbavaM 2 pagaisomo 3 logappio 4 akUro 5 bhIrU 6 asaDho 7 sadakkhinnU 8 lajjAluo 9 dayAlU 10 majjhattho 11 somadidi 12 guNarAgI 13 sakkaha sapakhajutto 14 sudIhadaMsI 15 visesanna 16 vuTTANuo 17 viNIo 18 kayannuo 19 parahiyatthakArI 20ya / tahaceva laddhalakkho 21 igavIsaguNo havai saDDo / ' dharmU jurannu samasta samIhita dAna tau ciMtAmaNi | dharmarannu teha rahaI yogyu adhikArI havai saDro / isau chehilau paduIhA joDiyai / sahadu zrAvaku huyaI etc. Ends. -( text ) fol. 133 evamAloiya nidia etc., as in No. 976. --(com.) fol. 133 isI pari AloIya sakalAticAra guru Agai prakAzI karI niMdI karI garahI karI duggaMchI karI bhAvasuddhipUrva / tiviheNa paDikkato iti / trividha mani vacani kAyi karI pApa hUMtau pratikrAMtu nivartita hUMtau baMdAmi jiNe cauvvIsaM / cauvIsa jiNa / / RSabhAdika varddhamAnAvasAnavartamAnacauvIsIsaMsthAna vAdauM namaskarauM / / 50 iti zrIzrAvakapratikramaNasUtravivaraNaM samAptaM // cha / zrIH // cha // 50 // jayati 'caMdra'kulaM subha saMkulaM kuvalayojvalannaika kalAkulaM / gurucakoravaravrajamaMjulaM / vimalakomalagokamalAkulaM // 1 yaH staMbhanAdhIzvarapArzvanAtha prasAdamAsAdya navAMgavRttiM / labdhA babaMdheha kimatra citra / so'trAjaniSTA'bhayadevamUriH // 2 tadIyapAdadvayapadmasevA ___ madhuvrataH zrIjinakallabho'bhUt / yadaMgaraMge vratanartanena kiM nRtyatAkIrtidhanaM na lebhe // 3 tatpazaile(5)jani yogarAjaH surAnataH zrIjinadattamariH / tadaMtiSaccaika udaikalAvAn vinA kalaMka jinacaMdrasUriH // 4 ziSyo'sya jajJe jinapatyabhikhyaH pravAdinAgeMdrajaye mRgeNdrH| jinezvarAkhyo(5)sya babhUva ziSyaH ___ prabhAvanodbhAvanasiddhirAmaH // 5 See Viyaralava (pp. 86-87) of Pradyumna Suri.

Page #389
352 Jaina Literature and Philosophy [988.. jinaprabodhAbhidhamUrirAsI(t ) tatpadrapUrvAcalacaMDabhAnuH / pade tadIye jinacaMdramUri rabhUnmanobhUjayakAramUrtiH // 6 yeSAM yugapradhAnAnAM prasadya padadaivataM / dakSiAciMtAmaNI mahyaM jJAnatejasvinIM dadau // 7 pitRbhyo ')vyativAtsalyaM yenAdhyAyitarAM mayi / yaza-kIrtigaNirmA sa pUrva vidyAmabhANayat / / 8 rAjeMdracaMdrasUrIMdrarvidyA kAcana kAcana / jinAdikuzalAkhyaizca dApyAcAryapadaM ca me // 9 aMbhokUNya( ? )karaMdabiMdunikarAllAtvA yathA SaTpadaH / ___ svAM vRttiM tanute tathA zrutakaNAnAdAya ruccaiH pdaiH|| sUriH zrItaruNaprabhaH pramitaye mugdhAtimugdhAtmanAM / SoDhA(55)vazyakasUtravRtti byAliSa. ............padaM // 10 yanmithyA(5)bhidadhe mayA matimahAmAdyAdasamyakpade / vyAkhye pAdathavA tadatra sudhiyA saMzodhya nirmatsarAH / vyAtatvaM tu tathetikAM gatadhiyo niHsaMzayAnA...... / ... ... ... ... ... ... ... ... // 11 ....... zedhanadIdhite...kRte vivRteryadupArjayaM / upacitaM sukRtaM sukRtepsitaM . . . . . . bhavI ... Reference.- Extracts from Tarunaprabha Suri's Sadavasyaka balavabodhavstti composed in Samvat 1411 are given by Kalyanavijaya in his article "paMdaramI sadImAM bolAtI gujarAtI Tar". These extracts are published on pp. 54-55 of "get gujarAtI sAhitya pariSadake ahevAla ane nibaMdhasaMgraha" in A. D. 1923. For a Ms. having the vstti given here see Limbdi Catalogue No. 2664. This Ms. is written in Samvat I419 and as such it is very important. SaDAvazyakasUtra Sadavasyakasutra avacUrNisahita with avacurni 853 No. 989 1892-95. Size.-- 10] in. by +l in. Fxtent.- (text) 8 folios ; II lines to a page; 38 letters to a line. , -(com.), , , 31 , , , , 56 " "" ,

Page #390
989.1 IlI. 4 Malasitras Description. Country paper very thin and white; Devanagari characters with gears; this is a qaqat Ms., containing the text as well as a small commentary; the latter written in a very small hand; legible, uniform and good handwriting; borders pertaining to the text as well as those regarding the commentary ruled in three lines in red ink; red chalk used; foll. numbered in the right-hand margin only; edges of some of the foll. slightly damaged; condition tolerably good; both the text and the commentary complete. Age.-- Old. Author of the commentary- Not mentioned. Subject. This Ms. contains a number of sutras in Prakrit together with their explanation in Sanskrit. Some of the sutras are as under (1) navakAra mantra, ( 2 ) praNipAtasUtra, (3) iriyA bahiya, (4) tassa uttarI, ( 5 ) annattha, ( 6 ) namutthu NaM ( styled as the last sutra of the second adhikara ), ( 7 ) arihaMtace iANaM, (8) logassa (styled as the 1st sutra of the 4th adhikara ), ( 9 ) UTIL, (styled as the 1st sutra of the 6th adhikara), (10) fariga (styled as the 1st sutra of the 9th adhikara), ( 11 ) veyAvaccarANaM ( 12 ) jAvaMta ke vi sAhu, ( 13 ) uvasaggaharaM, ( 14 ) jaya vIyarAya, ( 15 ) icchAmi etc. aNujANaha ( suguruvandanasUtra ), ( 16 ) daivasikAlocanAsUtra, ( 17 ) abbhuTTio and (18) vaMditusUtra Begins. (text) fol. 12 at afgaroi etc. "" etc. Ends. (text) fol. 8b (com.) 1 iha caityavaMdanAdarzanazuddhayarthaM tathA vaMdanakaM gurUNAM guNavatpratipanne AvazyakaM sarvAticAravizuddhyarthe dviravazyamanuSThIyate / evamahaM Aloya etc. up to cauvvIsaM // 50 // This is followed by the line as under :-- iti zrAvakapratikramaNasUtraM saMpUrNa // cha // etc. 353 (com.) fol. 8b

Page #391
354 SaDAvazyaka sUtrAvacUri Jaina Literature and Philosophy ityevamalparuci sattvavibodhanAya zrAddhapratikramaNasUtra vivRttireSA kiMcinmayA prakaTitA ( 5 ) va nu (tu) vistarArtho yo bRhadvRtitora (vara) cUrNitazva || cha // iti zrAddhapratikramaNasUtrAvacUrNiH samAptaH // cha // Begins. - fol. 14 ahe // i No. 990 Size.-9 in by 41 in. Extent.-- - 32 folios ; 18 lines to a page ; 52 letters to a line. Description. Country paper thin, rough and white; Devanagari characters with occasional qars; small, legible and good hand-writing ; borders ruled in four lines in black ink; red chalk used; foll. numbered in both the margins; fol. r(c) blank ; so is the fol. 32; this Ms. contains the pratIkas of the sutras ; the last fol. slightly worn out; condition good; complete ; extent 2001 Slokas. Age.- Samvat 1622. Author. - Not mentioned. [989. Sadavasyakasutravacuri Subject. A small commentary in Sanskrit explaining the pratikramanasutras beginning with Navakara and ending with Vandittusutra. 765. 1892-95. tAvat zrAvaNApi pratyahaM trIn paMca sapta vArAn darzanavizuddhayarthaM caityavaMdanA vidheyA yadAhuH || sAhUna satta vArA / hoi ahorattamajjhayAraMmi / gihiNNA puNa ceivaMdaNa / tiya paMca satta vA vArA // 1 // tathA vaMdanakaM cASTa kAraNAnyAzritya guNavatpratipattaye ga ( gurUNAM dAtavyaM / tathA sarvAticAravizuddhyarthaM pratikramaNaM cobhayakAlaM avazyamanuSTheyamiti / tatra caitatsarvamapi / anuSTAnaM sAkSAdeva gurvabhAvo / sthApanAcArya | sthApanApUrva

Page #392
990.] Ill. 4 Mulasutras kameva vidheyaM / yadAhuH duHkhamAMdhakAra saMsAranimagnajinabhadragaNikSamAbhabhaNa pAda (dA:) || guruvirahami ThavaNa | guruvaesovadaMsaNatthaM ca / jiNavirahami vijiNabiMbaM sevaNAmaMtaNaM sahalaM // 1 rano pi paruksa vi / jaha sevAmaMtadevayAe vA / tahacaiva rukkhassa vi / guruNo sevA viNayaheU // 2 sA ca namaskAra pUrvikaivetyataH sa evAdau vyAkhyAyate / iti tatsUtraM cedaM namo arihaMtANAmityAdi | namo namaskAro arhadbhayaH zakrAdikRtAM pUjAM siddhigatiM vA arhatIti arhataH tebhyaH yathA // etc. Ends. fol. 324 saMprati pratikramaNAdhyayanamupasaMharan (na)nuttarottaradharmavRddhyarthamaMtyamaMgalamAha // evamahaM AloIya ityAdi vyAkhyA || eva (vaM ) prakAreNAhaM samyagAlocya guronirvecya ( ? ) niMditvA duSTakRtamiti svamakSaM garhitvA tadeva gurusamakSa jugupsitvA dhiggAM (mAM) pApakariNaM ityAdinA samyamiti sarva yojyaM / duchiyaM iti pAThe tu evamAlocya tA ( ? ) niMditvA garhitvA jugupsitaM duzcikitsitaM vAcicArajAtaM // samyag trividhena manobAkAmalakSaNena pratikrAMtaH sakRta (tU) iti pratikramaNazvaturviMzatijinAn vaMde iti gAthArthaH // 50 // iti pratikramaNavaMdanaka sUtrAvacUri samAptaH // cha // tailAdrakSejjalAdrakSe / rakSet zithilabaMdhanAt parahastagatA rakSet / evaM vadati pustikAH // 1 adRzyadoSAn mativibhramAcca / pramodito vA galitaM yadi syAt / tadAryavayaiH parizodhanIyaM / prAyeNa muhyaMti hi leSatAraH // 2 // yAdRzaM pustake dRSTaM etc. 3 graMthasyeva pramANastu / zlokasahasradvayaM pica / prAyaH graMthasya vAcogmi / karttA puruSeNa veditA // 4 // 355 graMthA 2001 || zubhaM bhavatuH // zrIrastuH // kalyANamastuH || saMvat 1622 varSe kArtika zudi 8 gurau 'jhalutarA'grAme / municelAratnasaMyamamuniliSitaM / / svahitArthAya vAcA (ca)nArthe pramAdaM vihAya samyagbhAvena ityAdarabhilakhitAstiH || cha || kalyANamastuH //

Page #393
356 SaDAvazyaka sUtra avacUrNi sahita No. 991 Size.- 101 in. by 41 in. Extent. (text) 23 folios; 7 lines to a page; 40 letters to a line. -(com.),, dr Jaina Literature and Philosophy ; 10 "" Description. Country paper thin and greyish; Devanagari characters with as; bold, big, clear and good hand-writing; borders ruled in four lines in red ink; this is a fre Ms.; it contains both the text and the commentary; the text written in the middle and in a bigger hand; fol. 1 blank; fol. 23 is also blank except that the title is written on it; edges of the first fol. slightly damaged; red chalk and yellow pigment used; the text and the commentary complete so far as they go; extent 1000 slokas; condition tolerably good. dr I Age.- Pretty old. Author of the text-More than one saint. dw [ 991. Sa davasyakasutra with avacurni wr wr rw 45 ; dw 1306 1891-95. ,,,, com. Not mentioned. It may be Devendra Suri, in case this commentary is really the same as Vandaruvrtti. Subject. This work deals with the following sutras which are to be recited at the time of performing a religious function viz. pratikramana. "" rw dr (1) navakAra maMtra, ( 2 ) iriyAvahiya, ( 3 ) tassama uttarI, (4) annattha, (5) namutthu NaM, ( 6 ) arihaMta ceiyANaM, ( 7 ) logassa, ( 8 ) pukkharabara, (9) siddhANaM buddhANaM, ( 10 ) jAvaMti ceiyAI, ( 11 ) namo'rhata, (12) (13) uvasaggaharaM, ( 14 ) jaya vIyarAya, ( 15 ) saMsAradAvAnala, ( 16 ) ciMtAmaNi, ( 17 ) suguruvaMdana, ( 18 ) devasia AlouM, ( 19 ) savvassa vi ( ? ), ( 20 ) ambhuTTio, ( 21 - 30 ) dasa paccakkhANa, ( 31 ) atIcAragAthA, ( 32 ) karomi bhaMte, (33) vaMdita ( zraddhapratikramaNasUtra ), ( 34 ) Ara ujjhAe, (35) zrutadevatAstuti, ( 36 ) namo'stu varddhamAnAya, ( 37 ) varakanaka and ( 38 ) vizAlalocana. These sutras are briefly explained in the avacurni. Thus the text contains some more sutras than what we find in the printed

Page #394
997.] 111. Malasutras Begins.-- ( text ) fol. 1 // 6 // ___ namo arihaMtANaM / namo siddhANaM / namo AyArayANaM / namo uvajjhA. yANaM / namo loe sabbasAhuNaM / eso paMca namukkAro savvapAvappaNAsaNo / maMgalANaM ca savvesiM paDhama havai maMgalaM / / 3 Il etc. , - (com. ) fol. I" e 60 / / nmo'hNdbhyH| vaMdArubaMdArakavRMdavaMdyaM / ___ praNamya vIraM jitamAravIraM / upAsakAnAmupakAraheto vakSyAmyanuSThAnavidhiM suboghaM // 1 // etc. Ends.-- ( text ) fol. 22a evamahaM Aloiya niMdia gI( ga )ri( ra )hiya (u)duggachiya( yaM) sa(saM)maM / tiviheNa paDikkato baMdAmi jiNe caurvAsaM / / 50 / / iti zrAddhapratikramaNasUtraM / ,, - ( com. ) fol. 224 . nirvedaM gatvA samyag zuddhyA trividhena manovAkAyAdinA prati 0 // pramAdAdikatAnivRtta san vaMde aMtyamaMgalamiti // 50 // iti zrAvakapratikramaNasUtrAvacUrNiH samAptA / ,, - (text ) fol. 234 kalaMkanirmuktanamuktapUrNataM kutarkarAhuyasanaM sadodayaM / apUrvacaMdraM jinacaMdrabhASitaM dinAgame naumi budhainamaskRtaM // 3 // , - ( com. ) fol. 23 kutarkarAhu grasatIti kutrkraahugrsnH|| 3 // cha || zrIH / ___etc. madeg graM0 1000 / Reference. - The text is published. See No. 976. For description of a Ms. having Salavasyakasutra and avacuri see B. B. R. A. S. vols. III-IV, p. 400. Here it is said that this ayacuri "begins like the Vandaruvitti and is probably based on it. It does not contain the kathas".

Page #395
358 Jaina Literature and Philosophy 1992. . SaDAvazyakasUtra Sadavasyakasutra avacUrisahita with avacuri No. 992 - 195. 1873-74. Size.- 101 in. by 43 in. Extent.--(text) 10 folios ; 8 to 1o lines to a page ; 35 to 40 letters to a line. ,, - ( com.),, ,, ; 14' ,, ,, ,, ; 484 , to a line. Description.- Country paper thin, rough and white; Devanagari characters with occasional pRSThamAtrAs; this is a pazcapATI Ms.; very smail, clear and good hand-writing : borders of one side ruled in four lines and those of the other side in two in black ink ; red chalk used ; yellow pigment, too; foll. numbered in the right-hand margin only, and that, too, just in a lower corner ; both the text and its commentary complete ; condition good, though some of the foll. have their edges slightly damaged. Age.-- Samvat 1491. Author of the avacuri.- Not mentioned. Subject. -- The text together with its explanation based upon ___Vandaruvrtti. Begins. ( text) fol. I* || 50 // ahe / / namo arihaMtANaM 1 namo siddhANaM 2 etc. ,, -(com.) fol. II || 50 // iha tAva....kenApi nityaM trIn sapta paMca vArAna darzanazuddhayai caityavaMdanA vidheyA etc. Ends.-- (text ) fol. 100 evamahaM Aloia niMdiya garihiya dugaMchiu sama tiviheNa paDikkato baMdAmi jiNe cauvIsaM // 50 // iti sUtraM , -- ( com. ) fol. ro' iti zrIdeveMdrasUrikRtavRtteravacUriH / saM0 1491 varSe 'tapA'zrIsomasuMdarasUriziSyamunikIrtinA'lekhi // zubhaM // 1-2 There are 25 lines with 20 letters in each line so far as the marginal por.

Page #396
993.] SaDAvazyaka sUtra avacUrisahita No. 993 Size. 10 in. by 4 in. Extent. (text) 12 folios; 23 lines to a page; 28 letters to a line. -(com.),, "" Ill. 4 Malasutras "3 dr ; I dr dr dw Begins.-- ( text ) fol. 14 60 // namaH zrIpravacanAya / namo arihaMtANaM etc. dr -(com.) fol. 1a || 0 ||| ; Description. Country paper thin, rough and greyish; Devanagari characters; this is a qaqat Ms.; it contains the text as well as the commentary; the former written in a slightly bigger hand; borders ruled in four lines in black ink ; yellow pigment used; foll. numbered in the right-hand margin; edges of some of the foll. worn out; condition tolerably good; complete up to Sakrastava. Age. Samvat 1684. Author of the avacuri- Not mentioned. Subject. 1-2 These numbers refer to a column. Sadavasyakasutra with avacuri 2 359 dr The Ms. starts with Navakarasutra and ends with Sakrastava which is preceded by pratyakhyanasutra. 132. 1873-74. Adau sUtralakSaNaM nirUpyate / etc. Ends. -- ( text ) fol. 12 iti zakrastavaH saMpUrNaH // 2 // kalyANaM bhavatu // zrI // zrI dw dr dw - ( com. ) fol. 124 tato ( S) naMtaraM trikAlavartidravyArhadvaMdanArthamimAM gAthAM pUrvAcAryAH paThati / je ai sAdi sugamA dvitIyo (S) dhikAra | prathamo daMDaka : // cha // saMvat 1684 varSe posamAse zuklapakSe caturdazyAM tithau vRhazapati / 'sItA' nayaramadhye liSiteyaM SaDAvazyakasya vRttiH kalyANaM bhavatu leSakapAThayoH zrI // zrI //

Page #397
360 SaDAvazyaka sUtra ( ? ) avacUrisahita No. 994 Size. 10 in. by 4 in. Extent. (text) 3 folios; 14 lines to a page; 52 letters to a line. . 33 32 - (com.),, ; 13 ;80(?) Description. Country paper very thin, rough and white; Devanagari characters with pRSTamAtrA ; this is a pacapATI Ms.; the text and the commentary both written in a smaller hand; the latter in a very very small hand; quite legible, uniform and good hand-writing; borders ruled in three lines in red ink; red chalk used; foll. numbered in the righthand margin; edges of each of the foll. slightly damaged; condition tolerably good; both the text and the commentary complete so far as they go. 22 Jaina Literature and Philosophy Ends.--(text) fol. 3deg wr [ 994. Sadavasyakasutra (?) with avacuri p "" cha // cha // 1 Sec p. 353. "" Age.- Old. Author of the avacuri-- Kulamandana. Subject. The text together with its explanation in Sanskrit. Begins (text) fol. 1a || 0 || namo arihaMtANaM etc. :9 123. 1873-74. "" ( com. ) fol. rb || 60 // namo jinAgamAye // iha caityavaMdanAdarzanAzuddhyarthaM tathA vaMdanake gurUNAM guNavatpratipattaye tathA AvazyakaM sarvAticAravizuddhayarthaM dviravazya manuSThIyate / etc. aNimUhiabalavirio parapakar3a jo jahuttamAutta jeMkui a jahAthAmaM / nAyavvo vIriAyAro // 8 ityatIcAragAthAH // cha // "" 21 - ( com. ) fol. 3 iti zrIguruvaMdanakA'cUri zrIkulamaMDanasUrikRtA 1

Page #398
995.] III. 4Malasatras 361 SaDAvazyakasUtra Sa davasyakasutra bAlAvabodhasahita with balavabodha No. 995 254. 1871-72. Size.-10% in. by 4in. Extent.-- 54 folios ; 14 lines to a page ; 42 letters to a line. Description.- Country paper tough and white; Devanagari cha racters; big, legible and good hand-writing , borders ruled in three lines and edges in one, in red ink ; foll. numbered in the right-hand margin only; fol. 1 blank; this Ms. contains the text as well as its explanation in Gujarati ; the text almost complete so far as it goes ; condi tion very good ; the text at times written in a bigger hand, Age.- Not quite modern. Author of the balavabodha.- Not mentioned. Subject.- This Ms. contains various sutras beginning with Nava kara and ending with Samsaradavanalastuti and Javanti ceiyaim. These sutras are explained in Gujarati. Begins.- (text ) fol. I" e 6 // zrIpArzvanAtho vijayate // __namo arihaMtANaM etc. ,,- ( balan ) fol. // 6 // // zrIgaNezAya namaH zrIgurubhyo namaH // etc. Ends.-- (text) fol. 54deg jAvaMti ceiAI ur3e a ahe atirialoe a savvAiM tAiM vaMde ia saMto tattha saMtAI 1 , --( balan ) fol. 54 Urdhva lokane viSe adho lokane viSe tiria lokane virSe puna arthe te sarva jinabiMba prataI bhAvasahita vAdauM huI ihAM rahyo thako tihAM je sthAnaka Agali kahIsthe tihAM rahyA je caitya zAsvatAM azAzvatAM teha prateM vAMdauM Reference. -- For a Ms. having the text containing some of the sutras above noted and a balavabodha in bhasa see Keith's Catalogue No. 7495. 46 [J.L. P.]

Page #399
362 Jaina Literature and Philosophy [996. SaDAvazyakasUtra Sadavasyakasutra TabbAsahita with tabba 1289 No. 996 1886-92. Size.-- 9} in. by 4.3 in. Extent.-- (text) 18 folios ; 6 lines to a page ; 38 letters to a line. ,, - (tabba) , , , , , , , 64 , , , Description.-- Country paper thin, rough and white ; Devanagari characters; the text written in a bigger hand and the interlinear tabba in a smaller hand ; legible and tolerably good hand-writing ; borders ruled in two lines and edges in one in red ink ; foll. numbered in the right-hand margin only; fol. ra blank ; so is the fol. 186; condition very good ; complete. Age.- Samvat 1824. Author of the tabba.--- Not mentioned. Subject:--Some of the sutras in Prakrit along with their explanation in Gujarati. Begins.- (text) fol. Ideg // 6 // paMDita // cakricUDAmaNIzrIzrI108zrItilaka vijayajIprazAdAt / / zrI // namo arihaMtANa 1 namo siddhANaM / 2 etc. ,, -- ( tabba ) fol. 1deg paMDittazrI108zrIjIvavijayajI tazikSazrI 105. zrIpremavijayajI tazikSapaMzrIdatilakavijayajIprazAdAt // 6 // // namaskAra mAharo zrIarihaMta viharamANanaiM hau namaskAra siddhi rahiM huu mAharau namaskAra zrIAcAryagurunai huu etc. Ends.-- (text) fol. 18a jaivi paDilehaNAe heU jIyarakkhaNANAya taivi imaM maNamakkaDa nijaMtaNachasuNIchitti 5 / iti muhapatIpaDilehaNagAthA saMvatta 1824 mitti posa suda 6 nIze zanIvAreNa liSataM puzrI108zrItilakavijayajI tazikSakapUravijayalapIkRttaM 'pIpADa'madhye // zrIzrI108zrIvijayazenAvattitatreNa zrImastu leSapAdvacanam

Page #400
997.] ff III. 4 Malasutras 363 - ( tabba ) fol. 184 vizrI 108 zrIzrIzrIzrIvijaya zena sarike iti muhapatipaDilehaNagAthA jAMNavI jatarphe // liSatu zrI 108 zrIbija senasareNa tatzrI105 zrImavijaya tatzrI103 zrI amaravijaya tatzrI saM. 1824 miti mAghavade 14101 zrI amRtavijaya tatzrI101lakSmIvIjaya tatzrI37zrIjivavijayajI tatzrI 35zrIpremavijayajI tatzrI 35zrItilakAvajayajI tatziSya liSatAM paM0 kapUra vijayena 'pIpADa'madhye zubhavelAyaM kalaMNamastu zrI // mAhArAja zrI 108 vijayidhajIrAjeNa lapIkRta zrIma SaDAvazyaka sUtra bAlAvabodhasahita No. 997 Size.-- 93/4 in. by 42 in. Extent.- 71 folios; 15 lines to a page ; 42 letters to a line. Description.- Country paper thin and white; Devanagari characters ; small, legible and good hand-writing; borders ruled in three lines in red ink; red chalk used; white pigment too ; foll. r* and 71b blank ; edges of the first and last foll. slightly worn our ; a strip of paper pasted to fol. 12; condition on the whole good; the text as well as its balavabodha complete; the latter seems to be composed in Samvat 1501. Age.-- Samvat 1766. Author of the balavabodha- Mahopadhyaya Hemahamsa Gani, devotee of Jayacandra Suri, pupil of : Munisundra Suri, pupil of Somasundra Suri of the Tapa gaccha. Begins. -- ( text ) fol. 1 namo arihaMtANaM etc. " Subject. Sutras pertainting to the six avasyakas along with the corresponding explanation in Gujarati. Sadavasyakasutra with balava bodha 872 1892-95. - ( balao ) fol. rb OM namaH siddhaM // zrIjinAya namaH // OM namaH zrIpArzvanAthAya namaH / C

Page #401
364 Jaina Literature and Philosophy 1997 zrI(zre)yAMsi zrImahAvIraH sizrIsaMghasya yacchatAt yasyAjJA kalpavallIva manovAMchitadAyinI 1 zrIvarddhamAnajinazAsanarAjyanet (?) vizvatrayAdbhute caritrayugapradhAnaH zrIsomasuMdaragururNaru ca vattI(?) bhUyAdamayamahimA mama suprasannaH 2 tatpaTTanAyakA zrImunisuMdarayo jayatyadhunA | jayacaMdrasUri-jinakIrtimariparikaritAH // 3 // svAnyayorupakArAya likhyate mayA / SaDAvazyakasUtrANAM vyAkhyA bAlA( va )bodhinI // 4 // pahilaM sakalya mAMgalikanu mUla zrIjinazAsananu sAra igyAra iMga caUda pUrvanu uddhAra sadeva zAzvatu zrIpaMcaparameSTi mahAmaMtra etc. Ends.- ( text ) fol. 70deg desAvagAsiyaM uvabhogaparibhoga paJcakkhAmi / annatthaNA bhogeNaM sahasAgAreNaM mahattarAgAreNa savvasamAhivattiAgAreNaM vosirAmi ,, - ( balan ) fol. 71 jeha bhaNI sUdhA dharmanu udyama jIva huMi mokSaphala dAIu kai // iti pratyAkhyAnabAlAvi(va)bodhaH cauthau adhikAra saMpurNa hUu // zrISaDAvazyakabAlAvi(va)bodha saMpUrNa hUu / eha mAhi cyAri adhikAra pahilai adhikAri devavaMdanI 1 bIjai guruvaMdanI 2 cIjai paDikamaj3 cauthai paJcakkhANa 4 iti zrI tapAgacchanAyakasakalasuvihitapuraMdarazrIsomasuMdarasUrizrImunisuMdarasUrizrIjayacaMdrasUripadakamalasevinA / ziSyamahopAdhyAya zrIhemahaMsagaNinA zrAddhavarAbhyarthanayA kRto(s)yaM SaDAvazyakabAlAvi(va)bodha AcaMdrAkrka naMdyAt saM0 1501 va // // saMvat 1766 nA varSe mAsottamamAghamAse zuklapakSe tRtIyAtithau ravivAsare / likhitaM 'moDha'jJAtIya // Reference.-- For description of a Ms. having Sadavasyakasutra and Merusundara's balavabodha see B. B. R. A. S. vols. III-IV, p. 400. Herein we find a description of another Ms. having Sadavasyakasutra and an anonynous balavabodha composed earlier than that of Merusundara. 1 See No. 942

Page #402
998.] III. 4. Malasutras .365 SaDAvazyakasUtra Sa davasyakasutra TabbAsahita with tabba 158 No. 998 1871-72. Size.-- 101 in. by 44 in. Extent. -- 23 folios ; s lines to a page ; 36 letters to a line. Description.- Country paper thin, rough and white; Devanagari characters; this Ms. contains the text and its interlinear tabba ; the former written in a very big hand whereas the latter in a very small one ; legible and good hand-writing; borders ruled in two lines and edges in one, in red ink; foll. numbered in both the margins; fol. I blank ; red chalk used; both the text and the commentary complete; condition very good. Age.- Samvat 1873. Author of the tabba-- Not mentioned. Subject.--This work starts with Navakara and ends with Samayiya vaijutto followed by Samstarakapaurusisutra and several pratyakhyanas beginning with cauvihara uvavasa. All these sutras are explained in Gujarati. Begins.- (text) fol. I zrIAdinAthajI namaH / / Namo arihaMtANaM Namo siddhANaM // etc. ,, - (tabba) fol. I zrIarihaMtane mAro namaskAra ho| sarva siddhane mAro namaskAra ho / AcAryane mAharo namaskAra ho / etc. - ( text ) fol. 19 sAmAiaMmi u kae samaNo iva sAvao havai jamhA eeNa kAraNeNa bahuso sAmAiaMkujjA 2 sAmAiaposahasaMThiassa jIvassa jAi jo kAlo so saphalo bodhavvo seso saMsAraphalaheU 35 chaumattho mUDhamaNo kittiamittaM pi saMbhare jIvo jaM kiMci na saMbharAmi micchA mi dukkaDaM tassa 4 I See p. 255. "

Page #403
1366 Jaina Literature and Philosophy [998. sAmAyaka vidhi lIdhuM vidhiM pAryu ji kAMI avidhi hUu huI te savi huM maneM vacaneM kAyAiM karI tassa micchA mi dukkaDaM cha karemi bhaMte posaha AhAraposahaM desao samvao sarIrasakkAraposahaM savvao baMbhaceraposahaM savao avvAvAraposahaM savao caubihe posahe ThAmi etc. -- (text) fol. 20 jai me hunja pamAo imassa dehassa imAi rayaNIe AhAramuvahidehaM ___ savvaM tiviheNa bosiriaM4 cattAri maMgalaM arihaMtA maMgalaM siddhA maMgalaM sAhU maMgalaM kevalipaNNatto dhammo maMgalaM 5 cattAri loguttamA arihaMtA loguttamA siddhA loguttamA sAhU loguttamA kevalipaNNatto dhammo loguttamo 6 cattAri saraNaM pavajAmi arihate saraNaM pavajjAmi siddhe saraNaM pavajjAmi sAhUsara kevalipaNattaM dhamma saraNa pavajjAmi 7 pANAivAya 1 maliaM2 corikkaM 3 mehuNaM 4 daviNamucchaM 5 kohaM 6 mANaM 7 mAyA 8 lobhaM 9 etc. - (text) fol. 21 arihaMto maha devo jAvajjIvaM susAhuNo guruNo jiNapaNNattaM tattaM ia sammattaM mae gahiaM 14 iti zrIsaMthArAporisIsUtraM Ends.- fol. 23deg savvasamAhivattiAgAreNaM 8 pANassa leveNa vA 1 aleveNa vA 2 accheNa vA 3 bahuleNa vA 4 sasittheNa vA 5 asittheNa vA 6 vosirAmi iti AMvi(bi)lapaJcakkhANa saMpUrNa saMpUrNa SaDAvazyakaM saMvat 1873 varSe 'kRSNagaDhagnagarena lipi Sthandilapratilekhanasatral known as 24 mAMDalA are given as under in two columns on the last foll. which is not numbered :-- 1 This satra is printed in "ghaDAvazyakasUtrANi" (p. 5). It is pratically printed in 'paJcapratikramaNAdisUtrANi" (p. 538) published by Sri Jaina Sreyskara Mandala Mhesana in Samvat 1917. It is also printed in "zrIpratikramaNasatra" (pp. 383-384) published by Sravaka Bhimasimha Manaka in A. D.1888.

Page #404
999.] III. 4 Malasatras 367 // vaDI niti saMthAranai smiipiN|| // AgADhe majjhe pAsavaNa(Ne) aNa ahi laghu nItya saMthAranai samIpaI Ase 2 etc. // AgADhe(? De) Asanne uccAre / upAzrayadvAravihira pAsavaNe(0) aNaahiAse 1 aNAgADhe Asanne uccAre AgADhe Asanne pAsavaNa(?Ne ) aNa aNAgADhe majjhe pAsavaNe ahiyAse 2 pAsavaNa(?Na) aNaahi yAse 1 etc. ahiyAse 1 // aNAgADhe majjhe uccAre pAsavaNe // AgADhe majjhe uccAre pAsavaNe ___ ahiyAse 3 aNaaNaahiyAse 2 etc. aNAgADhe dUre pAsavaNe ahiyAse 3 These are the the mandalas made for attending natural calls. These calls may be attended to ( 1 ) near the bed, (2) inside the upasraya near its entrance ( 3 ) outside the upasrya but near its entrance and (4) at a distance of about 100 hastas from the upasraya. SaDAvazyakasUtra (2) Sa davasyakasutra bAlAvabodhasahita with balavabodha No. 999 246(a). 1871-72. Extent. -- (text) 39 - 2 = 37 folios ; 3 lines to a page ; 32 letters to a line. ,, -- ( balan ) 37 folios ; 7 lines to a page ; 42 letters to a line. Description.-- Country paper tough and whitish ; Devanagari characters ; this Ms. contains the text as well as its balavabodha; the former written in a very big hand ; legible and good hand-writing ; borders ruled in two lines and edges in one, in red ink ; foll. numbered in the right-hand margin only; white paste used ; edges of the last fol. slightly worn out; condition on the whole good ; both the text and the balavabodka incomplete since the first two foll. are missing ; this Ms. contains an additional work viz., saMthArAporisIsutta which begins on fol. 36deg and ends on fol. 396; it is explained in Gujarati; the pertinent lines on fol. 36deg and 39deg are as under :

Page #405
360 Jaina Literature and Philosophy [999 ( balan ) fol. 360 zrIgautamAdi mahAmoTA ruSasviranaI namaskAra hau ehavA gurusASaI pachaI triNi nomukAra kahaI ( text ) fol. 39 arihaMto mahadevo / jAvajIvaM susAhuNo gurunno| jiNapannattaM tattaM / ia sammattaM mae mhiaN|| 14 // iti zrIsaMthArAparisisUtra saMpUrNaH // cha / zubhaM bhavatu // kalyANamastuH // cha zrI Then follow some three verses. ( balan ) fol. 39" iti zrIsaMthArAvidhi saMpUrNaH Age.- Not modern. Author of the balavabodha.-Not mentioned. Subject. This work consists of a number of sutras together with their explanation in Gujarati. Begins.-- ( text ) fol. 39 bIyakkamaNe / hariyakamaNe / etc. -- ( bala0 ) fol. 3deg bIyakA gohu~ pramuSa bIjanaiM cAMpavaI karInaiM etc. Ends.- ( balan ) fol. 36deg posahavidhiM lIdho / vidhi pAryo vidhi karatAM avidhi AzAtanA huI / te savi hu~ / mana vacana kAyAiM karI micchA mi dukkaDaM ||ch|| iti zrIkhaDAvazyakasUtraM saMpUrNa // cha / SaDAvazyakasUtravRtti (?) Sadavasyakasutra vrtti (?) No. 1000 43. 1880-81. Size.- 121 in. by 21 in. Extent.-- 32 leaves ; 4 to 7 lines to a page ; 55 to 60 letters to a line. Description.-Palm leaf thin, durable and greyish ; Devanagari cha racters with pRSTamAtrA ; small, legible and good hand-writing; this Ms. presents an appearance of the work having

Page #406
1000.] 369 been divided into two separate columns but really speaking lines of the first column are continued to the second; borders of each of the columns ruled in two lines in black ink; red chalk used at times; the left-hand margins have been worn out in good many cases; this Ms. starts with the first leaf numbered as 146; leaves numbered in both the margins; in the right-hand margin as 146, 147 etc.; in the left-hand one by letters; e. g. 174th is numbered as Ill. 4 Malasutras several leaves more or less worm-eaten; condition unsatisfactory; there is a hole in every leaf in the space between the two columns: there are two fragmentary blank leaves at the end; they are extra; leaf 146a blank; complete so far as it this Ms. contains the rates of the goes; for text; instance karemi bhaMte ityAdi on leaf 148. According to Buhler's Report for 1880-81, p. 25, this Ms. is a continuation of the preceding one i. e. that of 42 of 1880-81 dated Samvat 1179. Age.- Old. Author. Not mentioned; that is what appears. Subject.- A Sanskrit commentary explaining certain sutras probably pertaining to the six avasyakas. Begins.-- leaf 146b sarvajJAya || deveMdravaMyacaraNAn praNamya bhaktyA jaineMdranAma... kiMcinmAtraM vakSye praticaraNAyA gRhasthAnAM // gurubhaktyA yadavAptaM tAvanmAtramapi bhavati puSTikaraM / $?Hi(s)fq a?ia || di(s)xai a aPi aegPoiitala etc. Ends.-- leaf 177b A 94 64 jayati jagati klezAveza prapaMca himAMzumAn / ......IagaiaqAaeiavaiazmnozqigara yatipatirajo yasyA hRSyAnmatAM vunidhirnayAn dhamatamatayastInAnApare samupAsa || ... nAMthakapateH zatAni bhASNaigatagatAni viMzatyAvikAnye.

Page #407
370 Jaina Literature and Philosophy [1001. Sar3AvazyakasUtra Sa davasya kasutrabAlAvabodha balavabodha 1309. No. 1001 1891-95, Size.-- 102 in. by 43 in. Extent. -- 60 - 6 = 54 folios ; 14 lines to a page ; 62 letters to a line. Description.- Country paper rough, thin and white; Devanagari characters with occasional pRSTamAtrAs; big, clear and good hand-writing ; borders mostly ruled in two lines in black ink; red chalk used; foll. numbered in the right-hand margin only; this Ms. contains the game of the text ; fol. 60deg blank ; strips of paper pasted to fol. 60deg ; corners of the first few foll. slightly worn out ; condition tolerably good; foll. I-6 missing ; otherwise conmplete. Age.- Samvat 1611. Author.- Not mentioned. Subject.- Explanation of Sadavasyakasutra in Gujarati. Begins --- fol 7deg mokSa lahasi // 6 kathA / zrInukArabAlAvabodhaH // etc. Ends.-- fol. 60deg evhA paravANani viSai bavekIrayatnaghaSa karavA / jeha bhaNI sUdhA gharmanu udyama jIva huI mokSaphaladAIu thAi / prtyaakhyaanbaalaavibodhH| cauzu adhikAra saMpUrNa huu / zrISaDAvazakabAlAvibodha saMpUrNa huu / / eha mAhi cyAri adhikAra / pihali adhikAri devavaMdana / 1 bIjai guruvaMdana 3 / trIjai paDikamaNo 4 cuthai pacaSAMNa / etalai cyAri adhikAra samAptaH // // saMvat 1611 varSe bhAdrapadAdi 9numi gurudine / 'unaMta duggaiH 'bhaatt'jnyaatii| ThAkurazrIzrIzrIzrIbalarAja / sutasasvAdAsa lipiti / / zubhaM bhavatu / cha / / yAdRze......doSo na dIyate // 1 // cha / zrIzrI AcAryadharmaratnamAragurubhyo namaH // cha // zrIrastu // cha /

Page #408
i002. 1 III. 4 Mulasatras 371 Avazyaka sUtraniyukti Avasya kasutraniryukti (Avassayasuttanijjutti) (Avassayasutta nijjutti ) 629. No. 1002 1892-95. Size.- 10 in. by 43 in. Extent.- 35 folios ; 24 lines to a page ; 60 letters to a line. Description. Country paper very thin and greyish ; Devanagari characters with quals ; very small, clear and fair bandwriting ; borders ruled in two pairs of lines in black nk; the space between these pairs coloured red; numbers for some of the foll. entered twice in one and the same margin ; bits of paper pasted to fol. 18; edges of the first two and those of the last two slightly worn out; unnumbered sides decorated with a small disc in the centre ; the numbered, with two more,one in each of the two margins; complete ; red chalk used; condition fair. Age.-- Samvat 1483 (?) Author.-- Bhadrabahusvamin. For his other works etc. see No.709. For a discussion in German see " Ubersicht uber die Avasyaka-Literatur" (pp. 23-27). Subject.-- About so verses which occur in the begining of this Ms. and form the Sthaviravali are also found in the beginning of Nandisutra. But they are not found in the edition containing Avasyakasutra, its niryukti and Haribhadra Suri's commentary (D. L. J. P. F. Series). They do not occur even in the edition containing niryukti and Malayagiri Suri's tika (Agamodaya Samiti Series). Furthermore, they are not commented upon by Jinabhadra Ksamasramana, Haribhadra Suri, Malayagiri Suri or any other commentator of the Avasyakasutraniryukti; but they occur in various Mss. This may due be to the fact that some scribe wrote them perhaps as mangalacarana and others followed in his foot-steps. So if we were to neglect them for a moment, the Avasyakasutraniryukti, which is a metrical composi

Page #409
372 Jaina Literature and Philosophy (1002. tion in Prakrit can be said to be explaining the six adhyayanas of the Avasyakasutra. The niryukti of the ist ( Samayika) adhyayana can be divided into two groups: (1) Uvagghayanijjutti ( Upodghataniryukti ) and ( 2 ) Namokkaranijjutti ( Namaskaraniryukti). Out of them Upodghata-niryukti is sub-divided into several sections known as under :-- (1) Pedhiya (Pithika), (2) Padhamavaravariya ( Prathamavaravarika), ( 3 ) Biiyavaravariya ( Dvitiyavaravarika), (4) Uvasagga (Upasarga ), (5.) Samosarana ( Samavasarana ), (6) Ganaharavaya' (Ganadharavada), (7) Samayari ( Samacari ), (8) Nihoavavattavva (Nihnavavaktavya ) and (9) Sesauvagghayanijjutti (Sesopodghatariryukti). The niryukti of the second ( Caturvinsatistava ) adhyayana has no such sub-divisions. The sarne is the case with the niryukti of the third ( Vandana ) aydhyayana. Under the niryukti of the fourth (pratikramana) adhyayana, we find ( 1 )4 Jhanasaya ( Dhyanasataka ), (2) Paritthavaniyanijjutti (Paristhapanikaniryukti), ( 3 ) Patikkamasamgahani ( Pratikramanasamgrahani)s; (4) Jogasamgahanijjutti ( Yogasamgrahaniryukti ) and ( 5 ) Asajjhayanijjutti ( Asvadhyayaniryukti). Neither the niryukti of the firth ( Kayotsarga ) adhyayana nor that of the sixth (Pratyakhyana ) adhyayana, has any subdivisions as we find in the case of the niryukti of the first adhyayana. In the the case of a few Ms. contain syakasutra 1 This is also styled as Ganahara. 2 This is of ten types. 3 This division is at times neglected. 4 This is not the composition of Bhadrabahusvamin, though sound here; but it is rather the work of Jinabhadra Gani Ksanisaramana. 5 This is also known as Samgrahani.

Page #410
1002.) III. 4 Malasatras 373 niryukti, its component parts have been treated by me separately as desired, and they have been accordingly given separate serial numbers. Ernst Leumann believes that there have been four redactions of the Avasyakasutraniryukti : (1) Bhadrabahu's redaction, ( 2 ) Siddhasena's redaction, ( 3 ) Jinbhata's reaction and ( 4 ) the Vulgata-redaction.' After entering into a learned discussion pertaining to these redactions he has recapitulated the results in a tabular form which I may here represent as under: -- Avasyaka Avasyaka-niryukti XI 1 3rd 4th Ist Redac. 2nd Redac. Redac. Redac. II-VIII ( Uvaggha- I ( Pedhiya) Theravali yanijjutti) Pancanamaskara 1 IX I ( Samayika II ( Caturvimsati stava ) III ( Vandana ) XII IV ( Pratikramana ) XIII XIV XV ( Paritthavan. XVI ( Sam- (Jhan iya-nijjutti) gahani) asaya ) XVII (Jogasam gaha) XVIII Asajjhaya nijjutti ) V (Kayotsarga) XIX VI | Pratyakhyana) XX In this connection I may add that the seventh section of Mulayara 3 (Mulacara ) of Vattakerasvamin is known by the name of Avassayanijjutti. This Digambara work resembles Avasyakasutraniryukti in several respects such as six divisions etc. 2 3 See Ubersicht uber die Avasyaka-Literatur " (p. 2.). lbid., p. 31. For a pertinent portion of this see the above-mentioned work pp. 16-19.

Page #411
374 Jaina Literature and Philosophy [ 1002 For a detailed information about "subject" in Sanskrit sec pp. 135-139 of " nanyAdigAthAyakArAdiyuto viSayAnukramaH " (Agamodaya Samiti Series No. 55). In the printed edition in verses 450, 457 and 458, there is a reference to garbhapaharana pertaining to Lord Mahavira. This is in agreement with the passage occurring in Bhavanadhyayana of Acarangasutra and the passage in Kalpasutra. Moreover, it is supported by a Jaina antiquity found at Mathura. Begins.-- fol. 1a -- jayai jagajIvajoNI / viANao jagagurU jagANaMdo / jaganAho jagabaMdho jayai jagapio mahAbhayavaM // 1 // fol. ra AbhiNibohiyanANaM / suyanANaM ceva ohinANaM ca / taha maNapajjavanANaM | kevalanANaM ca paMcamayaM // 1 // Ends.-- fol. 35b sanvesi pi nayANaM bahuvihavattatrayaM nisAmittA / taM savvAvasuddhA (ddhaM ) jaM caraNaguNaTTio sAhU // 94 // paccakkhANanijjuttI saMmattA // cha // samAptaM zrImadAvazyakaM // cha / saM0 1483 [8] varSe phA0 0 5 / so 0 Reference. Published along with Avasyakasutra and Haribhadra Suri's commentary Sisyahita in the Agamodaya Samiti Series, Nos. 1-4, and also in the same Series as Nos. 56 and 60 and in D. L. J. P. F. series as No. 85 where Malaya! giri Suri's commentary is given in 3 parts so far as available. See Weber II, p. 379fn. and 742ff., as well as Indian Antiquary vol. XXI, p. 329 ff. For additional Mss. see B. B. R. A. S. vols. III-IV, p. 400 and G. O. Series vol. XXI, pp. 13 and 33. I This passage is quoted by Darsanavijaya in his article " mathurAnI kaMkAlI TIlo published in Sri Jaina Satya Prakasa ane bhagavAna mahAvIranA jIvananA ye viziSTa prasaMgo (vol. II, Nos. 4-5, p. 180.) 2 Here the work is styled as raag of Bhadrabahu.

Page #412
1002. ] III. 4 Malasutras For the origin of the Botikas according to this Niryukti and Haribhadra's commentary see Z. D. M. G. vol. X L. p. 92ff. and for Avasyakasutraniryukti (IX) see W. Z. K. M. vol. V (?VI). For a learned discussion in German see Ubersicht uber die Avasyaka-Literatur" (pp. 22-31). cc In Jaina Sahitya Samsodhaka (vol. II, No. I, pp. 81-91), July 1923 we have an article in Gujarati entitled as pro. lyumana ane Avazyaka sUtra. Herein it is said that Prof. Leumann had commenced publishing in Abhandlungen fur die Kunde des Morgenlandes, his work Die Avashyaka Erzahlungen; but he let it go after about 50 pages were printed as he could not get the necessary Mss. of bhasya, curni, tika, etc. In 1894 he prepared a paper on Avasyaka and its literature to be read at the International Oriental Congress. This paper he has published in 50 pages. Herein he has first of all pointed out the place assigned to Avasyaka by the:Svetambaras and the Digambaras. This is followed by the summary of the nijjutti, some of the special features of the curni and those of Haribhadra Suri's tika on Avassayasutta, an exposition of Visesavassayabhasa, etc. In the end he has given photo-prints of some of the worn-out leaves of Silanka Suri's commentary on it. Some of the proofs of this publication seem to have been sent by the late Prof. Leumann to the late Dr. Bhandarkar. They are to be found in his collection at B. O. R. I. 375 After these remarks, Jinavijaya and K. P. Modi, the writers of this article have given from the above-mentioned publication the names of the 11 Ganadharas and mentioned their doubts and have reproduced quotations from the non-Jaina sources like the Upanisad etc. with their original sources where possible'.-a very praiseworthy attempt on the part of the late Prof. Leumann. For certain important statements in Gujarati see Siddhacakra (vol. IV, No. 12, pp. 284-288). I For this see Ubersicht uber die Avasyaka Literatur (pp. 37-38).

Page #413
376 Jaina Literature and Philosophy 1002. They are as under : 1) Out of the 10 niryuktis, Avasyakasutraniryukti is composed first. 2) It is more exhaustive than the rest, and that its Upodghataniryukti is recommended not only for the study of the remaining five adhyayanas of Avasyakasutra but even while studying the nityukti of other works. 3) Some of its gathas occur in some of the agamas. For instance 11/2 gathas are in Anuyogadvarasutra, and some gathas in Sthananga and Nandisutra, too. 4) The discussion about avadhijnana given in the Nandisutra reminds one of a corresponding topic dealt with in the Avasyakasutraniryukti. 5) It is the Avasyakasutraniryukti on which we have a number of commentaries, such as mulabhasya, the Visesa vasyakabhasya, curni and various other commentaries.' 6) Avasyakasutra and its Upodghataniryukti are unique in the sense that a separate treatise viz. Anuyogadvara is composed for explaining them. 7) There is a discussion as to why there are two mangalas in the Avasyakasutraniryukti, one by way of the gatha beginning with AbhinibohiyanANaM and one by way of the gatha commencing with titthayare bhagavaMte (Upodghataniryukti). A. M. Ghatage has made certain observations regarding the Niryuktis. He places the Avasyakasutraniryukti along with the Dasavaikalikaniryukti in the second group out of the three 2 in which he divides the collection of Niryukti I Cf. what is given on p. 15 of Ubersicht uber die Avasyaka-Literatur. 2 The first and the third groups are as under : The niryuktis on the first two angas come under the first group which contains "Niryuktis the text of which is preserved to us in a form which we can reasonably take to represent their original one free from later additions" (p. 270). "Ir the third group come the Niryuktis which are now called by the names of the Bhasyas and Brhad-Bhasyas like those on Nisitha and others where it is not now possible to separate the original Niryukti and the latter commentary ou it." (PP 270-71).

Page #414
1003.) iti. 4 Malasatras 377 works. He defines the second group as under :--- " The second group consists of those Niryuktis where verses of the so-called Mula-Bhasya are added to the original Niryukti either to explain it or to supplement it." - Vide his article " The Sutrakslanga-niryukti" (p. 270 ) published in "The Indian Historical Quarterly". vol. XII, No. 2 ( June 1936). In the end, I may mention that it is rather difficult to say for certain as to which sutras constitute the original Avasyakasutra. This Avasyakasutraniryukti can throw at least some light in this connection. For, herein we have sutrasparsikaniryukti which explains every word of the sutra or good many words of it. As such sutras, mention may be made of the following sutras :-- (1) Navakara, ( 2 ) Karemi bhante, ( 3 ) Logassa, (4) Suguruvandanasutra, (5) Tassa uttari, ( 6 ) Annattha and (7) the various Pratyakhyanasutras. The meaning of some of the gatbas of the Avasyakasutraniryukti seems to tally with the ineaning of some of the sutras. These sutras may be a part and parcel of the Avasyakasutra. As a specimen mention may be made of Cattarimangalam. For further discussion, the reader may refer to pp. 135-137. 83. AvazyakasUtraniyukti Avasyakasutraniryukti No. 1003 1872-73. Size.-- 104 in. by 43 in. Extent.--- 44 folios ; 15 lines to a page ; 68 letters to a line. Description.- Country paper thin, tough and whitish ; Deva nagari characters with JaaS; small, legible and good hand-writing ; borders ruled in four lines in black ink; red chalk used especially to mark the numbers for verses ;

Page #415
378 Jaina Literature and Philosophy frooz. yellow pigment rarely used ; edges of the first two foll. slightly damaged ; condition on the whole very good ; complete ; extent 2572 slokas; the contents may be rough ly indicated as under: therAvaliyA + peDhiyA foll. 1-30 cauvIsatthayAnijjutti fol. 266-270 paDhamAvaravariyA , 3*--64 baMdaNAnijjutti , 27-31 biiyAvaravariyA ,, 6-12 paDikkamaNanijjatti , 31-32 uvasagga ,, 12-14 jhANasaya , 324-34* samosaraNa ,, 14-15 pAriTrAvaNiyanijjutti(?), 34-360 gaNa.hara ,, I5-160 asajjhAyanijjatti , 36-38 sAmAyArI ,, 16deg 17deg | kAussagganijjutti , 38b-41 namokkAranitti , 17-26 paccakvANanijjutti , 41-440 Age.--- Not modern. Begins.-- fol. 18 jayai jagajIvo etc. Ends.- fol. 44 sanvesi pi etc., up to saMmattA as in No. 1002. This is followed by the line as under :-- cha / iti zrIAvazyakazrataskaMdhaH samAptaH // cha / graMthAnaM 2572 // cha / / N. B.- For additional information see No. 1002. AvazyakasUtraniyukti Avasyakasutraniryukti No. 1004 _1180.. 1886-92. Size. -- 12] in. by 4g in. Extent.- 43 folios ; 17 lines to a page ; 64 letters to a line. Description.- Country paper thin, brittle and greyish ; Devanagari characters with occasional gains; small, legible and good hand-writing ; borders ruled in four lines in black ink ; red chalk used ; white and yellow pigment, too ; foll. more or less worm-eaten ; strips of paper pasted to some of the foll. in the beginning ; some foll. torn almost in the middle%3

Page #416
9851 III. 4 Malasatras 379 condition fair ; marginal notes written at times ; complete ; extent 3550 slokas. Age.- Old. Begins.- fol. I jayai jagajIva etc. Ends.- fol. 43 savvesi pi etc., up to paccakkhANanijjuttI sammattA / / This is followed by the lines as under :etthaM puNa caubhaMgo asuddho u // 1 so guNa gahaNijjo sIsapasirasANa hou jaraNijjo sAhUNa ...re bhojjo niccaM ca AcAra harANajjA // 2 akkharamattA lihiUNa pagaraNamiNaM jaM pataM punna sAhaNa dhamma / teNa dhammeNa puNo samvo vi jaNo lahau mokkhaM // 4 / iti AvassayaM sammattaM / cha / cha / graMthAgraM 3550 sarvasaMkhyA / zubhaM etc. N. B.-- For further particulars see No. 1002. AvazyakasUtraniyukti Avasyakasutraniryukti No. 1005 257. 1883-84. Size. -- 10 in. by 44 in. Extent.-- 173 folios ; 9 lines to a page ; 25 letters to a line. Description.-- Country paper thin and greyish; Devanagari cha racters with pRSThamAtrAs; big, bold, legible and elegant handwriting: borders ruled in two pairs of lines in black ink; the space between the pairs coloured yellow; numbers, for foll. entered only once; a square-like design in the centre on unnumbered sides and two more in the margins in the case of the numbered ones ; fol. I decorated with a design ; otherwise blank; edges of the first fol. badly worn out ; edges of the 2nd fol. slightly damaged ; some of the foll. worm-eaten ; condition tolerably good; this Ms. contains therAvalI, peDhiyA etc.; yellow pigment used; complete.

Page #417
380 Jaina Literature and Philosophy [1005. Age.-- Samvat 1553. Begins.-- fol. 10 jayai jagajIva etc. Ends.--- fol. 173a savvesi pi etc. up to paccakkhANAnajjuttI as in No. 1002. This is followed by the lines as under:-- samAptA iti zrIAvazyakazrutaskaMdhaH samAptaH // cha / saMvat 1553 varSe vaizApazudi 1 some 'pattane' likhApitaM // cha // zrI uruvaMza'jJAtIyabhaNasAlI // cha / devacaMdrabhAryA ThakUputrabhaNasA pa ( ? ) maMDalikabhAryA manAIsatA // cha / bakAIpaThanArtha // cha / zubhaM etc. N. B.- For other details see No. 1002. AvazyakasUtraniyukti Avasyakasutraniryukti No. 1006 240. A. 1882-83. Size.-- 104 in. by 4 in. Extent.-- 34 folios ; 20 lines to a page ; 73 letters to a line. Description.--Country paper:very thin, smooth and greyish; Deva nagari characters with ears; small, quite clear and beautiful hand-writing ; borders ruled in three lines; out of them two are in blank ink and one in red ink ; a corner of the first fol. slightly worn out ; condition very good ; red chalk used ; fol. 34deg blank ; complete. Age.- Seems to be old. Begins.-- fol. 18 jayai jagajIvajoNI etc. as in No. 1002. Ends.-- fol 34 savvesi pi etc. up to saMmattAas in No. 1002. This is followed by cha / zubhaM bhavatu // miti bhadraM N. B.-- For other details see No. 1002.

Page #418
1008.] III. 4 Malasairas 384 AvazyakasUtraniyukti Avasyakasutraniryukti No. 1007 208. 1871-72. Size. -- 104 in. by 4.3 in. Extent.-63 folios; 15 lines to a page; so letters to a line. Description.- Country paper thin, rough and white; Devanagari characters with pRSTamAtrAs; small, legible, uniform and beautiful hand-writing ; borders ruled in three lines in red ink; foll. numbered in the right-hand margin ; the last fol. wrongly numbered as 64 ; it is really 63rd ; notes occasionally written in the margins; complete ; extent 3100 slokas; condition very good ; yellow pigment used ; fol. 63deg blank. Age.- Old. Begins.- tol. 1" 5 60 // 5 jayai jagajIvajoNIviyo(?yA)Nau jagaguru jagANaMdo / jaganAho jagabaMdha / jayai jagapiyAmaho bhayavaM / 2 Ends.- fol 63* samvesi pi nayANaM vahuvihavattavvayaM nisAmittA / taM savvanayavisuddhaM jaM caraNaguNaTio sAhU // 71 / / iti paJcakkhANanijjuttI sammattA // 6 // smaaptaa|| SaDvidhAvazyakaniyukti // cha / / iti graMthAnaM zloka 3100 // cha // yAdRzaM etc. up to doSo na dIyate 1 N. B.- For other details see No. 1002. AvazyakasUtraniyukti Avasyakasutraniryukti 771. No. 1008 1895-1902. Size.- 11| in. by 44 in Extent.-- 44 - 2 = 42 folios ; 17 lines to a page ; 75 letters to a line,

Page #419
282 Jaina Literature and Philosophy [1008. Description.--- Country paper thin and white ; Devanagari chara cters with garais; sufficiently big, bold, clear and good hand-writing ; borders ruled in four lines in black ink; red chalk used ; several foll. more or less worm-eaten ; foll. I and 2 lacking ; otherwise complete; edges of the foll. 3 to 6 slightly worn out'; condition on the whole good : 2700 gathas; extent 3375 slokas. Age.-- Samvat 1488. : Begins -- fol 3 vA vAsudevA ya / / 71 ' solasa rAyasahassA | sababaleNaM tu saMkalaNibaddha / acchaMti vAsudevaM / agaDataDaMmI ThiyaM saMtaM // 72 // etc. Ends -- fol 44 savesi pi etc ; up to sADU as in No 1007. This is followed by the lines as under - // 71 evaM 158 // cha iti paJcakkhANaM nAma chadraM ajjhayaNaM sammattaM / / iti paJcakkhANanijjuttI sammattA || AvassaganijjuttI sammattA / / gAthA 2700 zlokasaMkhyA 3375 // cha / // saMvat 1488 varSe mArgazIrSa vadi 11 ekAdazyAM gurau // zrI pIsala - nagare paM0 guNasamudragaNinA likhApitaM zrIAvazyaka saMpUrNa // cha // zubhaM bhavatu etc. N. B.- For further particulars see No. 1002. AvazyakasUtraniyukti Avasyakasutraniryukti No. 1009 157. 1871-72, Size.-- IIT in. by 48 in. Extent.-- 46 - 1-9 = 36 folios ; 17 lines to a page ; 60 letters to a line. Description.- Country paper thin, rough and greyish; Deva. nagari characters with EATIS ; small, legible and very fair ___hand-writing ; borders indifferently ruled in red ink ; red * 1 This portion occurs as a part of the 70th verse on p. 78a in the edition containing Malayagiri Suri's commentary on Avasyakasutra.

Page #420
'Toro.] III. 4 Mulasatras 383 chalk and yellow pigment used; numbers for foll. entered once only; unnumbered sides have a small disc in red colour in the centre, whereas the numbered, in each of the two margins, too; marginal notes seem to be added at times ; the first fol. as well foll. 37 to 45 lacking; otherwise pratically complete ; edges of several foll. slightly worn out; foll. 36 and 46 damaged probably on account of their having been exposed to fire; condition fair ; this Ms. commences practically with the 29th gatha of sthavirAvalI. Age.-- Samvat 1532. Begins -- fol 2 gunnaannN| vaMdAmi ajamaMguM sU(sa )yasAgarapAragaM dhIraM // 29 vaMdAmi ajjadhammaM vaMde tatto ya sadaguttaM ca / tatto ya ajjavairaM tavaniyamaguNehiM vairasamaM // 30 // etc. Ends. -- fol 464. sanvesi pi etc., up to saMmattA as in No. 1002. This is followed by the lines as under : cha // zrIAvazyakasUtraM samAptaM / / graMthAnaM 2550 anuSTupa graMthAnumAna 3150 / zubhaM bhavatu // cha / saMvat 1932 varSe jyeSThamAse caturdazIdine guruvAsare zrAvikArUpAI zrAvikA vAyU~ zrAvikA pUrI zrIAvazyakasUtra liSApitA / pravartinIrAjalakSmIupadezena // N. B.-- For additional information see No. 1002. AvazyakasUtraniyukti Avasyakasutraniryukti No. 1010 .85. 1872-73. Size.--- IOf in. by 48 in. Extent.-- 71 - I = 70 folios ; I3 lines to a page; 44 letters to a line. Description.- Country paper thin and white; Devanagari charact ers with pRSTamAtrAs; big, legible and elegant hand-writing; borders ruled in two pairs of lines in black ink; the space

Page #421
Jaina Literature and Philosophy [1010. between the pairs coloured red; unnumbered sides hvae a square-like desgin in the the centre whereas the numbered, in each of the two margins, too, in yellow colour; a strip of paper pasted to fol. 2"; foll. 6 and 65 to 71 slightly torn; condition on the whole good; white pigment used; red chalk at times only; the 1st fol. lacking; this Ms. contains poDhayA etc. up to jogasaMgaha and AsAyaNA complete plus some portion; thus it begins and ends abruptly. Age.- Pretty old. Begins -- fol 2a 384 Ends nANujjoyassa jae bhaI damasaMghasUrassa // 10 // This is the 10th gatha of four which is followed by aftur. fol 71b ( paratitthiya ) gahapahanAsagassa tavateyadittalesassa / sthavirAvalI (therAvalI ) AvAsayaM tu kAuM jiNovaiTuM guruvaeseNaM / tini thuI paDilehA kAlarasa vihI imA tattha || 56 // duviho ya hoi kAlo vAghAyama eyaro ya nAyavvA / The Ms. ends thus abruptly. N. B. For further particulars see No. 1002. a1a1e daaldize azui azazoi ar || * No. 1011 Size. 10 in. by 4 in. Sthaviravali (Theravalij) Extent.-- 46 folios; 17 lines to a page; 58 letters to a line. Description. Country paper very thin and greyish; Devanagari characters; small, legible and good hand-writing; borders thickly ruled singly in red ink; red chalk used; unnumbered sides have a small disc in red colour in the 273(a). A. 1882-83. 1 This is 1369th gatha of the Avasyakasutraniryukti according to the edition containing Haribhadra Suri's commentary.

Page #422
1011.) III. 4 Malasutras 385 centre; the numbered have two more, one in each of the two margins ; complete; some of the foll. somewhat wormeaten; condition unsatisfactory; this work is followed by the following constituents which practically make up Avasyakasutraniryukti. (1) pIThikA (peDhiyA) foll. Ib to 3. (2) prathamAvaravarikA (paDhamAvaravariyA ) foll. 34 to 64. (3) dvitIyAvaravarikA (biiyAvaravariyA) foll. 6 to 12. (4) 'upasarga (uvasagga) foll. 12 to I34. (5) gaNadhara (gaNahara ) foll. 139 to 164. (6) sAmAcArI (sAmAyArI) foll. 16 to 17. (7) upoddhAtaniyukti (uvagghAyanijjutti ) foll. 17 to 21b. (8) namaskAraniyukti (namukkAranijjatti) foll. 21 to 24. (9) sAmAyikaniyukti (sAmAiyanijjutti) foll. 24deg to 26. ( 10 ) caturviMzatistavaniyukti (cauvIsatthayanijjutti ) foll. 264 to 37. (11) vandananiyukti (vaMdaNanijjutti ) foll. 27deg to 30deg. (12) pratikramaNaniyukti ( paDikkamaNanijjutti ) foll. 30deg to 31'. (13) dhyAnazata (jhANasaya ) foll. 31deg to 33". . (14) pAriSThApanikAniyukti ( pAridvAvaNiyAnijjatti ) foll. 33deg to 36. (15) pratikramaNasaGgrahaNI ( paDikkamaNAsaMgahaNI ) foll. 360 to 37deg. (16) yogasaMgraha (jogasaMgaha) foll. 376 to 38. (17) AzAtanA (AsAyaNA) foll. 38 to 39*. ( 18 ) asvAdhyAyaniyukti ( asajjhAyanijjatti) foll. 394 to 41". (19) kAyotsarganiyukti ( kAussagganijjutti ) foll. 41 to 44'. ___ foll. 444 to.44. foll. 44deg to 45 .. () pratyAkhyAnaniyukti ( pacakhANAnijjatti ) foll. 45* to 46". Age.-~- Pretty old. * Author.--- Perhaps Devavacaka. Subject.-Some of the verses in Prakrit mentioning the names of several Sthaviras. 1 In the printed Catalogue we have Samavasrarana between Upasarga and Ganadhara.

Page #423
386 Begins.- fol. ra OM namo zrIjinAgamAya / jayai jagajIvajoNIviyANao jagagurU jagANaMdo / jaganAho jagabaMdhU jayai jagappiyAmaho bhayavaM // 1 // etc. fol. rb Jaina Literature and Philosophy Ends.--' fol. 1b dAma ajarakkhiyakhamaNe rakkhiyacarittasavasse / rayaNakaraMgabhUo aNuogo rakkhio jehiM // 32 // nANamidaMsaNaMmiya tatra viNae niJca kAlamujjuttaM / ajjA (? jja) naMdilakhamaNaM sirasA vaMde pasannamaNaM // 33 // 'ater' ist etc. This verse is not numbered as 34 but it is numbered as 10 and the succeeding ones are accordingly numbered as 11, 12 etc. pIThikA (per3hiyA ) No. 1012 Reference. - Published. See No. 1002. je ane bhagavaMte etc. up to bucchaM AbhiNibohiyanANaM suyanANaM ceva ohinANaM ca / taha maNapajjavanANaM kevalanANaM ca paMcama // 27 // therAvaliyA samattA [ 1011. Pitbika (Pedhiya ) Extent. fol. rb to fol. 34. Description.-- Complete. For other details see Sthaviravali No.111. Subject. -- 81 verses in Prakrit. 1. This is the 29th verse of Sthaviravali given in the beginning of Nandisutra. 2 This forms the very 1st verse of the Avasyakasutraniryukti commented upon by Malayagiri Suri, 273 (b ). A.1882-83.

Page #424
1013.] III. 4 Malasutras 387 Begins.- fol. 1. oggaha IhAbAo a dhAraNA eva hu~ti cattAri / AbhiNibohiyanANassa bheyavatthu samAseNaM // 1 // ' etc. Ends.- fol. 30 itthaM puNa ihagAro suyanANeNaM jao sueNaM tu / sesANamappaNA vi ya aNuoga paIvadiTuMto // 81 // ' paDhiyA saMmattA / / Reference.- Published. See No. 1002. pIThikA Pithika 1207. No. 1013 1887-91. Size.-- 104 in. by 44 in. Extent.--- 3 folios ; 14 lines to a page ; 44 letters to a line, Description.--Country paper thin, brittle and greyish ; Devanagari characters ; sufficiently big, clear and good hand-writing; borders ruled in four lines in black ink ; the space between the pairs coloured red ; foll. numbered in both the margins; unnumbered sides have a small disc in red colour, in the centre only whereas the numbered in ihe margins, too; complete ; edges of all the foll. slightly worn out ; condi tion tolerably good ; this Ms. contains 79 verses in all, Age.-- Pretty old. Begins.- fol. I OM namo vItarAgAya / / AbhiNibohiyanANaM suyanANaM ceva ohinANaM ca / taha maNapajjayanANaM kevalanANaM ca paMcamayaM // uggaho Iha avAo etc. as in No. 1012. 1-2 These two verses form and and 79th verses of the Avasyakasutraniryukti above referred to ( see p. 386).

Page #425
388 Jaina Literature and Philosophy [1913. Ends.- fol. 30 etthaM puNa ahigAro etc. up todidaMto as in No. 1012. This is followed by // 79 pIDhiyA saMmmattA / N.B.-For other details see No. 1012. pIThikAbAlAvabodha Pitbikabalavabodha - 1347 (b). No. 1014 1895-98. Extent.-- fol. 4* to fol. 134. Description.-- Complete ; composed in Samvat 1564. For other details see Sthaviravalivrtti with balavabodha No. 631, where this work is styled as AvazyakapIThikAvivaraNa (bAlAvabodha). Author.-- Samvegadeva Gani, pupil of Somasundara Suri of Tapa gaccha. Subject. ---Sanskrit and Gujarati explanations of the Pithika of Avasyakasutraniryukti. Begins.- fol. 4 zrIvarddhamAnajinanAyaka eSa satyaM / prAbhAtikaH kila sahazra(sa)karo vibhAti / / yadezitIrthakiraNaprasaraiH prkaashH| ... saMjAyate sakalakavastuvikAzadakSaH // 1 // zrIsomasuMdarayarUna bhaktyA / zrIratnazekharagurUMzca / zrImat 'tapAgaNeMdrAn / natvA zrutadevatAMzcaiva // 2 // zrImattadAvazyakasyAdau / pIThikA vivRNomyahaM / / / bAlAvabodharUpeNa / bahvArthamalpasUtrikAM // 3 // bhIbhadrabAhusvAmi / Avazyakanai dhuri maMgalIka bhaNI / paMca jJAna vikhANai AbhaNiyohiyanANaM / suyanANaM ceva ohinANaM c| taha maNapajjavanANaM kevalanANaM ca paMcamayaM // 1 // aa0|| prathama mAtijJAna | zrutajJAna 2'etc.

Page #426
TOIS.] III. 4 Malasairas . 389 Ends.- fol. 13 havai IhAM siddhAMtanai avasari | zrutajJAnanu adhikAra jANivu / jeha bhaNI zrutajJAnai karI / anerA savi huM jJAnanA anuyoga artha jaNAi / jeha bhaNI zrutajJAna ApaNuiM svarUpa prkaashi| anai anerA jJAnanuM svarUpa prakAzai / jima dIvau ApaNapuM(?) prakAzai / anai anerAi padArtha prakAza karai / iha pradIpanu dRSTAMta jANivU / jeha bhaNI zrutajJAna ApaNuMDa svarUpa prakAzai | anai anerA jJAnanuM svarUpa prakAzai / jima dIvau ApaNapuM prakAzai / anai anerAi padArtha prakAza karai / iha pradIpanu dRSTAMta jANivu | tima zrutajJAna jANivU / cha / zrIsomasuMdarayugottamasUriziSyaH / saMvegadevagaNiriMdratithi : ] 151(6)4 prame(5)bde / / Avazyakasya dhuri saMsthitapIThikAyA / ___ bAlAdhabodhamatanona( t) svapadArthasiddhayai / 1 / zrIAvazyakasya prathamapIThikAbAlAvabodhaH samarthitaH / zubhaM bhavatu // pIThikAbAlAvabodha Pithikabalavabodha No. 1015 - 1232. 1891-95. Size.-- 101 in. by s in. Extent:- I3 folios; II to 24 lines to page: 30 to 58 letters to a line. Description.-- Country paper thick, rough and white ; Devanagari characters; bold, small, clear and fair hand-writing; borders ruled in two lines in red ink ; red chalk used; foll 62 and 12 written in a very big hand; fol. 6a numbered as I also ; a yellow piece of paper of the same size as the fol. pasted to fol. 136; similar is the case with fol. 18; corners of the first two foll. slightly worn out; condition good; fol. 10% contains tabulated results; complete, Age.-- Samvat:1872.

Page #427
390 Jaina Literature and Philosophy Begins.-- fol. 1 zrIzAMtinAthAya namaH // zrIvarddhamAnA (na) jinanAyaka evaM satyaM (prA) bhAtikaH kila sahasrakaroti ? vibhAti ( ? ) kiraNa prasAraiH prakAzaH sa jAyateM sakalavastubI (vi) kAzadakSaH 1 zrI somasuMdaragurUna bhaktyA zrIratna se ( ze ) Sa ( kha ) ragurUMzva zrImat 'tapa' gaNeMdrAna natvA zrutadevatAM caiva 2 zrImadAvazyaka syAdA(do) pIThi (Thi ) kA ( kAM) vivRNomyahA ( haM ) bAlAvabodharUpeNa bahvArthAmalpasUtrikAM 3 etc. zrIbhadrabAhu svAmI zrI Avazyakane dhure pahelaM maMgalIka bhaNI pAMca jJAMna vaSANe che. AbhiNI (Ni) bohI (hi ) yanANaM0 AbhinIbodhIka jJAMna kahats etc. fol. 64 zrI zAMtinAthAya namaH bhavyAnAmupadesA (zA) ya mArge vacanakA kathyate tatra prathama jIva anAdi kAlano mithyAtvI hato te haveM kAlalabdhi pAmIneM traNya karNa kareM cheM etc. Ends. fol. 134 tIma zrutajJAMna ApaNuM e artha prakAse aneM anerA e jJAMnano'rtha prakAseM IsyUM jAMNa 80 'prathamAvara rikA ( paDhamAbavariyA) ko iti zrI somasuMdaraka (yu) gottamasUrISpISya saMvega devagaNInA grathItA graMtha ai zrI Avazyaka pIThIkAbAlAvabodha saMpUrNa saMvat 1872 nA varSe zrAvaNa zuda 7 gurau dine lIpItaM paM (0) nyAya sAgaragaNInA svAtmArthe 'mahIja'grAme zrIsAMtinAthaprasAdAt bhadraM bhavatu zreyaM. svAtmArthe(s) lekhi. N. B. -- For other details see No. 1014. No. 1016 [1015. Prathmavaravarika (Padhamavaravariya ) Extent.- fol. 34 to fol. 64. Description.-- Complete. For other details see No. 1011. 1 This is also styled as Laghuvaravarika See. p. 391. 273 (c). A. 1882-83

Page #428
S 1017.1 III. 4 Malasatras 391 Subject.- 178 verses in Prakrit forming : a part of the Avasyaka satraniryukti. Begins.- fol. 3 titthayare bhagavaMte aNuttaraparakkame amianANI / tinnesu gaigaigae siddhipahapaesae vaMde // 1 // etc.' Ends.-- fol. 6a timneva ya kohisayA aTTAsIyaM ca huMti koDIo | asiyaM ca sayasahassA evaM saMbacchare dinaM / / 178 // paDhamAvaravArayA sNmmttaa| Reference.- Published. See No. I002. prathamAvaravarikA. Prathamavaravarika bAlAvabodha balavabodha 1347 (0). No. 1017 1891-95. Extent.- fol. 13a to fol. 220. Description.-- Complete. For other details see No. 631. Subject.-- Prathamavaravarika here styled as Laghuvaravarika is explained in Sanskrit and at times in Gujarati. Begins.- fol. 13 titthayare / ahaM tIrthakarAn sadA vNde| kiMviziSTAn tIrtha karAn / bhagavataH pUjyAna / punaH kiM0 tIrtha / anuttaraparAkramAn / punaH kiM. tI0 / amitajJAninaH / punaH kiM tii| tIrNAn / punaH kiM tIrtha / sugatigatigatAn / punaH kiM tIrtha | siddhipradezakAn / 1 | etc. Ends. - fol. 22 tinneva ya0 / trINi koTizatAni | aSTAzItizatasahasrAH lakSAH / etatsaMvatsare dattaM / triNisaI koDi / aThiyAsI koDi / ahIsI lakSa / etalaDaM suvarNadAna / paramezvariI varasadivasiI dIdhauM // 82 // iti laghuvaravarikA saMpUrNA // zrIbrahmavADizrImahAvIrAya namaH / zrIrastu ra(asmAkaM // 1 Malayagiri Suri before commenting upon this verse says : "ttropoddhaatsyaadimglmaah|" 2 This is 242th verse in the edition containing Malayagiri Suri's commentary.

Page #429
392 Jaina Literature and Philosophy [ Ior8. 'dvitIyAvaravarikA Dvitiyavaravarika (biiyAvaravariyA) ( Biiyavaravariya) No. 1018 273 (d). A. 1882-83. Extent.-- fol. 64 to fol. I24. Description.-- Complete. For other details see No. 1011. Subject. This work also known as Vtddhavaravarika consists of 348 verses in Prakrit and forms a part of the Avasyakasutra niryukti. Begins.-- fol. 6a vIraM AreTunamiM pAsa maliM ca vAsupujjaM ca / ee muttUNa jiNe a. sesA Asi rAyANo // 1 // etc. Ends.-- fol. 122 bahiyAyanAyasaMDe ApucchittANa nAyae svvo| divase muhuttasese kumAraggAme samaNupatto // 348 // varavariyA biiyA saMmattA / Reference.- Published. See No. 1002. dvitIyAvaravarikA No. 1019 Dviti yavaravarika 306 (8). A. 1882-83. Size.--101 in. by 48 in. Extent.-- 48-6=42 folios ; 17 lines to a page ; 60 letters to a line. Description.- Country paper thin, rough and greyish ; Devanagari characters with pRSThamAtrAs; small, legible, uniform and good hand-writing ; borders indifferently ruled in red ink; red chalk used; foll. numbered in the right-hand margin; 1 2 This is also styled as Vrddhavaravarika. See p. 394. The letter & is gone as the corresponding portion is worn out.

Page #430
Ior.] III. 4. Malasatras. 393. 64 210 .. .this Ms. starts with the 7th fol.; fol. 48b_blank ; Dvitiyavaravarika ends on fol. 130; condition good; this Ms. contains the following 19 works in addition.-- (1) upasarga 70 verses foll. 136-145 (2) samavasaraNa 69 , , 14-16 (3) gaNadharAvalI - 80(:),, , 16-17*3 - (4) sAmAcArI , 174-18 (5) upoddhAtaniyukti 18b-22 (6) namaskAraniyukti . 220-25 (7) sAmAyikaniyukti ,, 254-26 (8) caturviMzatistavaniyukti 62 , ,, 266-28 (9) vandananiyukti 189 , ,, 284-31 (10) pratikramaNaniyukti ,, 31-32 (11) ArtadhyAna ____18 , fol. 320 (12) dhyAnazataka * 106 foll. 320-34 (13) pAriSTApanikAniyukti , 34-37 (14) pratikramaNaniyukti ,, 376-39 (15) yogasaGgraha 60 , ,, 39-40 (16) AzAtanA fol. 40 (17) asvAdhyAyaniyukti III , foll. 40*-42* (18) kAyotsarganiyukti I72 " , 42-45 " 44 (19) pratyAkhyAnaniyukti 21 verses plus a prose passage plus 90 verses , 459-48* Age.-Old. ... Begins.-- fol. ja ___ vIraM arihanemi pAsa etc. Ends..- fol. 13a bahiyA ya nAyasaMDe etc., up to samaNupatto as in No. To18. This is followed by // 48 biiyA varavariyA saMmattA // cha / / N. B.-- For additional information see No. 1018. 4 20 [I.L. P.1

Page #431
394 Jaina Literature and Philosophy [1020. dvitIyAvaravarikA. Dvitiyavaravarika dIpikA dipika No. 1020 1347 (d). 1891-95. Extent.-- fol. 22s to fol. 324. Description.- Complete. For other details see No. 631. Author.-- Not mentioned. Subject.- A Sanskrit explanation of Dvitiyavaravarika. Begins.- fol. 22* vIraM ariTTanemiH // vIraM zrIvarddhamAnaM 1 ariSTanemi 2 pArzva 3 mAlliM 4 cAnyadvAsupUjyaM 5 / etAn jinAn / muktvA / avizeSA jinAH rAjAnaH Asan // 1 / rAyakule suSijAyA ete paMcApi jinavarAH / rAjakuleSvapi jAtAH / paraM kumAravAse( 5)pi pravrajitAH / kiMviziSTeSu rAja kuleSu / vizuddhavaMzeSu / etc. , - fol 3t' iti bhagavatokte / tvayA mAraNAMtikopasargo rakSaNIyaH / ityuktipUrva siddhArtha vyaMtaraM / bhagavatpAce muktvA / zako jagAma prAtaH kollAgasaMni veze / SaSThapAraNake / bahalavipreNa | pAyasaM kSIrAnaM dataM / tatra devairvasudhArA kRtA suvarNadhArA | paMca divyAni jAtAni / 60 / iti zrIbRhadaravarikAyAH dIpikA saMpUrNaH / zrIrastu / asyA varavarikAyAM kSepakagAthA 14 vRttyAdiSvapi na vyaakhyaataa| sA ca / Auha parasA / vyAkhyA / bharatazcakrI prAcyA mAgadhaM 1 etc. Ends.- fol. 32 trizalAkakSiH 27 zeSA aspaSTatayoktA bhavAH aMtargaNyA na / saMsArazabdena ekeMdriyaH vikaleMdriyatvAptireva jJeyAH / na ca vAcyaM / devAnaMdA. vakSiAsthitiH kathaM bhavanvena gaNyate / samavAyAMge uktatvAt / 74 / iti vRddhavaravarikAyAH sAroddhAro likhito'sti // cha /

Page #432
1022.] III. 4 Malasatras 395 upasarga Upasarga (uvasagga) (Uvasagga) No. 1021 273 (0). A. 1882-83. Extent.- fol. 124 to fol. 13. Description.- Complete. For other details see No. 1011. Subject. -- 70 verses in Prakrit forming a part of the Avasyakasutra niryukti throw light on terrible hardships undergone by ___Lord Mahavira. Begins.- fol. 12 govanimittaM sakkassa Agamo vAgarei deviMdo kullAgabahula chaTussa pAraNe payasavasuhA' // 1 // etc. Ends.-- fol. 130 abhiya bahi ujjuvAliyatIraviyAtha(? va )tta sAmasAla ahe / chadreNukkaDuyassa ouppanaM kevalaM nANaM // 70 // upasargA saMmattA // cha / Reference.- Published. See No. 1002. Upasarga upasarga No. 1022 306 (b). A. 1882-83. Extent.- fol. Ib to fol. 14. Description.- Complete. For other details see No. 1019. Begins.-fol. 13 govanimitaM sakkassa etc. Ends.- fol. r4 jabhiya bahi etc. up to kevalaM nANaM // 70 as in No. 1021. This is followed by upasargAH samAptAH // N. B.- For further particulars see No. 1021. 1 One letter is gone, as the corresponding portion is worm-eaten. 2 This verse occurs as 525th on p. 298b in the edition containing Malayagiri Sari's commentary on Avasyakasutra.

Page #433
396 upasargavyAkhyA No. 1023 Jaina Literature and Philosophy Extent. - fol. 324 to fol. 360. Description.-- Complete. For other details see No. 631. Subject. Explanation in Sanskrit of Upasarga. Begins. - fol. 324 zrIvIreNa dIkSA gRhItA / yairupasargaiH soDhaiH / kevalajJAnamutpannaM / vicAro likhyate / bahiyA ya0 / 1 / sa bhagavAn 'kSatriyakuMDa' grAmAda- bahiH jJAtakhaMDavane / sarvAn jJAtakAn ApRcchraya muktalApya / muhUrtazeSe / divase sati 'kumAragrAma' manuprAptaH | 1 | etc. Begins. fol. 13b Ends.--fol. 360 'jRMbhikA'grAmAd bahiH 'RjuvAlikA' nadItIre / vaiyAvacaM / caityatvAda vyAvRttaM patitacaityamityarthaH / tasyAsanne zyAmAkagRhapatikSetre / sAlataroradhaH SaSTatapasotkaTikAsthasya : kevalamutpede / 69 iti zrIAvazyakadIpikAnusAreNa | zrI vIropasargavicAro'lekhi | cha / gaNadharAvalI gaNaharAvalI) No. 1024 Extent. fol. 13 to fol. 16a. Description.-- Complete. For other details see No. Tor I. Subject. These 158 verses in Prakrit form a part of Avasyakasutraniryukti and deal with episodes pertaining to the Ganadharas of Lord Mahavira. rand [1023. Upasargavyakhya 1347 (e). 1891-95. 1 Ibid., p. 298b, v. 529. jo ya tavo aNucino vIravareNaM mahANubhAveNaM / chaumatthakAliyAe ahakkamaM kittaissAmi // 1 // etc. I Ganadharavali (Ganaharavali ) 273 ( f ). A. 1882-83.

Page #434
Yo25.1 - fol. ryb Ends. fol. 162 III. 4. Malasatras chinaMmi saMsayaMmI jiNeNa jaramaraNAvapyamukkeNa / so samaNo pavvaio saha khaMDisaehiM // 133 // gaNadharA saMmattA / 1 arihaMte vaMdittA caudasaputhvI taheva dasavI / ikkArasaMga suttatthadhArae savva sAhUya / 158 ittha e o (gha) nijjutI vaktavvA || gaNadharavaktavyatA samAptA / Reference.- Published. See No. 1002. gaNadharAvalI No. 1025 Extent.- fol. 164 to fol. 174. (Description. - Complete. For other details see No. rorg. Begins.-- fol. 16(c) taM divvadevaghai etc. Ends.- fol. 17a arahaMte vaMditA caudasaputhvI taheva dasaputhvI / ikArasaMga suttatthadhArae sabbasAhU ya // 79 // itthaMtare oghanijjuttI bhaNivvA // cha // 5 // N. B. -- For further Details see No. 1024. gaNadharAvalyavacUri No. 1026 Extent. fol. 404 to fol. 420. Ibid., p. 337b, v. 641. 397 Ganadharavali 306 (d). A. 1882-83. Ganadharavalyavacuri 1347 (g) 1891-95.

Page #435
398 Jaina Literature and Philosophy (1026. Description. This Ms. contains mostly the states of Ganadhara. vali. For other details see No. 631. Subject.-Ganadhara explained in Sanskrit in short. Begins- fol. 40 taM divvadevaghosa / souNaM mAhaNA tahiM tadA / aho jannieNa jaTuM / devA kira AgayA ihayaM / 1 / / tatra madhyamApApAyAM / mAnuSA divyaM pradhAnaM / taM devAnAM vrajatAmAgacchatAM ca ghoSaM zabdaM zrutvA / tuSTA hRSTA / ekamavocat / aho iti Azcarye / yAjJikena juSTaM yAgaH prArabdhaH etc. Ends.- fol. 42 dazadhA sAmAcArI icchAmicchetyAdi kathayiSyate / padavibhAga sAmAcArI navamapUrve / / 24 / gaNaharA samattA // arihaMte vaMdittA / eSA gAthA oghaniyuktirAdimA / atraughaniyuktirvaktavyA / iti gaNadharAvalyA'vacUriH chH|| samavasaraNa Samavasarana (samosaraNa) (Samosarana) 306 (0). No. 1027 A.1882-83. Extent.-- fol. 145 to fol. 16*. Description.-- Complete. For other details see No. 1019. Begins.-- fol. 146 jo u tavo aNucinno etc. Ends.-- fol. 162 saMkhAIe vi bhave sAhaija vA puro ya pucchijjaa| na uNaM aNAisesI biyANaI esa chaumattho // 69 // samavasaraNaM saMmattaM // cha / Reference.- Published. See No. 1002. 1 Ibid., p. 31nb, v. 592. 2 Ibid., P. 3ra, V.590.

Page #436
1029. ] " samavasaraNa avacUrisahita No. 1028 Extent, fol. 36b to fol. 40. Description. Both the text and the commentary complete. For other details see No. 631. Subject. Samavasarana together with its explanation in Sanskrit. Begins. -- ( text ) fol. 36b jo a tavo aNucinno / vIravareNaM mahANubhAveNaM / chatthakAliyAe / ahakkramaM kittaissAmi / 1 / Ends.- ( text ) fol. 40 "" III. 4 Malasutras 1 - (com) fol. 36b varivareNa brahmasthalakAle / yattapo'nucIrNa AsevitaM / kiMlakSaNena vIravareNa / mahAnubhAvena / mahAprabhAvamu (yu)ktena / tattapo yathAkramaM kIrttayiSyAmi / 1 / etc. Samavasarana with avacuri 1347 (f) * 1891-95, 399 saMkhAIe vibhave sAhai jaM vA paro u pucchijjA / na yaNaM aNAisesI biyANai esa chaumattho / ( 69 ) // sAmAcArI ( sAmAyArI ) No. 1029 Extent. fol. 16 to fol. 17. Description.--Complete. For other details see No. IoII. See p. 396. ~ ( com. ) fol. 40 vA athavA paro'nyo yat pRcchati / tatsarvaM kathayati / atizaya avadhyAdyatizayarahitaH sAdhuH enaM gaNadhAriNaM eSa chadmastha iti na vijAnAti | 69 / iti samavasaraNasyAvacUriH // Samacari (Samayari ) 273 (g). A. 1882-83.

Page #437
400 Jaina Literature and Philosophy [ 1090 Subject. These 64 verses in Prakrit form a part of Avasyakasutra niryukti. Begins.- fol. 16a icchA micchAta hakkAro AvassiyA ya nisIhiyA / ApucchaNA ya paDipucchA chaMdaNA ya nimaMtaNA // 1 // Ends.-- fol. 170 evaM sAmAyAriM jujaMtA crnnkrnnmaauttaa| sAhU khavaMti kammaM aNegabhavasaMciyamaNataM / / 64 // sAmAyArI smttaa| Reference:- Published. See No. 1002. sAmAcArI Samacari 306 (e). No. 1030 A. 1882-83. Extent.- fol. 17s to fol. 18deg. Description.- Complete. For other details see No. 1019. Begins.- fol. 172 icchA micchA tahakAro etc. Ends.-fol. 18b eyaM sAmAyAriM etc. up to saMciyamaNataM // 64 // sAmAyArI saMmattA // ch|| N. B.-- For further particulars see No. 1029.

Page #438
103r.] III.4Malasutras 401 sAmAcArI Samacari dIpikAsahita with Dipika No. 1031 1347 (h). 1891-95. Extent.- fol. 420 to fol. 45". Description.-- Both the text and the commentary complete. For other details see No. 631. Subject.- Samacari along with its explanation in Sanskrit. Begins.- ( text ) fol. 420 icchA 1 micchA 2 tahakkAro 3 AvAssiA ya 4 nisIhiyA 5 / ApucchaNA ya paDipucchA 7 / chaMdaNA ya 8 / nimaMtra(ta)NA Ne / 1 / ' upasaMpadA 10 ya kAle 10 sAmAyArI bhave dasavihA u / etc. ,, - ( com.) fol. 42deg atha dazadhA sAmAcArImAha | ( com.) fol. 42 icchAkAra(:) 1 mithyAkAraH 2 tathAkAraH etc. sAdhuSu evaM sAmAcArI | dazavidhaiva syAt / eteSAM padAnAM pratyekaM prarUpaNAM vakSye / 2 etc. Ends.- (text) fol. 43 evaM sAmAyAriM / jujutA crnnkrnnmaauttaa| sAhU khavaMti kammaM / aNegabhavasAMcaamaNataM / ' ,, - (com.) fol. 45 sAdhavaH enAM sAmAcArI jujutAnAM samAcaraMto aneka bhavasaMcitaM karma kSipayaMti / kiMvi0 karma / anaMta anaMtabhavopArjitaM / kivi0 saadhvH| caraNakaraNoyuktAH / crnnsptnyaaN| karaNasaptatyAM udyuktA udyamavaMtaH / 64 / iti sAmAcArIdIpikA smaaptaaH|| 1 This is 667th gatla of the niryukti according to the edition containing Malayagiri Suri's commentary: 2 bid., gatha 723. I [].L.P.]

Page #439
402 : Jaina Literature and Philosophy [ 1032. upodghAtaniyukti Upodghataniryukti (uvagyAyanijjatti) ( Uvagghayanijjutti ) No. 1032 273 (h). A. 1882-83. Extent.- fol. 17deg to fol. 21b. Description.-Complete; the verses 78 and 79 rumbered on fol. 194 as 48 and 89 through oversight. For other details see No. I0I. Subject.-- These 216 verses in Prakrit form a part of Avasyakasutra niryukti. Begins. -- fol. 176 ajjhavasANa nimitte AhAre veyaNA parAghAe / phAse ANApANu sattavihaM jhijjhae AuM // 1 // ' Ends.- fol. 21 paJcakkhe (iva) daNaM jIvAjIve ya punapAvaM ca / paJcakkhAyA jogA sAvajjA tealisaeNaM // 16. (216) / upodghAtaniyuktiH smaaptaa| Reference.-- Published. See No. 1002. upodghAtaniyukti Upodghataniryukti No. 1033 306 (f). A. 1882-83. Extent.- fol. 18 to fol. 22. Description.-- Complete. For other details see No. 1019. Begins. -- fol. 18 ajjhavasANa nimitta etc. 1 This is 724th gatha of the niryukti according to the edition containing Malayagiri Suri's commentary. 2 Ibid., gatha 877.

Page #440
1034.) 111. 4 Malasatras 403 Ends. fol. 226 #F# (FT) au etc. up to Ficar dorsagol. as in No. 1032. This is followed by the line as under 21deg upodhAtaniyuktiH // cha / / N. B. -- For further particulars see No. 1032. Upodghataniryukti upodghAtaniyukti No. 1034 615 ( a ). 1884-86. Size. -- 102 in. by 3 in. Extent.-- 20 folios ; 14 lines to a page ; 48 letters to a line. Description.- Country paper thin, rough and white; Devanagari characters with gaEIS ; small, uniform, quite legible and elegant hand-writing; borders ruled in four lines in black ink; red chalk used ; foll i to 25 missing; foll. numbered twice in the right-hand margin only: once as 26, 27 etc., and once as 74, 75 etc.; fol. 29th torn; edges of some of the foll. slightly worn out ; condition tolerably good; Buenafayi@t ends on fol. 296; then we have the following works in addition: ( 1 ) Farah No. 1038 foll. 296 to 336 (2) Friteuriet ,,1042 , 3;b ,, 378 (3) Toatfiutavgift ,, 1046 , 370 4024 ( 4 ) quillin ,, Ioso , 40deg (5) AUTISET >> 1054 * 446 (6) HUHTI ,,1057 >> 450. This last work ends abruptly. Age.- Pretty old. 1 Foll. 386 and 392 do not seem to be interconnected.

Page #441
404 faini Literature and Philosophy tos Begins. -- ( abruptly) fol. 26" lakappA nayarI mittasirI kUrapiuDAI // 29 // codA(isa) do vAsasayA taiyA siddhiM gayassa vIrassa / adya(va)ttagANa diTTI seyaviyAe samuppannA // 30 // etc. Ends.-- fol. 296 paJcakarave daNaM etc. up to teyalisueNaM as in No. 1032, This is followed by 77 // cha // 277 upodghAtaniyuktiH smaaptaa|| ch|| N. B.- For additional information see No. 1032. upodghAtaniyukti Upodghataniryukti vyAkhyAsahita with vyakhya 1347(i). No. 1035 1891-95. Extent.---- fol. 45b to fol. 614. Description.- Both the text and the commentary complete. For other details see No. 6;6. Author of the vyakhya.- Ksamaratna Suri. Subject.-- Upodghataniryukti with vyakhya in Sanskrit. Begins.- ( text ) fol. 45" ajjhavasANa 1 nimitta 2 AhAre veyaNA parAghAe / phAse ANApANu(pU) sattavihaM jhijjhae Au // 1 // etc. , ---(com.) lol. 45" gaNadharAvalyAM / dabbe addha ahAUya / asyAM gAthAyAM dravyakAla 1 / addhAkAla 2 / yathAyuSkakAla 3 / etat dvAratrayaM vyAkhyAtaM / tathopakramakAladvAre | duvihovkkmkaalo| asyAM gAthAyAM / caturthopakrama kAladvAra / sAmAcAryupakramakAlatrividho(5)pi vyAkhyAtaH / etc. Ends.--- (text) fol. 60deg paJcakkhe iva dadraM jIvAjIve ya puNNapAve ya / paccakkhAyA jogA sAvajA tetalisaeNaM / / ( 213?) 1 See page (06a of the edition referred to on p. 403.

Page #442
1037] III. 4. Malasatras 10 Ends. . ( com. ) fol. 612 iti tetaliputrakathA samAptAH // atha gAthArthaH / tetalisutena maMtriNA jIvAnajIvAn / puNyaM pApaM ca pramukhAni nava tatvAni / pUrvabhavazrutajJAnena etAn padArthAn pratyakSAna dRSTvA sAvadyA yogAH sAvadyavyApArA pratyAkhyAtAH tyaktAH / / 214 / uddese nidesedeg gAthAdvayadvArANi vyAkhyAtAni / upoddhAtaniyuktiH samUtrA vyAkhyAnasahitA likhitA // zrIrastu / zrIkSamAratnavAribhiH kRtA // namaskAraniyukti Namaskaraniryukti (namokkAranijjutti) (Namokkaranijjutti) 273(i). No. 1036 A. 1882-83. Extent.- fol. 21 to fol. 24. Description.-- Complete. For other details see No. 1011, Subject.-- These 144 verses in: Prakrit form a part of Avasyaka sutraniryukti. Begins.-- fol. 21b uppattI nikkhevo payaM payattho parUvaNA vatthU / akveva pasiddhi kamo paoyaNa phalaM namukkAro // 1 // Ends.--- fol. 242 ihalogami tidaMDI sAdivvaM mAuliMgavaNameva / paraloicaMDapiMgala huMDI jakkho ya diTuMtA // 144 // Reference. - Published. See No. 1002. namaskAraniyukti Namaskaranirynkti No. 1037 306 (8). A. 1882-83. Extent.-- fol. 220 to fol. 254. Description.-- Complete. For other details see No. 1019. This is 887th gatha according to the edition containing Malayagiri Suri's commentary. 2 Ibid.; gatha 1025.

Page #443
406 Begins. fol. 22b Ends. fol. 25a namaskAra niyukti No. 1038 uppattI nikdal etc. ilagaMmatidaMDI etc. up to diTTaMtA as in No. 1036. This is followed by // 39 (139) namaskAra niyuktiH // cha // N. B.-- For further particulars see No. 1036. Jaina Literature and Philosophy Extent. fol. 29b to fol. 33. Description. Complete. For other details see No. 1034. Begins. fol. 29b Ends.- fol. 33b No. 1039 uppattI nikkhebo etc. namaskAraniryuktivyAkhyA if etc. up to fagar as in No. 1036. This is followed by 45 // cha // namokkAranijjuttI sammattA // cha // N. B. For other details see No. 1036. [ 1037. Namaskaraniryukti 615 (b). 1884-86. Namaskaraniryuktivyakhya Extent. fol. 61a to fol. 70a. Description. This Ms. contains the safes of Namaskaraniryukti. Complete. For other details see No. 631. Subject. Namaskaraniryukti explained in Sanskrit. Begins.-- fol. 612 uppattI 0 | namaskArasyotpattirvAcyA 1 / nikSepo nAmAdivicAraH 2 padaM padArtha 4 prarUpaNA 5 vastu 6 AkSepaH ziSyapraznaH 7 prazi 1347 (j). 1891-95.

Page #444
10.40.] III. 4. Malasatras 407 (si)ddhiruttaraM 8 kramaH 9 prayojanaM 10 phalaM 11 / etairekAdazabhirainamaskAro vyaakhyeyH||1|| etc. Ends.--- fol. 70deg cauro mRtH| namaskAraprabhAvAt yakSo devavizeSo'jani / A rakSakaistvaM cauryakAraka iti caurikAya / zUlikAyA utkSipya / jinadAse kSipyamANe / devIbhUtahuMDakena / puropari zilAM vikuLa / rAjAnaM bhApayitvA / jinadAso mocitaH / gajamAropya rAjJA pure / prAvezito mahena / namaskAra prabhAvopari / ete paMca dRSTAMtAH 5 // iti dRSTAMtaH / / zrIrastu / / sAmAyikaniyukti Samayikaniryukti (sAmAiyanijjutti) ( Samaiya nijjutti) 273 (5). No. 1040 A. 1882-83. Extent.- fol. 244 to fol. 264. Description.-- Complete. For other details see No. TOIL. Subject. --These III verses in Prakrit form a part of Avasyakasutra niryukti. Begins.- fol. 24 naMdia(?ma)NuogadAraM vihivaduvagyAiyaM ca nAUNaM / kAUNa paMcamaMgalamAraMbho hoi suttassa // 1 // Ends.- fol. 264 savvesi pi nayANaM bahuvihavattavvayaM nisAmittA / taM samvanayavisuddhaM caraNaguNaTrio sAhU // 11(111) / ' sAmAiyanijjuttI smaaptaa| Reference.- Published. See No. 1002. 1 2 This is 1026 gatha according to the cdition referred to on p. 4os, Ibid., gatha 1067.

Page #445
408 Jaina Literature and Philosophy [ I04I. sAmAyikaniyukti Samayikaniryukti 306 (h). No. 1041 A. 1882-83. Extent.-- fol. 25 to fol. 26". Description.- Complete. For further details see No. 1019. Begins.- fol. 25. naMdimaNuogadAra etc. Ends.--tol. 26 saJcesi pi nayANaM etc. up to sAha || as in No. 1040. This is followed by 100 sAmAiyanijuttI / cha / / N. B.-- For other particulars see No. 1040. sAmAyikaniyukti Samayikaniryukti 615 (0). No. 1042 1884-86. Extent.--- fol. 33deg to fol. 37*. Description.--- Complete. 146+3 = 149 verscs. For further details _see No. 1034. Begins.-- fol. 336 naMdimaNuogadAraM etc. Ends.-- fol. 37. vijjAcaraNanaesu sesasamoyAraNaM tu kAyavvaM / sAmAiyanijjuttI subhAsiyatthA parisamattA // 146 // cha / / nAyami giNihaanve agihiyagvAmi ceva atthaMmi / jaiyatvameva ii jo ubaeso so nao nAma // 1 // sanvesi pi nayANa etc. up to sAhU // 2 // Then we have :esA cattAlasaeNa samattA suttapphAsiyanijjuttI / gAhANa parisamattaM taheva sAmAiyajjhayaNaM / N. B.-- For additional information see No. 104',

Page #446
1044.] 11. 4 Malasatras 409 T sAmAyikaniyuktyavacUri Samayikaniryuktyavacuri No. 1043 __1347 (k). 1891-95. Extent.-- fol. 70 to fol. 75". Description.-- This Ms. contains tales of Samayikaniryukti; com ____plete. For other details see No. 631. Subject. - Samayikaniryukti explained in Sanskrit. Begins.- fol. 70 naMdimaNuogadAraM0 / naMdi anuyogadvAraM / vidhivadupodghAtikaM ca jJAtvA / paMcamaMgalaM ca kRtvA / sUtrasya AraMbho bhavati // 1 // athavA kaya paMca / kRtapaMcanamaskAraH sAmAyikaM karoti / etc. Ends.- fol. 75 nAyami0 / gRhItavye arthe jJAte eva / agRhItavye artha jJAte evaM / yatitavyaM bhavati | iti yaH updeshH| nAma iti komalAmaMtraNe / sa jJAnanayo bhavati / gRhItavye arthe jJAte sati / agRhItavye arthe jJAte sati / yatitavyameva / iti yaH upadezaH nAma iti komalAmaMtraNe / sa cAritranayo bhavati / 100 samvesiM0 / sarveSAmapi nayAnAM / bahuvidhavaktavyatAM nizamya / tatsarvanayAvazuddhaM bhavati / tatkiM / yaccaraNaguNasthitaH sAdhuH / tatsarva navizuddhaM // 101 / iti saamaayikniyuktrvcuuriH|| caturviMzatistavaniyukti Caturvirsatistavanir yukti ( cauvIsatthayanijjutti) ( Cauvisatthayanijjutti) 273(R). No. 1044 A1882-83. Extent.- fol. 264 to fol. 27deg. Description.- Complete. For other details see No. IOIT. Subject.- These 6r verses in Prakrit form a part of the Avasyaka sutraniryukti. Begins.- fol. 264 cauvIsagatthayassa u nikkhevo hoI nAmanipphana / cauvasigassa chakko thayassa (u) caukkao hoi // 1 // ' etc. 1 This is 1068th gatha rccording to the edition containing Malayagiri Suri's coiny.entary.

Page #447
410 Jaina Literature and Philosophy [ 1044. Ends.- fol. 27 caMdAiJcagahANaM pabhA payAsei parimiyaM khilaM / kevaliya(nANa)laMbho logAlogaM payAsei // 61 // cuviistthynijjuttii| Reference. - Published. See No. 1002. caturviMzatistavaniyukti Caturvimsatista vaniryukti 306 (i). No. 1045 A. 1882-83. Extent.- fol. 26deg to fol. 284. Description. Complete. For other details see No. 1019. Begins.-- fol. 266 cauvIsagatyayassa etc. as in No. 1044. Ends.- fol. 28 caMdAicagahANaM etc., up to payAsei / / as in No. 1041. This is followed by the line as under : 62 cauvIsatthayanijjuttI // cha / N. B.- For further particulars see No. 1044. caturvizatistavaniyukti Caturvimsatistavaniryukti No.1046 615 (d). 1884-86. Extent.-- fol. 37 to fol. 40deg. Description.- Complete. For further details see No. 1034. Begins.- fol. 370 cauvIsagatthayasta etc. as in No. 1044. I This is 1102th gatha according to the edition of Avasyakasatra containing Haribhadra Suri's commentary.

Page #448
411 1047.] III. 4 Malasutras Ends.- fol. 40 caMdAiccagahANaM etc., up to payAsei || as in No. 1044. This is followed by S and the lines as under : cauvIsatthagayassa u vi(bi)tiyajjhayassa esa nijuttii| gAhaggeNa samattA puMnAe paMcasaTTIe // 70 cauvIsasthayajjhayaNaM sammattaM / / cha // N. B.- For additional details see No. 1044. caturviMzatistavaniyukti CaturvimsatistavaniryuktidIpikA dipika No. 1047 1347 (1). 1891-95. Extent.- fol. 75" to fol. 78'. Description.- This Ms. contains gatimes of Caturvimsatistavaniryu __kti. Complete. For other details see No. 631. Subject.- Caturvimsatistavaniryukti explained in Sanskrit. Begins.- fol. 75deg cauvIsagatthaya / caturviMzataH ca anyat / stavasya dvayoH padayoH nAmaniSpanno nikSepo bhavati / dvAbhyA(bhyAM) padAbhyAMzcaturvizatistava iti nAmaniSpannaM syAdityarthaH / caturviMzateH SaTko padaprakAro nikSepo bhavati / stavasya catuSkazcatuHprakAro nikSepaH syAt / 1 / etc. Ends.-- fol. 78deg asminnanAnupUrvIpAThe caturviMzatistavena / samyakRtvazuddhirabhihitA / sA ca samyaktvazuddhirzaNavatAM sAdhUnAM pratipattyA labhyate / tato guNavatsApratipattyartha vaMdanakaM kriyate / anena saMbaMdhenAyAtaM vaMdanakaM tRtIyAdhyayanaM / tasya niyuktiH kriyate / iti caturviMzatistavasya dIpikAH / samAptAH // chaH // zrI

Page #449
412. Jaina Literature and Philosophy [1048. vandananiyukti Vandananiryukti ( vaMdaNanijjutti) ( Vandananijjutti) 273 (1). No. 1048. A. 1882-83. Extent.- fol. 274 to fol. 30'. Description. Complete though this work seems to start with the latter portion of the second verse. For other details see No. IOLI. Subject.- These verses in Prakrit forin a part of Avasyakasutra niryukti. Cf. the last verse of Simiyari. Begins.- fol. 274 baMdaNaciikiikama pUAkaMmaM ca viNayakamaM ca // 2 etc. Ends.--- fol. 300 eyaM kiikamavihiM jujaMtA caraNakaraNamAuttA / sAhU khavaMti kaMmaM aNegabhavasaMciyamaNataM // 190 / .. vaMdaNAnijjuttI / gA. 1659 3 Reference.- Published. See No. 1002. vandananiyukti Vandananiryukti No. 1049 306 (5). A. 1882-83. Extent.-- fol. 28a to fol. 31". Description.- Complete. For further details see No. 1019. Begins, -- fol. 28 * vaMdaNaciikiikammaM etc. Ends,-- fol. 31b - eyaM kiikammavihiM etc., up to saMciyamaNaMtaM // as in No. 1048. This is followed by the live as under :- . 89 (189) vaMdaNanijjuttI saMmattA // cha / N. B.--- For additional information see No. 1048. 1 2 3 Ibid., gatha 1103. Ibid., gatha 1230. This seems to be the extent up to this work and not that of this work only.

Page #450
1051.] vandananiyukti No. 1050 111. 4 Malasutras Extent.-- fol. 402 to fol. 44b. Description.- Complete. For further details see No. 1034. Begins.-- fol. 404 Ends.-. fol. 44b crashesari etc. evaM kaikammavihiM ctc., up to saMciyamaNaMtaM / 96 / vaMdaNInajjattI sammattA // cha // N. B. For additional particulars see No. 1048. Vandananiryukti 615 (e). 1884-86. 413 vandananiyuktidIpikA No. 1051 Extent. fol. 78b to fol. 850. Description. Herein we find as of Vandananiryukti. Complete. For other details see No. 631. Vandananiryuktidipika 1347 (in). 1891-95. Subject.-- Vandananiryukti explained in Sanskrit. Begins. fol. 788 atha vaMdanAdhyayanasya dIpikA likhyate / vaMdanagAthA | 1 | kaigAthA | 2 | vaMdana karmma 1 citikarma 2 kRtika 3 pUjAkarma 4 vinayakarma 5 / etAni paMca nAmAni vaMdanakastha bhavaMti / etc. Ends. -- fol. 85 gururAha / jaha0 / he ziSya yathA dUto / rAjAnaM natvA / kArya nivedya | pazvAdvisarjito ( s)pi baMdate / sAdhurapi evameva / prathamavaMdanake / kSAmaNaM nivedya | pazvAtkSAmana nivedanarUpaM / nigamanavacanaM bhaNitvA gacchati 74 / evaM gAthA | sAdhavaH enaM kRtikarmavidhi (dhiM ) yuMjAnAH kurvetaH caraNakaraNayogayuktAH sAvadhAnAH | anekabhavasaMcitamanaMtaM karma kSipayaMti / 75 / iti vaMdanakaniryuktirdIpikA samAptAH || chaH // zrIH || Then we have a part of Pratikramananiryuktivyakhya but as the yellow pigment is applied, it cannot be properly deciphered.

Page #451
414 pratikramaNa niyukti ( paDikkamaNanijjutti ) Jaina Literature and Philosophy Begins. -- fol. 3ob No. 1052 Extent.-- fol. 3ob to fol. 31. Description. Complete (?). For other details see No. 1011. Subject. These verses in Prakrit form a part of Avasyakasutraniryukti. DikkamaNaM paDikamao / paDikkamiyavvaM ca ANuputrIe / tIe paccutpanne aNAgae ceva kAlaMmi // 1 etc. I Ends. -- fol. 31b gao nAmanikkhevo atrAMtare sUtraM vAcyaM / pratikramaNaniryukti No. 1053 Pratikramananiryukti (Padikkamananijjutti ) Reference. -- Published. See No. 1002. paDasiddhANaM karaNe kiccANamakaraNe ya0 // 52 // paDikkamaNanijjuttI // [1052. 273 (m). A. 1882-83 Pratikramananiryukti 306 (k). A. 1882-83. Extent.- fol. 31b to fol. 32b. Description.-- Complete. For further details see No. 1019. Begins. fol. 31b paDikamaNaM paDikkamao etc. Ends- fol. 32b pANAivAyaM paJcakakhAyatti aliyavayaNaM ca / savvamadinnAdANaM abbaMbha pariggahaM svAhA // 51 // 3 paDikkamaNanijjuttI saMmattA // cha // N. B. For additional information see No. 1052. 1 This is gatha 12 31 according to the edition of avasyakasutra, containing its niryukti and Haribhadra Suuri's commentary. 2. Ibid, gatha 1270.

Page #452
1055.] III. 4 Malasatras 415 pratikamaNaniyukti Pratikramananiryukti 615(f). No. 1054 1884-86. Extent.- fol. 44 to fol. 45. Description.- Complete. For further details see No. 1034. Begins.-- fol. 44 paDikkamaNaM paDikkamao etc. Ends.-- fol. 456 savvaM pANAraMbha paccakkhAi aliyavayaNaM ca / savvaM ca adattAdANaM abaMbha pariggahaM svAhA // 53 paDikkamaNanijjuttI sammattA / / cha / cha / N. B.-- For other particulars see No. 1052. - dhyAnazataka Dhyanasataka (jhANasayaga) (Jhanasayaga) 273 (n). No. 1055 A.1882-83 Extent.- fol. 3rd to fol. 33b. Description.- Artadhyana goes up to the I8th verse ; thereafter the numbering of verses is continuous; complete ; in all 106 verses. For other details see No. 1011. Subject.-- These verses in Prakrit are looked upon as forming a part of Avasyakasutraniryukti though its author is Jinabhadra Gani Ksamasramana. Begins.--- fol. 316. vIraM sukkajjhANaggidakamiMdhaNaM paNamiUNaM / jogIsaraM sarannaM jjhANajjhayaNaM pavazvAmi // 1 ' etc. I Ibid., p. 5824.

Page #453
416 Ends. fol. 33b fol. 31b tadavirayasavirayA pamAyapara saMjayANugaM jhANaM / savvapAmUlaM vajje (?) pavvaM jaijaNeNa // 18 // fol. 31b dhyAnazataka No. 1056 Reference. - Published. See No. 1002. Jaina Literature and Philosophy sattavaha [va] baMdhaNaDahaNaMkaNaM bare (? mAra ) NAipaNihANaM / araterreghatthaM nigviNamaNa so(S) hama vivAgaM / / 19 / / - paMcuttareNa gAhAsaeNa jhANassa ye samakkhAyaM / jiNabhaddavamAsamaNehiM kaMmavisohIkaraM jaNo // 106 // 3 jhANasayaM saMmattaM / Extent.-- fol. 32b to fol. 34. Description. - Complete. For further details see No. 1019. Here, through oversight Artadhyana is separately counted. Begins. fol. 320 Ends. fol. 34b vIraM kajhANasu etc. ful. 320. afaridesa etc up to jaijaNeNa // 18 as in No. 1055. This is followed by ahaM jhANaM saMmattaM // cha // - fol. 32deg sattavedhaNa etc. paMcuttareNa gAhA etc. up to jayaNo / / 106 jhANasayaM saMmattaM // cha // N. B. For additional information see No. 1055. [1055. Dhyanasataka 306 (1). A. 1882-83. 1-2 Ibid., p. 588a. 3 This gatha is not given in the edition referred to ou p. 41o.

Page #454
1057.] dhyAnazataka No. 1057 Extent. fol. 45. Description. Incomplete. For other details see No. 1034. Begins. fol. 45b Ends.- fol. 45b III. 4 Malasatras vIraM sukkajjhANaggi etc. pAriSThApanikA niryukti ( pAriTThAvaNiyAnijjutti ) amaNunnANaM sAivisayavatthUNa dosamailassa / dhaNiyaM vigarcitaNama saMpaogANusaraNaM ca // 6 // taha sUlasI sarogAdiveyaNAe viugapaNihANaM / tayasaMpaogacitaNa tappa. This ends thus. N. B. For further particulars see No. 1055. - No. 1058 Extent. fol. 33b to fol. 36. Dhyanasataka 615 (g). 1884-86. Paristhapanikaniryukti (Paritthavaniyanijjutti) quigrafoufaft g(1)=31m Megftaiat | jaM nAUNa suvihiyA pavayaNasAraM ughalahaMti // 1 // 417 Description. Complete. For other details see No. IOII. Subject. It is doubtful how far these verses in Prakrit form a part of Pratikramananiryukti, a section of Avasyakasutraniryukti, though so suggested on p. 372. Begins--. fol. 33b 273 (0) A. 1882-83. etc. 1 In the edition noted on p. 410, we have 83 verses and they are commented upon by Haribhadra Suri. The editor of this edition has not included them as a part of Avasyakasutraniryukti but has numbered them separately. 2 This is the 1st gatha according to the edition of Avasyakasutra containing Haribhadra Suri's commentary. It occurs on p. 619a. $3 [J. L. P.]

Page #455
418 Jaina Literature and Philosophy [ 1078. Ends.- fol. 362 gurumUle vi vasaMtA aNukUlA je na hu~ti hu guruNaM / eesiM tu payANaM dUraMdUreNa te hu~ti // 53 (153 ) // ' pArijjavaNiyanijjuttI saMmattA / Reference.--- Published. See No. 1002. pAriSTApanikAniyukti Paristhapanikaniryukti 306 (m). No. 1059 A. 1882-83. Extent.--- fol. 34deg to fol. 37b. Description.- Complete. For further details see Nos. 1019 and 1056. Begins.--- fol. 340 pAridvApaNiyavihiM etc. Ends.--- sol. 376 gurumUle ctc. up to te huti // as in No. 1058. This is followed by 153 pAridvAvaNIyAnijjuttI saMmattA // cha / N. B.-- l'or additional information sce No. 1058. - pratikramaNasaGgrahaNI Pratikramanasamgrahami (paDikkamaNasaMgahaNI) (Padikkamanasangahani) 273 (p). No. 1060 A. 1882-83. Extent.-- fol. 36 to fol. 37b. Description.-- Complete. For other details see No. 1011. Subject.-- These 80 verses in Prakrit appear to form a part of Pratikramananiryukti, a section of Avasyakasutraniryukti, but it is not so according to the edition noted on p. 410. I Ibid., gatha 83. Vide p. 644b.

Page #456
419 1062.] III. 4 Malasatras Begins.- fol. 36 jahaM jaMbupAyavego supakkaphalabhAranamiyasAhaggo / ___ diTTo chahiM puremehiM te biMtI jaMbubhakkhemo // 1' etc. Inds.-- fol. 37" aha " me nava darisaNaMmi cattAri Aue paMca / Aime aMte sese do do bheyA khINabhilAveNa igatImaM / / 80 // paDikkamaNAsaMgahaNI Reference. --- Published. See No. 1002. pratikamaNasahAgrahaNI Pratikramanasaingrabani 306 (n). No. 1061 A. 1882-83. Extent.-- fol. 37deg to fol. 394. Description.--- Complete. For further details see Nos. TOI9 and 1056. In No. 1019, through oversight, the title of this Tork is wrongly stated as pratikramaNaniyukti. Begins.--- fol. 370 jaha jaMbupAyavego etc. Ends --- fol. 39 aha(vA) kaMme nava darisaNaMmi etc. up to igatIsaM // 80 // as in ___No. 1060. This is followed by paDikamaNasaMghayaNI saMmattA / / N. B.-- For additional particulars see No. 1060. yogasagraha Yogasamgraha (jogasaMgaha) (Jogasamyala) No. 1062 273 (g). A. 1882-83. Extent. --fol. 37 to fol. 38'. Description.-- Complete. For other details see No. 1011. ----------- I Cf gatha 1. Vide p.6454 2 Letters as and are gone, since the corresponding portion is worm-eaten, 3 This verse is numbered as 1 on p. 6630.

Page #457
420 Jaina Lilerature and Philosophy [1062. Subject.-- These 60 verses in Prakrit form a part of Pratikramana niryukti, a section of Avasyakasutraniryukti. See p. 372. Begins.-- fol. 37 AloyaNa niravalAve AvaIsu daDhadhammayA / aNissiovahANe ya sikkhA na(Ni)pa(ppa)DikaMmayA // 1 // etc. I Ends.-- fol. 38b pAyacchittaparUvaNa AharaNaM tattha hu~ti dhnnguttaa| ArAhaNAi marudevA osappiNie paDhama siddho // 60 // saMmattA jogsNghaa| Reference.- Published. See No. 1002. yogasaGgraha Yogasarngraha 306 (0). A. 1882-83. No. 1063 Extent.- fol. 39 to fol. 40*. Description.- Complete. For further details see Nos. 1019 and 1056. Begins.-- fol. 398 AloyaNa etc. Fnds.- fol. 40 pAyacchittaparUvaNa etc. up to paDhama siddho // 60 as in No. 1062. This is followed by jogasaMgahA / / N. B.--- For additional information see No. I062. 1 This is 1274th gatha ( p. 6635 ) according to the edition noted on p. 410, 2 Ibid., 1320th gatha (P.57240 ).

Page #458
1065.] AzAtanA ( AsAyaNA ) No. 1064 Ends.-- fol. 39a III. 4 Extent. fol. 38b to fol. 39a. Description. Complete. For other details see No. 1011. AzAtanA Malasatras No. 1065 Subject. These verses in Prakrit do not form a part of Pratikramananiryukti, a section of Avasyakasutraniryukti according to the edition noted on p. 410-the edition-wherein they are attributed to a samgrahanikara by Haribhadra Suri. Begins. fol. 38b Reference. Published. See No. 1002. parao pakkhAsaMne gaMtA cirNA[Na nisiaNAyamaNA | AloyaNa paDisuNaNe pugvAlavaNe a Aloe // 9 etc. Asatana (Asayana) 273 (r). A. 1882-83. ahavA arihaMtANaM AsAyaNAi sajjhAya kiMci nAhIyaM / 2?sugiisi faalaraigon q( 11 ) 11 4 3 AsAyaNA sammattA / 1 Ibid., 1st gatha (p. 725a). 2 There is a lacuna viz. f in the Ms. itself. 421 Extent. fol. 40a. Description.-Verses 61 to 64. For further details see Nos. 1019 and 1056. Asatana 306 (p). A. 1882-83. 3 In the edition noted on p. 410, this is the 1st gatha (p. 727b). After this verse we have in the printed edition: pratikramaNa saMgrahaNI samAptA ". "

Page #459
422 Jaina Literature and Philosophy [ 1065. Begins.-- fol. 409 'purao pakvAsane etc. Ends.-- 101. 402 31891 stigar etc. up to faRIFTATTUI as in No. 1064. This is followed by e u 64 AsAyaNA saMmattA N. B.-- For additional information see No. I064. asvAdhyAyaniyukti Asvarlhyayaniryukti (asajjhAyanijjutti) ( Asajjhayanijjitti) No. 1066 273 (s) A. 1882-83. Extent.-- fol. 390 to 41. Description.- Complete. For other deteils sce No. 1011. Subject. These in verses in Prakrit form a part of Pratikramana ___niryukti, a section of Avasyakastitraniryukti. Scc p. 372. Begins.-- fol. 392 asajjhAiyanijjuttiM vu(khu)cchAmI dhIrapurisapanattaM / jaM nAUNa muvihiyA pavayaNasAraM ubalahaMti // 1 // Ends.- fol. 414 asajjhAiyanijjutti jujaMtA crnnkrnnmaauttaa| sAhU khabaMti kama aNegabhavasaMciyamaNataM // 111 / / / sjjhaaiynijjuttii| Reference.-- Published. See No. 1002. 1 In the Ms. this is not numbered as I but is given in continuation with yogasaMgraha and hence numbered as 61. 2 This is gatha 13?1 according to the edition (p. 731b) containing Avasyaka sutra, its niryukti and Haribhadra Suri's commentary. It may be compared with the 1st verse of No. ios8. 3 Ibid., gaitha 1417 (p. 759 ). Cr. the last verses of Nos. 2020 and 1048.

Page #460
1068.] ___ III. 4. Malasatras 423 asvAdhyAyaniyukti Asvadhyayaniryukti No. 1067 306 (3). A, 1882-83. Extent.-~tol. 40" to fol. 12*. Description.- Complete. for further details see Nos. 1019 and 1056. Begins.-- fol. 402 asajjhAiyAnijjAtaM etc. Ends.- fol. 424 asajjhAiyanijjutti etc. up to saMtriyamaNaMta as in No. 1066. This is followed by 11 asajjhAiyanijjuttI saMmattA cha / / N. B.-- For additional information see No. 1066. kAyotsarganiyukti Kayotsarganiryukti (kAussagganijjutti) ( Kaussayganijjitti) No. 1068 273 (t). A. 1882-83. Extent. --fol. |I" to fol. 44. Description.-- Completc. lor other details scc No. 1011. Subject.-- These 172 vcrscs in Prakrit form a part of Avasyaka sutraniryukti. See p. 372. Begins.-- fol. 418 AloyaNa paDikkamaNe mIsa trivege tahA viussagge / tavaccheya mUla aNavaTTayA ya pAraMcie ceva // 1 // ' etc. Ends.- fol. 443 tamhA u nimameNaM muNimA ubaladdhasa(su)ttasAreNaM / kAussaggo uggo kaMmakkhayaTrAya kAyabvo // 172 / / / kAussagganijjuttI gA0 2398 // cha / Reference.--- Published. Soe No. 1002. | Ibid., gatha 1418 (p. 764a). 2 Ibid., gatha 15546p.8orb).

Page #461
424 antiteeriagifen No. 1069 Extent. fol. 42a to fol. 45b. Description. Complete. For further details see and 1056. Begins. fol. 42a Jaina Literature and Philosophy No. 1070 AloyaNa paDikamaNe etc. pratyAkhyAnaniyukti ( qaza$?asgia ) Ends.- fol. 45b tamhA u nimmameNaM etc. up to kAyantro / / 172 as in No. 1068. This is followed by kAussagganijjuttI saMmattA // cha // N. B. For additional information see No. 1068. Kayotsarganiryukti 306(r). A. 1882-83. Nos. 1019 [1069. Pratyakhyananiryukti (l'accakkhananijjutti) Extent. fol. 44a to fol. 46b. Description. Complete. For other details see No. 1011 1. Subject. The first few verses are followed by a passage prose. This passage is a part of Avasyakasutra. verses commence with 24th and go up to 94. a part of Avasyakasutraniryukti. Begins. fol. 442 273 (u). A. 1882-83. g(q)azaeroi qaesaren q=azdei a enggeaftc | parisA kahaNavihI yA phalaM ca AIya chanbheyA // 12 etc. 2 mostly in Then the They form I Herein there is a misprint. af begins from fol. 44a and goes up to fol. 46b. The entries viz. foll, 44a to 44b and foll. 44b to 45a should face . Furthermore, there should be a number 20 inside the brackets facing this work. 2 This is gatha 1555 (p. 803a) of the edition referred to on p. 410.

Page #462
1070.1 III. 4 Malasatras 425 fol. 44 tattha samaNovAsao puvvAmeva micchattAo paDikkamai / sammattaM uba saMpajjai no se kappada ajjappabhidaM / aMnautthie vA annautthiadevayANi vA / anautthiyapariggahiyANi vA / arihaMtaceiyANi vaMdittae vA | etc. pasamasaMvegAiliMge subhe AyapariNAme paMnatte / sammattassa samA(?) NovAsa eNaM ime paMcaiyArA jANiyasvA etc. --- - fol. 45 * duates sAmAmi u kae samaNo [ i kae samaNo ] iva sAvao havai jamhA / eeNa kAraNeNaM bahuso sAmAyiyaM kujjA // 12 // vaMti bhANiUNaM viraI khalu jassa sabviyA natthi / sosa(a) viravAI | cukkai desaM ca savvaM ca // 13 // 9 fol. 45b jaM ( ? taM) ta ( ja ? ) hA ihaloAsaMsapaoge | jIviAsaMsappa - oge | maraNAsaMsappaoge / kAmabhogAsaMsappaoge // cha || (Pratya) paccakkhANaM uttaraguNesu / khamaNAiyaM / aNegavihaM teNa ya ihayaM / pagayaM / taM pi ya iNamo dasavihaM tu / / 24 / / 8 sAmAiyassa samaNovAbha ( sa ) evaM ime paMca0 // maNaduSpANihANe | yadupaNihANe kAyappaNihANe / sAmAyiyassa sahaakaraNayA / ' etc. Ends.- fol. 46b addi pi nayANaM bahuvihavattavvayaM nisAmittA | taM savvanayavisuddhaM jaM caraNaguNaTTio sAhU || 94 // 1 paccakkhANanijjuttI saMmattA / Reference.-- Published. See No. 1002. See Buuhler's Report for 1872-73 where there is given a photo - print of a page of the Avasyakasutra. A facsimile of the last page of a Ms. of the Avasyakasutra dated Samvat 1189 is given in Rajendralal Mitra's " Notices of Sanskrit Mss. vol. III, facing P. 67.10 1-2 Ibid., p. 811a. 3 Ibid., p. 811a. There this portion along with those marked as 1 and 2 form a part of Avasyakasutra. 4-6 Ibid., p. 831b. There these portions form a part of avasyakasutra. 7 See p. 839a where this passage occurs as a part of Avasyakasutra. 8 Gatha 1563 (p. 840b ). 9 Gatha 1623 (p. 8640 ). 10 Similarly a facsimile of the last page of a Ms. of Kalpasutra supposed to be about 350 years old is given in the same volume on a page facing 66.

Page #463
426 pratyAkhyAnaniyukti No. 1071 Jaina Literature and Philosophy Extent.- fol. 45h to fol. 48a. Description. Complete. For further details see Nos. 1019 and 1056. Begins. fol. 45b Ends.- fol. 48 Pratyakhyananiryukti 306 (s). A, 1882-83. qezzzaroi q@zzare etc. as in No. 1070. // cha // zubhaM bhavatu // cha // etc. -- faaari etc. up to as in No. 1070. Then we have : 90 paJcakkhANanijjuttI saMmattA // cha // zrImadAvazyaka sUtraM N. B. For additional information see No. 1070. [ 1071. pratyAkhyAnaniyukti No. 1072 Size.- - 98 in. by 37 in. - Extent. 38 14 + 64 15 = 73 folios; 14 lines to a page; 46 to 54 letters to a line. Pratyakhyananiryukti 1220 (1). 1884-87. Description. Country paper thin, rough and white; Devanagari characters with occasional qars; small, legible, uniform and good hand-writing; borders ruled in four lines in black ink; red chalk used; foll. numbered in the right hand margin; condition very good; this Ms. seems to be a combination of two different Mss.; the 1st of them goes from fol. 105 to 142b and has both the beginning and the end abrupt; the second runs from fol. 189a to fol. 252b; the latter is written in a slightly thinner, smaller and better hand-writing; Taraf incomplete as this Ms. begins abruptly; foll. 122 to 135, 143 to 188 and foll. 205 to 219 missing; this Ms. contains the following additional works:

Page #464
1072..] III. 4 Malasatras 427 TOP " "746 , 189. ... 749 , " (1) laghukSetrasamAsa foll. I05 to 108'. (2) piNDavizuddhi No. 413 , I08deg ,, III'. (3) zrAvakavaktavyatA , III , II (4) paJcaliGgIprakaraNa H4deg ,, 117'. (5) zIlopadezamAlA (6) vItarAgastotra __,, 138 ,, I42. (7) praNipAtasUtra ,, 884_fol. 189. (8) IpithikIsUtra ,790 (9) uttarIkaraNasUtra ,,796 (10) kAyotsargasUtra ,,800 (II) nAmastava 814 (12) caityastavapratIka ,,826 , , (13) prabodhacaityavandana , 1894 ,, 1890] (14) 'darzanaM devAdi stava (15) gharakanakasUtra (16) tIrthavandanasUtra (17) zakrastava ,753 (18) caityastava 821 (19) kAyotsargasUtrapratIka ,, 813 (20) zrutastava foll. 189deg ,, 190* (21) zrutasya bhagavataH fol. 190*. (22) siddhastava (23) vaiyAvRttyakarasUtra (24) kAyotsargasUtrapratIka 25) saMsAradAvAnalastuti (26) jAvaMti ceiyAI (27) jAvaMta ke vi sAhU ,,763 (28) namo'hat ,,897 (29) upasargaharastotra ,769 (30) prArthanAsUtra ,,786 (31) vandanakasUtra ,853 (32) devasikAlocanAsUtra (33) savvassa vi (34) gurukSAmaNAsUtra ,, 867 , , (35) ekAzanAdipratyAkhyAna , 937 foll. 19ob ,, I9". (36) AcAmlapratyAkhyAna , 950 fol. I9r. (37) vividhAhAropavAsapratyAkhyAna , 934 - " " - 9 035 0000 906 759 ,, 91

Page #465
428 Jaina Literature and Philosophy and Philosophy (1072. (38) divasacarimapatyAkhyAna No. 941 fol. I91' (39) sAmAyikasUtra , 871 , , (40) sAmAyikapauSadhapAraNagAthA ,, 883 ,, I91" (41) jaya mahAyasa , 875, ,, (42) zramaNopAsakapratikramaNasUtra ., 917 foll.,, to 192 (43) AyArIya uvajjhAe , 877 fol. 1920 (44) sirithaMbhaNayapAsanAhathui ,, 880 , 193* (45) aticAra (46) zrutadevatAstuti (47) bhuvanavAsinIdevIstuti (48) kSetradevatAstuti (49) jaya tihuyaNastotra foll. , , 194 (50) ajitazAntistava , 194deg ,, 1964. (51) ullAsikastotra (ajitazAntistotra)fol.196% ,, 196deg. (52) namiUNa foll. 196deg ,, 1974 (53) taM jayau ,, 197%, 198. (54) mayarahiyaM (smaraNa) fol. 1983 ,, 178. (55) sigghamavaharau foll. 19 199*. (56) zrAvakavidhi ___fol. 1999 ,, 199". (57) dAnavidhi foll. 1990 ,, 200*. (58) namaskAraphala (59) catuHzaraNa fol. 2 2014 ,, (60) saMyamamArI , 202'. (61) ajJAtanAmadheya 202* ,, 204. (incomplete ) (62) catuHzaraNa ,, 220* ,, 221. (incomplete) (63) sUkSmArthavicAra ,, 22zb. (64) karmavipAka 229. (65) AgamikavastuvicAra 232. (66) karmastava 233. (67) karmastavabhASya (68) zataka ,, 234* ,, 236. (69) saptatikA , 236deg ,, 239. (70) bandhasvAmitva ,, 239* ,, 240 (71) saGgrahaNI , 240*, 252. , 20 , 201. 234

Page #466
429 1073.] III. 4 Malasttras On fol. 2526, a list of works mentioned here is given. Age.- Samvat I492. Begins.-abruptly fol. 105* .........tteyaM piMDae navae // 46 do ceva namukkAro AgArA chaJca porisIe u / satteva ya purimar3e | egAsaNagaMmi aTreva // 47 sattegaTTANassa u / aTTevAyaMbilaMmi aagaaraa| paMceva abhatta / chappANe carimi cattAri // 48 etc. Ends.--fol. 1056 nAmi ginhiyatve | agiNDiyatvaMmi ceva atthaMmi / jaiyatvameva iya jo / uvaeso so nao nAma || 7. savvesi pi nayANaM / bahuvihavattavayaM nisaamittaa| taM savvanayavisuddhaM / jaM caraNaguNaTrio sAhu / / 71 paJcakkhANanijjuttI samattA / / yAdRzaM pustake dRSTaM tAdRzaM likhitaM mayA / yadi zuddhamazuddha vA / mama doSo na dIyate // ch||2|| cha / zrI N. B.-- For other particulars see No. I070. AvazyakasUtraniyukti Avasyakasutraniryukti ziSyahitAsahita with Sisyabita 1091. No. 1073 1887-91. Size-- 109 in by 41 in. Extent. 351-I = 350 folios ; 17 lines to a page ; 48 letters to a line. Description.- Country paper thin and greyish; Devanagari cha racters with pRSTamAtrAs; small, legible and elegant handwriting ; borders ruled in four lines in red ink; red chalk and yellow pigment used; numbers for foll. entered only once in a corner of the right-hand margin; nos

Page #467
430 Jaina Literature and Philosophy [1073. 1, 2, etc. also written at times between the lines perhaps indicating the nos. of foll. copied out in a single day; fol. 35b practically blank; fol. 168 lacking ; several foll. slightly_worm-eaten ; edges of the last fol. slightly damaged; fol. 250 somewhat smutty; condition on the whole satisfactory. Age.-- Fairly old. Author of the commentary.- Haribhadra Suri. For his works see pt. II, p. 300 and this pt. III, pp. 105,224 and 234. Subject. The text together with its explanation in Sanskrit. The latter is styled as Sisyahita. Begins.-- (text) fol. 20 " AbhinibohiyanANaM etc. as in No. 1081. --( com. ) fol. a namaH sarvajJAya | praNipatya jinavareMdra etc. as in No. 1076. Ends.-(text) fol. 351a sakasi pi nayANaM etc. ,,' ~ ( com.) 12 sthitipakSamupadarzayannAha etc. up to gAthArthaH practically as in No. 1076. This is followed by the lines as under : dr ziSyahitAyAM pratyAkhyAnavivaraNaM samAptaM / cha / vyAkhyeyo'dhyayanamidaM yadavAptamiha zubhaM mayA puNyaM / zuddhaM pratyAkhyAnaM labhatAM bhajyo (vyo ) janastena / samAptA ceyaM ziSyahitA nAma AvazyakaTIkA kRtiH sitAMbarAcArya jinabhadranigadANusAriNA / 'vidyAdhara 'kulatilakAcAryajinadatta ziSyasya dharmya (to) joiNImahattarA sUnoralpamAtarAcArya haribhadrasya // cha yadihotsUtramajJAnAdvayAkhyAtaM tad bahuzrutaiH / kSAMtavyaM kasya saMmohAcchadmasthasya na jAyate yadA ( da ) ( ) taM viracayatA subodhyAM TM puNyaM mayAssvazyakazAstraTIkAma | bhave bhave tena mamaiva mevaM bhUyAjjinoktau nu mate prayAsaH // anyaca saMtyajya samastasattvA mAtsaryaduHkhaM bhavabIjabhUtaM

Page #468
1074.] M. 4 Malasutras 431 sukhAtmakaM muktipadAvahaM ca sarvatra mAdhyasthamavApnuvaMtu // cha | samAptA ceyamAvazyakaTIkA / / cha / dvAviMzatisahasrANi pratyekAkSaragaNanayA anuSTupchaMdasA mAnamasyA uddezataH kRtaM / / aMkato(5)pi 22000 zubhaM bhavatu zrI tapA'gacchasya / This is followed by the following line in a different hand:-- paMDitazrIvijayacaMdragaNiziSyapaM0vivekacaMdraga kalyANacaMdreNa prati bha(bhAM)DAgAre muktaa|| Reference.- Published. See No. 1002. AvazyakasUtraniyukti Avasyakasutraniryukti ziSyahitAsahita with Sisyahita No. 1074 1181. 1886-92. Size.- 10 in. by 4g in. Extent.- (text) 380 - I - I = 378 folios; I to II lines to a page ; 45 letters to a line. -(com.) 378 folios ; I3 to 17 lines to a page ; 55 letters to a line. Description.- Country paper thin, rough and white; Devanagari characters with occasional pRSThamAtrA; this Ms. contains the niryukti ( text) and the commentary as well ; it is a f@rare Ms; space for the text is reserved; the text written in a bigger hand ; legible and good hand-writing; borders ruled in four lines in black ink ; nos. for foll. entered twice as usual; fol. I blank ; fol. 222 also numbered as 2233; the subsequent ones as 224 etc; similarly fol. 287 also numbered as 288 ; life-perods and heights of the 24 Tirthamkaras tabulated on foll. 72" and 734; explanation by means of a digaram on fol. 323"; tabulated results

Page #469
Jaina Literature and Philosophy ( 1074 on fol. 330 ; yellow pigment used; red chalk, too, at times ; margins of some of the foll. worm-eaten ; edges of the first fol. slightly worn out; the last fol. some-what damaged; foll. 118 to 121 slightly damaged in the body; condition on the whole good ; both the text and the com mentary complete ; extent 22500 slokas. Begins.-- (text )fol. 3b anfaatatiecaro etc. as in No. 1073. ,- (com.) fol. rb TATAARIT AA: FT: HTETIT Trone Paraati ait etc. as in No. 1073. Ends.(text ) fol. 3800 samvasi pi etc. ,, - (com.) fol. 3800 franga etc. up to reta: E as in No. 1073. This is followed by yi if(0) 28400. N. B.- For other details see No. 1073. ziSyahitA Sisyahita [SCRATE [ AvasyakasutraniyuktivivRti] niryuktivivrti ] No. 1075 131, 1873-74. Size.-- 104 in. by 44 in. Extent.-- 545 folios; 15 lines to a page ; 48 letters to a line. Description.- Country paper thin, rough and greyish ; Devanagari characters ; sufficiently big, legible and good hand-writing; borders ruled in four lines in black ink; red chalk and yellow pigment used; a piece of paper of the size of a fol. pasted to fol. 1o; same is the case with fol. 5456; foll. 14 and 5456 blank; a strip of paper pasted to fol. 3435 condition very good ; complete. Age.- Pretty old. Author.-- Haribhadra Suri. For his works see No. 1073.

Page #470
1076. ] 11). 4 Malasatras 433 Subject. This work named as Sisyahita elucidates the Avasyaka sutraniryukti. There was a bigger commentary than this composed by Haribhadra Surias suggested by himself (see p. 434; "Begins " V. 2). Begins.- fol. 1 : Hata! Tratare ftat als etc. as in No. 1076. Ends. -- fol. 546* ffufaqat etc. practically up to geata: 5 as in No. 1073. This is followed by the line as below: JAT PP00olly ! etc. Reference.-- Published. See No. 1002. - ziSyahitA Sisyabita No. 1076 366. 1880-81. Size.-- 124 in. by 4 in. Extent... 213 folios; 15 lines to a page; 72 letters to a line. Description.- Country paper very thin and greyish ; Devanagari characters with genas; small, legible and good handwriting; borders ruled in four lines in black ink; the intermediate portion coloured red; all the foll. have at least one disc in the centre; and each verso has two additional ones in the margins; only a few foll, are numbered twice ; foll. 18 and 2136 blank ; red chalk and yellow pigment used; marginal notes added at times; a piece of paper of the same size as a fol. is pasted to fol. 1a and to fol. 2136 as well; strips of paper are pasted to some foll. ; condition unsatisfactory; complete so far as FIATUTETTA is concerned; extent 12383 slokas. Age.- Old. Begins.fol. 16 TA: STATTI praNipatya jinavareMdraM vIraM zrutadevatAM gurUna sAdhun / Avazyakasya vivRti gurUpadezAdahaM vakSye // 1 //

Page #471
434 Jaina Literature and Philosophy [ro76. yadyapi mayA tathA(5)nyaiH kRtA(5)sya vivRtistathApi saMkSepAt / .. tadrucisattvAnugrahahetoH kriyate prayAso'yaM // 2 // Ends.- fol. 213 sthitapakSamupadarzayannAha sanvesi pi gAhA / vyA0 sarveSA etc. ubhayameva vA'napekSyamityAdirUpAM athavA nAmAdInAM nayAnAM kaH ke sAdhumicchatItyAdirUpaM nizamya zrutvA tatsarvanayavizuddhaM sarvanayasaMmataM vacanaM yaccaraNaguNasthitaH sAdhuryasmAtsarvanayA eva bhAvanikSepamicchaMtIti gAthArthaH // cha // AcAryaharibhadrakRtau ziSyahitAyAmAvazyakaTIkAyAM sAmAyikAdhyayanaM samApta // ch|| sAmAyikasya vivRti kRtvA yadavAptamiha mayA kuzalaM / tena khalu sarvaloko labhatAM sAmAyikaM paramaM / yasmAjagAda bhagavAn sAmAyikameva nirupamopAyaM zArIramAnasAnekaduHkhanAzasya mokSasya // 2 // graMthAnaM 12383 / / cha // etc. N. B.-For other particulars see No. I075. ziSyahitA Sisyahita No. 1077 134. 1873-74. Size.-- 104 in. by 44 in. Extent.- 248 - 13 - II = 224 folios ; IS lines to a page ; 56 letters _to a line. Description.- Country paper thin and greyish; Devanagari cha racters with pRSThamAtrAs; small, legible and good hand-writing; borders ruled in four lines in black ink; red chalk used; yellow pigment, too; nos. for foll. entered in a small hand between or near the lines in the right-hand margin ; edges of the first and the last few foll. worn out; corners of several foll. damaged; foll. 139th and the following are more or less worm-eaten ; condition fair; marginal notes written here and there'; foll. so to 62 and 194 to 214 lacking; extent 12383 slokas. Age.---- Sainvat ISII. Begins.-- fol. Iarha // sAMprata sAmAyikAdhyayanAnaMtaraM caturviMzatisUtrAdhyayana mArabhyate / iha cAdhyayanodeze satrAraMbheSu etc.

Page #472
1078.] (niryukti) fol.1 111. ziSyahitA'ntargata kumAranandikathA 4 Malasatras cavIsa gacchassa u nikvevo hoi nAmanippanno / cavIsagassa chakkA thayassa ukkao hoi // Ends. - sthitapakSa etc. up to mokSasya // 2 // practically as in No. 1076. This is followed by the lines as under:-- graMthAgraM 12383 // cha // zrIH // maMpavAchAlikhitaM // cha // zrIH // saMvat 1511 varSe mAghamAse zuklapakSe 13 dine zrI ' kharatara gacche zrIsAgaracandramUrivAcanAcAryazrI mahimarAjagaNibhiH svaziSya paM0 dayA sAgaragaNivAcanArthamalekhi 'zrIpattana 'pure / 'zrImAla 'jJAtIyasaM 0 cAMdAbhAryayA saM0guNarAjaputrI saM0 DAlI bhAvikayA zrI maMDapagaDha sthitayA lekhitA vA0dayAsAgaragaNivarANAM // N. B.-- For further details see No. 1075. 435 Sisyahitantargata-Kumaranandikatha No. 1078 Size.- ro++ in. by 44 in. Extent. - 3 folios; 13 lines to a page ; 44 letters to a line. Description.-- Country paper thin, rough and yellowish ; Devanagari characters with occasional garais; small, legible, uniform and good hand-writing; borders ruled in four lines in black ink; red chalk used; foll. numbered in the right-hand margin orly; some portions of each of the foll. worn-out; otherwise condition good; lacunas on fol. 34; complete so far as it goes ; fol. 3b blank. Age.-- Old. 1130. 1884-87. Subject. This is a portion of Sisyahita where the life of Kumaranandi, a goldsmith is narrated with a view to explain the orgin of the city of Dasapura. It is also found almost ad verbatim in Avasyakavrtti by Malayagiri Suri. Cf. the Cunni (pt. I, pp. 397-398 ).

Page #473
436 Jaina Literature and Philosophy [ 1078. Begins.-fol. I teNaM kAleNaM teNaM samaeNaM 'caMpA'e nayarIe kumAranaMdI suvaNNakAro ithilolo parivasai so jattha surUvaM dAriyaM pAsai suNei vA / taccha(stha) paMca suvaNNasayANi dAUNa taM pariNei / evaM teNaM paMca sayA piMDiyA / tAhe so IsAluo egakkhaMbhapasAyaM karitA tAhiM samaM lalai / tassa ya mitto nAilo nAma samaNovAsu / aNayA 'paMcaselaga dIvavatthAu vANamaMtarIu suravainiueNa 'gaMdIssara'dIvaM jattAe patthiyAu | tANaM ca vijjumAlI nAma 'paMcaselAdhivaI so cuo tAo ciMtitaM / kiMci ghuggIhemo / jo amhaM bhattA bhavijai | navaraM vaccaMtIhiM 'caMpA e kumAranaMdI paMcamahilAsayaparivAro uvalalayaMto diTro tAhe ciMItayaM esa itthilolo etaM buggAhemo tAhe tAhiM ujjANagayassa appA daMsiu tAhe sobhai / / etc. Ends-fol 3 jaMca rAya jimei / taM ca pajoassa vi dijai / navaraM pajosavaNAe suraNa pucchio / kiM aja jimesi so ciMtei / aju marijAmi tAhe pucchAmi so bhaNai ajja pajjosavaNArA uvavAsiu so bhaNai / ahaM yi uvvaasiu| mama viM mAyApiyANi sAvayANi / Na yANiyaM / mayA jahA / ajja pajjosavaNa tti ranno kahiyaM / rAyA bhaNai / jANami jahA sA dhutA kiM puNa mama eyaMmi baddhillae pajjosarveNo yeva na sajjhai tAhe mukko mikkhAmiu ya / paTTo ya sovaNo / tANakkharANatthAyaNanimittaM baddho / so vi sudinno / tappabhiI paDabaddharAyANo jAyA / putvaM mauDabaddhA Asi banne vAsAralagatto raayaa| tattha jo dhaNiyavaggo Agau so tahi '----viu / tAhe 'dasapuraM' jAyaM cha Reference.-- Published in Sisyahita ( pp. 2966-300" ) and also in Malayagiri Suri's com. ( pp. 391 -394deg ). AvazyakasUtra AvasyakasutrabRhadvAttaTippaNakagata bihadvrttitippanakagatazayyAtarasvarUpa sayyatarasvarupa No. 1079 302 (b). A. 1882-83. Extent.- fol. 9" to fol. 9". Description.- Complete so far as it goes. For other details see Pindavisuddhi No. 119. 1 Lacunas in the Ms.

Page #474
1980. ] Begins.fol. 9(c) zrIAvazyaka bRhadvRttiTippanakagataM zayyAtarasvarUpaM likhyate / zayyayA sAdhusamarpitagRhalakSaNayA bhavArNatraM taratIti zayyAtarastasya piMDaH zayyAtarapiMDaH / atha ko ( s) yaM zayyAtaraH 1 kadA ca zayyAtaro bhavati 2 katividhastapiMDa 3 kadA cA'zayyAtaraH syAt 4 keSAM ca saMbaMdhyasau varjanIyaH 5 ke ca DigrahaNe doSAH 6 kadA ca viMDo gRhyate 7 va zayyAtaro bhavatI 8 tyaSTau dvArANi // Avazyaka sUtraniryukti vivRtisahita III. 4 Malasutras Ends.fol. 9 aSTamadvAre || svasthAne vasanazayyAtaro bhavati dezAMtare tu gato na bhavatyapi kevalaM bhadrakAMtadoSAt tatpiMDastatrApi varjanIyaH / bhadrako hi mama tAvat svagRhAvasthitasyAmI na kiMcid gRhNati / yadi tAvadiha gRhNati tathApi zobhanamiti vicitya'neSaNIyama'pi kRtvA dadyAt prAMtastu mama svagRhasthitasthAmI na kiMcid gRhNatyatra tu gRhNati tatkimidAnImanyaH saMjAto ( ( ) haM tasmAnmAyAvana eveti vicitya vasatphaccho (?) kuryAt evaM zayyAtarasaMbaMdhinA bhrAtRmAtulaAarti sapA ( ? )sthA prabhUNAmapi saMbaMdhI piMDo varjanIyo bhadrakaprAMtAdidoSAt / ityalaM vistareNa tadarthinA tu prakalpatRtIyo dezako'nveSyaH // zayyAtarapiMDasvarUpaM // cha // zrI // 437 Avasyakasutraniryukti with vivrti No. 1080 Size.-- 1o++ in. by 4 in. Extent.-- 270 + 368 = 638 folios; 13 lines to a page ; 44 letters to a line. 1168. 1884-87. Description. Country paper rough and greyish; Devanagari characters with gears; sufficiently big, legible and good hand-writing; borders ruled in three lines in red ink ; nos. for foll. entered only once ; fol. r blank ; white paste used; this Ms goes up to the end of the 2nd khanda ; the first khanda gets completed on fol. 270b and the commercement of the second is not numbered in succession but it is marked afresh; fol. 271a i. e. to say the new folio 1 is blank ; a piece of paper of the size of a fol. pasted to fol. 1; edges of the first two foll. and the last as well slightly damaged ; condition on the whole good.

Page #475
438 Jaina Literature and Philosophy [ rosof Age.- Prety old. Author of the commentary-- Malayagiri Suri. For his other works see Nos. 194, 201, 220, 235, 254 and 619. Subject. -- Avasyakasutraniryukti together with its explanation in Sanskrit. Begins.- (niyukti) fol. I4' AbhiNibohiyanANaM etc. ,, - (com.) fol. Ib pAtu naH pArzvanAthasya pAdapadmanakhAMzavaH azeSavighnasaMghAtatamobhedakahatavaH 1 jayati jagadekadIpaH prakaTitaniHzeSabhAvasadbhAvaH / kumatapataMgavinAzI zrIvIrajinezvaro bhagavAn (2) natvA gurupadakamalaM prabhAvatastasya maMdazaktirapi AvazyakaniyuktiM vitRNomi yathAgamaM spaSTaM (3) yadyapi ca vittamo'syAH saMti vicitrAstathApi viSamAstA saMprati ca jano jaDadhI yAniti vivRtisaMraMbhaH (4) etc. ( com.) fol. 270deg of the first part kAni punarviMzatikAraNAni yaistIrthakaranAmagotraM karma tenopabaddhamityata Aha arahaMtA gAhA saNagAha apubvagAhA niyamAgAhA etA RSabhadevAdhikAravyAkhyAtatvAnna viniyaMte mAhaNagAhA asyA vyAkhyA puSpottarAucyuto 'brAhmaNakuMDagrAma nagare koDAlasagotrabrAhmaNa somilAbhidhAno'sti tasya gRhe utpannaH devAnaMdAyAH kukSAviti gAthArthaH cha etc. - ( com.) fol. 368deg of the 2nd part idAnIM zAMtiH zAMtyAtmakatvAt zAMtiH tatra sarva eva tIrthakRta evaMrUpA ato vizeSamAha cha jAto asivo vasamo gabhagate teNaM saMtijiNo pUrva mahadasivamAsIt bhagavati tu garbhagate jAto asivopazamastena kAraNena zAMtijinaH saMprati kuMthuH kuH pRthivI tasyAM sthitavAna kuMthuH pRSodarAditvAdiSTarUpaniSpattiH tatra sarve(s)pi bhagavaMta evaMvidhAstato vizeSamAha cha zubhaM rayaNavicittaM kuMthu sumiNami teNa kuMthujananI. svapne kuM sthaM manohare atyunate jiNo mahApradeze stUpaM ratnavicitraM dRSTvA pratibuddhavatI tena kAraNena bhagavAn nAmataH kuMthujinaH sAMpratamaraH cha / / iti zrImalayagirisUriviracitAyAmAvazyakaTIkAyAM dvitIyakhaMDaM samAptamiti cha etc. Reference.--- Published. See No. I002, p. 374.

Page #476
III. 4 Mulasutras 1081.] AvazyakasUtraniyukti laghuvRttisahita No. 1081 439 Avasyakasutraniryukti with laghuvetti 1089. 1887-91. Size.-- Iog in. by 4g in.. Extent.- 210-2 - 15 - 2 - 10 - 34 - 1 -4-9-16 = 117 folios ; 17 lines to a page ; 60 letters to a line. Description.- Country paper tough and greyish ; Devanagari characters with pRSThamAtrAs; small, clear and good hand-wri. ting ; borders ruled in four lines in black ink ; fol. 1. blank ; red chalk and yellow pigment used; foll. 4, 5, 9 to 23, 61, 66, 69 to 78,86 to 119, 126, 130 to 133, 136 to 144, and 165 to 180 lacking; this Ms. contains the niryakti and its commentary as well; both complete ; cdges of the first fol. partly worn out; condition good. fol. 210deg gives a sort of a long list of the contents. Age.-Old. . Author of the text.-Bhadrabahusvamin. ,, ,, ,, com.- Sritilaka Suri. Subject.-- The text along with a commentary in Sanskrit. Begins.-- (text) fol. 16 AbhiNibohiyanANaM suyanANaM ceva uhinANaM ca / taha maNapajjavanANaM kevalanANaM ca paMcamayaM / 1 // etc. ,, - (com.) fol. 1 e 60 // OM namaH zrIpaMcaparameSTibhyaH / / devaH zrInAbhisUnurjanayatu sa zivAnyaMzadeze yadIye / khelaMtI kuMtalAlI vilasadalikuzaprojjvalA zAlate sma / saMjAte saMyamazrIpariNayanavidhau mAMgalikye trilokI lakSmyA dUrvokurANAM tatiriSa patito dastahastavayAgrAt / 1 // etc. tathApyatyalpadhIhetoralpadhIrapyahaM punaH / racayiSyAmya vRttittAnArthe ladhIyasIM // 12 // etc.

Page #477
440 Jaina Literature and Philosophy [ 108r. Ends.-- (text) fol. 2109 samvesi pi nayANaM bahuvihavattavvayaM nisaamittaa| taM satvanayavisuddhaM jaM caraNaguNaTrio sAhU // 74 // ,, ~(com.) fol. 210deg pUrvAddha spaSTaM // tatsarvanayavizuddhaM yaccaraNaguNasthitaH sAdhuH yato yathAkhyAtacAritriNa eva mahodayapadAvAptiriti / / 74 // iti zrIzrItilakAcAryaviracitAyAmAvazyakalaghuvRttau pratyAkhyAnAdhyayanaM samAptaM / / cha / atra yaM. 698 // tatsamAptI samAptA(te)yamAvazyaka laghuvRttiH // naM. 12355 // yAdRzaM pustakaM etc. // zrIrastu // Reference.- For additional Mss. etc. see G. O. Series rol. XXI pp. 20, 9 and 40. See also Peterson's Report for 1882-83, p. 58 (1) AvazyakasUtraniyukti Avasyakasutraniryukti ladhuvRttisahita with laghuvrtti 1169. No. 1082 1884-87. Size.-105 in. by 49 in. Extent --- 297 - I - I - 78 = 217 folios ; I3 lines to a page; 56 letters to a line. Description.-- Country paper very thin and greyish; Devanagari characters with pRSThamAtrAs; bold, big, beautiful and legible hand-writing ; borders ruled in four lines in black ink; red chalk and yellow pigment used; foll. 2, 97 and 181 to 258 lacking; edges of the 3rd fol. slightly gone ; the first fol. very badly damaged ; about a quarter of it worn out; condition tolerably good. Age.-- Samvat 1535. Begins.- (com.) fol. 10 e6|| namaH zrIpaMcaparameSTibhyaH // devaH zrInAbhisanuH etc. as in No. 108r. Ends.- (text) fol. 2960 sanvesi pi nayANaM etc. as in No. 1081.

Page #478
1082.] Ends. -- ( com. ) fol. 2972 Then we have : as under : III. 4 Malasatras pUrvAddhaM spaSTaM // etc. up to graM. as in No. 1081. 12325. This is followed by the verses tIrthe vIravibhoH sudharma gaNabhRtsaMtAnalabdhonnatizvAritrojjvala'caMdra' gacchajaladhiprollAsasItadyutiH / sAhityAgamatarka lakSaNa mahAvidyApagAsAgaraH | zrI caMdraprabhasUriradbhuta matirvAdI bhasiMho ( ( ) bhavat // 1. tapaTTalakSmIzravaNAvataMsAH zrIdharmaghoSaprabhavo babhUvuH / yatpAdapadme kalahaMsalIlAM dadhau nRpaH zrIjayasiMhadevaH || 2 || tatpaTTodayazailazRMgama bhajattejAzva (stri) cUDAmaNiH | zrIcakrezvarasUrirityabhidhayA ko ( S) pyatra bhAnurnavaH / saMprAptAbhyudayaH sadaiva tamasA no jAtu vicchAyitaH / naivocaMDaruciH kadAcidapi na prAptA (tA? ) parAgastataH // 3 / vilalAma svaraM tatpaTTaprAsAda caMdrazAlAyAM / zrImAn zivapra (bha) guruH saMyamakamalAkRtAsaktiH // 4 // zrIza (zi) vaprabhasUrINAM teSAM ziSyo ( s)smi maMdadhIH / nAnA zrI tilakAcAryaH zrutArAdhanagRddhibhAk // 5 // etAM vRttiM laghumaviSamAM so ( S) hamAvazyakIyAM / tatpAdAbjasmaraNamahasA mugdhadhIraNyakArSe / tayatkiMcidrabhasavazato dRSTamasyAmazuddhaM / tatsaMzodhyaM mayi kRtakRpaiH sUribhistattvavidbhiH // 6 // vRttiM racayatA caitAM sukRtaM yanmayA (S) rjitaM / bhave bhave (S) haM tena syAM zrutArAdhanatatparaH // 7 // zava (?) dvAdazake (S)bdAnAM gati (te?) vikramabhUbhujaH / saMvatsare SaNNavate vRttireSA vinirmame // 8 // ziSyA naH zasyacAritrAH sarvazAstrAbdhipAragAH / asyAM sAhAyakaM cakruH zrIpadmaprabhasUrayaH // 9 // fast (S) smAkamimAM vRttimahivannaH zAstratattvavit / akhi(li) (kha) prathamAdarze yazastilakapaMDitaH / / 10 / / sapAdavizatyasyAM zloka dviSaTsahastrakA | pratyakSareNa saMkhyAnAditi nizvitavAnahaM // 11 // 441

Page #479
442 Jaina Lilerature and Philosophy [1082. yAvadvijayate tIrthaH zrImadvIrajinezituH / tAvadeSA marAlIva khelatAtkRtimAnase // 12 // saM. 1535 varSe caitrazudi 15 bhaume / ayeha zrI pattana'madhye | zrI. 'parataragacche gacchAdhipe paTTe zrIjinaharSasUrirAjye / puvataNIsapuNyalakSmI shrii| tasya ziSyaANaMdazrIgANa svayaM paThanArthe zrIAvazyakalaghuTIkA likhApitaM / zrI pattana'vAstavye 'udIcya jJAtIyayatizrIzaMghAsatabaDUAkena liSitaM zubhaM etc. N. B.-- For further particulars see No. 1081. AvazyakasUtraniyukti Avasyakasutraniryukti laghuvRttisahita with laghuvitti No. 1083 1182. _1886-92. Size.-- 104 in. by 44 in. Extent.-- 297 - 1 - 15 = 281 folios; 17 lines to a page; 40 letters to a line. Description.- Country paper thin and greyish, Devanagari cha racters with occasional yarats ; legible and good handwriting ; borders ruled in four lines in black ink ; space between the pairs coloured red; three discs : two in the margins and one in the centre ; nos. for foll. entered twice as usual ; yellow pigment and red chalk used; marginal notes written at times ; fol. I and foll. 56 to 70 lacking; corners of foll. i to 15 and 273 to 282 slightly worn out : foll. 721077 more or less smutty ; but, all the same they are readable ; edges of foll. 177 to 200 somewhat gone ; condition tolerably good ; fol. 297deg practically blank. Age.- Pretty old. Begins.- (text) fol. 20 AbhiNibohiyanANaM suyanANaM ceva ohinANaM ca etc. as in No. 1081,

Page #480
1084.) 111. 4 Malasatras 443 Begins.--( com. ) fol. 2 c9-9169) artigateMITTE ga: racayiSyAmyamUM vRttimuttAnArthI laghIyasIM // 12 // Ends.--/ text ) fol. 2979 Haath for natui etc. as in No. 1081. ,, -(com. ) fol. 297o gars etc. up to MATEESWAITA as in No. 1082. This is followed by istanta Festa: 11 g: 11 etc. N. B.-For other details see No. 1081. AvazyakasUtraniyukti Avasyakasutraniryukti laghuvRttisahita with laghuvrtti No. 1084 630. 1892-95. Size.-- 144 in. by in. Extent.-- 189 folios ; 28 lines to a page ; 40 letters to a line. Description.-- Country paper thick, tough and white ; Devanagari characters; big, legible, uniform and good hand-writing; borders unruled; foll. cloih-bound; red chalk and yellow pigment used; nos. for foll. i to 126 and those for 169 to 189 entered twice as usual ; but foll. 127 to 168 not numbered even once; a very thick and black paper preceding fol. 1'; two such papers following fol. 189; fol. 1898 half blank and fol. 1896 completely blank; this Ms. contains the text and the commentary as well; both complete ; extent 12325 slokas; condition excellent. Age.- Modern. Begins.-( text ) fol. 1a facraticuato etc. as in No. 1081. >> - (com.) fol. 1a FA: VATTAIFT: 1 a: starta etc. as in No. 108r. Ends.-- (text ) fol. 1898 af fa and etc. up to file as in No. 1081.

Page #481
444 Jaina Literature and Philosophy (1084. Ends.--( com. ) fol. 1894 gav FTE etc. up to aih: as in No. 1081. This is followed by TT 373741 karakRtamaparAdhaM kSatumarhanti santaH / fi: etc. N. B.-- For further particnlars see No. 1081. AvazyakasUtraniyukti laghuvRttisahita Avasyakasutraniryukti with laghuvrtti No. 1085 219. 1902-1907. Size.-- 109 in. by 44 in. Extent.- 352 + 3 = 355 folios; 13 lines to a page ; 47 letters to a line. Description.- Country paper thin and white ; Devanagari cha racters with qualats; bold, big, legible and good handwriting; borders ruled in three lines in red ink; red chalk and yellow pigment used; numbers for foll. entered twice as usual ; out of the 81 foll., the unnumbered sides decorated in the centre with a circular disc whereas the numbered, in the margins, too; fol. 1a blank ; foll. 83, 110 and un repeated ; the 295th fol. wrongly numbered as 296 in the right-hand margin ; condition very good except that the last fol. slightly damaged; extent 14000 slokas; complete. Age.--- Appears to be somewhat old. Begins.- ( text ) fol. 2a. Brufuatiguard etc. as in No. 1081. , - (com. ) fol. 1b go o il FA: SHUTTALEXT: 1 da: stari usaua etc. as in No. 1081. Ends.-- (text) fol. 3510 pa fa autu etc. as in No. 1081. -- (com. ) fol. 3510 gaie Frii etc. up to FAIATA125ggaan(f#:)' as in No. 108). This is followed by the lines as under:--

Page #482
1086.] II. 4 Mulasutras (tI) rthe vIravibhoH sudharma gaNabhRtsaMtAnalabdhonnati // zrI // gra. 14000 saMkhA ( khyA) / N. B. For further particulars see No. 1081. Avazyaka sUtraniryukti laghuvRttisahita No. 1086 Age. Samvat 1488 (?). Begins. (text) fol. 2a Extent. 282 folios; 17 lines to a page; 40 letters to a line. Description. Country paper tough and greyish; Devanagari characters with gears; small, clear and tolerably good handwriting; borders ruled in four lines in black ink; red chalk used; nos, for foll. entered once in a corner of the right-hand margin; remarks illustrated at times with figures (vide fol. 103b); foll. 281 and 282 repeat what is already written on the preceding foll; they seem to be added later on, though they bear an earlier date; the work becomes complete on fol. 280b; edges of the first fol. slightly damaged; some of the foll. slightly wormeaten; condition good; fol. 1a blank except that a few lines about the contents are written on it. 33 dr -(com.) fol. rb efforafari etc. as in No. 1081. Ends.(text) fol. 280" Avasyakasutraniryukti with laghuvrtti 'namaH zrIpaMcaparameSTibhyaH / deva : zrInAbhisnurjanayatu etc. as in No. 1081. 445 241. A.1882-83. far etc. as in No. 1081. - (com) fol. 28c4 pUrvArddha spaSTaM etc. up to khelatAskRtimAnasa // 12 // as in No. 1082. This is followed by the lines as under:---

Page #483
446 Jaina Literature and Philosophy [1087. cha etc. 'AzApallo dhAstavya prAgvATa'jJAtIya gI-AkAbhAryAmANikadepucyA 'pattana vAstavyacAMpAbhAryA camakUputra zivarAjapatnyA zrI.dhArU. nAmnyA zrIsomasuMdarasUrINAmupadezena saMvat 1488 varSe zrIAvazyakalaghu. vRttilekhitaa|| cha etc. AzApallI etc. up to the end seem to be written in a different hand. Begins.-- ( com. ) fol. 2812 turjagyA prathamo bhaMgaH // zuddhaH / dvayorapyajAnato rNtyo'shuddhH| madhyamayorvibhASA etc. - (niyukti ) fol. 282 savvesi pi nayANaM etc. - ( com.) fol. 2824 pUrvAdha spaSTaM etc. up to khelatAt kRtimAnase as in No. 1082. This is followed by the lines as under: cha etc. saMvat 1458 varSe phA(la)guNa zudi 6 budhe 'staMbhatIrthe' likhitaM / chH|| N. B.-- For further details see No. 1081. AvazyakasUtraniyukti Avasyakasutraniryukti TIkAsahita with tika 133, No. 1087 1873-74. Size~ 104 in by 44 in. Extent.-- (text) 124 folios; 7 to 15 lines to a page; 35 letters to a line , -- (com.) ,, , ; 27, 29 , , ,, ,, ; 56 ,, ,, , , Description.- Country paper thin and greyish; Devanagari cha racters with pRSTamAtrAs: this is a pazcapATI Ms.; the handwriting for the text bigger than that for the commentary ; both legible and good ; each of the columns has its borders ruled in four lines in black ink, with the intermediate portion coloured red; unnumbered sides have a disc in the centre in red colour whereas the numbered ones, in the margins, too ; a blank fol. is affixed to fol. 1a; same is the case with fol. 124deg; fol. I'_blank ; red chalk used ; some of the foll. present a very nice appearance. e. g. foll. 196, 245 etc.; illustrative tables pertaining to the Jinas and

Page #484
1087.] 111. 4 Malasairas 447 Cakravations given on fol. 43b ; corners of some of the foll. slightly damaged; condition good; this Ms. contains niryukti as well as its commentary; both complete. Age.- Old. Author of the commentary.--- Not mentioned. Subject -- The niryukti along with its explanation in Sanskrit. Begins.--- fol. 1deg e* namaH zrIvItarAgAya namaH // OM namaH zrIsarasvatyai namaH // etc. OM namaH zrIgaNezAya namaH // cha etc. - fol. 2 zrIvItarAgAya nmH| ___ namo arihaMtANaM etc. - (text ) iol. 2' jayai jagajIvajoNI etc. ,, --(com. ) fol. 10 e OM namaH vItarAgAya | prekSAvatAM pravRttyarthamAdau prayojanAdikamupanyasyanIyaM etc. Ends.-- ( text ) fol. 1246 savvesi pi nayANaM etc. up to sAhU 90 // iti paJcakkhANanijjuttI saMmattA | samAptedaM zrIAvazyakaM / ,, --- ( com.) fol. 124 sarvaviratisAmAyikadvayamevecchati nanu kimatra tamU (?) ucyate // 74 !! sabve deg tat sarvanayavi. sarvanayasaMmataM vacanaM yaccaraNaguNasthitaH sAdhuH / yasmAt sarvanayA bhAvanoktA pa...cchati 75 (?) 631. AvazyakasUtraniyukti Avasyakasutraniryukti avacUrisahita with avacuri No. 1088 1892-95. Size. - IOF in. by 41 in. Extent.-- (text) 96-1+1=96 folios ; 20 lines to a page ; 45 letters to a line. ,, - (com.) 96 folios ; 20 lines to a page ; 66 letters to a line,

Page #485
448 Jaina Literalure and Philosophy [ 1088. Description.- Country paper rough and white ; . Devanagari cha racters with occasional pRSThamAtrAs; it is a tripATI Ms.; the text written in the middle in a bigger hand ; legible and good hand-writing ; borders ruled in four lines in black ink; red chalk and yellow pigment used; the first fol. lacking ; the second repeated; fol. 2 commencing with the 4th gatha of Fulertrant; about a half of the second fol. worn out ; strips of paper pasted to several foll. ; some of the foll. more or less worm-caten ; condition very fair; heights and life-periods of the 24 Tirthamkaras and 12 Cakravartins tabulated on fol. 58b; diagrams on fol. 82deg; both the text and the commentary ending abruptly; complete up to the namukkAranijjutti and its commentary. Age.- Pretty old. Author of the avacari.-Not known. Subject.....The Niryukti along with its explanation in Sanskrit. Begins.-- ( text ) fol. 2a guNabhavaNagahaNa suarayaNabhariya daMsaNavisuddharatthAgA / saMghanagara bhadaM te akkhaMDacarittapAgArA // 4 // etc. __,, -- ( com.) fol. 21 paDibhA abhiggahA vi a uttaraguNA me viaannaahe(hi)||1|| guNA eva bhAvanA......darzanaM samyaktvaM tadevAsAri mithyAtvAdikacavarahitA vizuddhATacyA mArgAya....nusAreNa dIrghatvasUcanA dIrdha nirdezo yathA goyamA / he saMghanagara 0 bhadraM te etc. Ends.-fol. 96deg ( text ) jaM vattaNAirUvo kAlo davANa ceva pjjaao| teNa tassa taMmi niviruddhaM savvahA karaNaM // 32 // ahaceha kAlakaraNaM bacAi joisiakAlakaraNeNaM / sattavihaM tattha cira cao vi. This ends thus abruptly. ,, - (com.) fol. 96' bahudeg uktaM kAlakaraNaM / bhAvakaraNamucyate etc. ucyate iha bhAvAdhikArAt paryAyaprAdhAnyaM zrutasya jIvabhAvAt / zrutabhAvakaraNaM nozrutakaraNaM. This ends thus abruptly.

Page #486
* Ill. 4 Malasatras 449 1089.] AvazyakasUtraniyukticUrNi No. 1089 Avasyakasutraniryukticurni 1167. 1884-87. Size.-- 104 in. by 41 in. Extent.-- 51 + i = 512 folios; 13 lines to a page; 46 letters to a line. Description.- Country paper thin and greyish; Devanagari cha racters with occasional pRSThamAtrA ; sufficiently big, legible and good hand-writing ; borders neatly ruled in three lines in red ink ; foll. numbered in the right-hand margin ; fol. ra blank; edges of the first and the last foll. slightly worn out; foll. 100 to 178, 247 to 26r and 389 to 395 have their margins more or less worm-eaten ; a small hole on the last fol.; so two letters are gone; condition tolerably good ; lacunae on fol. 166; red chalk used ; information about the 24 Tirthamkaras tabulated on foll. 1196 and 120* ; fol. 353 repeated; white paste used; of course, rarely ; complete. Age.- Samvat 1620. Subject.- A commentary in mixed languages viz., Sanskrit and Prakrit elucidating the niryukii on Avasyakasutra. Begins.- fol. 1 namo arihaMtANaM etc. up to sabbasAhUNaM as in No. 731. This is followed by the lines as under : kAUNa NamokAraM titthakarANaM tilokamahitANaM / AyariyauvajjhAyANaM NamiUNa ya savvasAhuNaM // 1 // koti sIso Ayariyakuva(lolA(vA?)sI / jAtikularUvasU(su)yAyArasatta viNayasaMpaNNA(?NNo) Na durAMchao etc. Ends.-- fol. s11b evamAdi paraloe / aNugamo sNmtto| iyANi nayA te ya jahAputvaM tattha duve nyaa| te ya jahApuvvaM / tattha "tayA / ajjhayaNaNato ya (karaNaNato y)| ajjhynnnnto| NIyammi gihiyabve gaathaa| karaNaNato ya / samvesi pi

Page #487
450 Jaina Literature and Philosophy [1090. ri | gAhA / AvassaganijjuttiSuNNI saMmattA | cha / saMvat 1620varSe Aso vadi 8 budhe 'zrImAlI 'jJAte sAhAzaMghadattatatsutasAhAkAMhAnAliSyApitaM || zrIa ( u ) pAdhyA (ya) zrIgaja khAra paThanArthe etc. Reference. This work is published in two parts by Rsabhdevaji Kesarimalji Svetambara samstha, Rutlam, in A. D. 1928 and 1929 respectively. Avazyaka sUtrafaying ri No. 1090 Size. 10 in. by 41 in. Extent. 351 1 = 350 folios; 15 lines to a page; 60 letters to a line. Age. Not later than Samvat 1774. Begins. fol. Description. Country paper thin and greyish; Devanagari characters with occasional HITS; sufficiently big, legible and very good hand-writing; borders ruled in three lines in red ink; nos. of most of the foll. written twice as usual; red chalk used; foll. 1a and 3516 blank; the heights and the life-periods of the 24 Tirthamkaras tabulated on foll. 81 and 82; fol. 197 wrongly numbered as 198; for, there is a continuity of matter so far as foll. 196b and 198a are concerned; fol. 279 wrongly numbered in both the margins as 179; some lacunae on foll. 237 and 282b; foll. 341 etc. numbered only once and that too, as it seems in a different hand; complete; a piece of paper of the same size as the fol. pasted to fol. 12; same is the case with fol. 351b; condition excellent. Avasyakasutraniryukticurni mt starimq: | ggest an: || 129. 1873-74. namo arihaMtANaM etc. up to sabasAhUNaM as in No. 1089. This is followed by 130 admi fawr etc. as in No. 1089.

Page #488
1091.1 III. 4. Malasatras 451 Ends.--fol. 351" evamAdi paraloe etc. practically up to sammattA as in No. 1089. This is followed by the line as under :-- cha || zubhaM bhavatu etc. graM. 19 ( ? ) hazrUH ( 2 ) // etc. Then in a different hand we have :-- saMvata 1774 va. paM. dIpavijayagaNinA AvakacauNa patra 351 paM.zrI nyAyasAgaragaNinA pradattA etc. N. B. For further particulars see No. 1089. Avazyaka sUtrafagian grot No. 1091 Size.-- 11 in. by 5 in. Extent. 372-6-7-1 - 3-6 + 1 = 350 folios; 17 lines to a page; 46 letters to a line. Avasyakasutra niryukticurni Description. Country paper rough and white; Devanagari characters with TTS; sufficiently big, legible and very good hand-writing; borders ruled in four lines in black ink; nos. for foll. entered twice as usual; foll. 1a and 372b blank; edges and corners of the first few foll. slightly worn out; some of the foll. more or less damaged owing to their being worm-eaten; fol. 112 partly torn; several foll. have their upper portion somewhat gone; condition fair; names of the Tirthankaras and the Cakravartins along with their heights etc. tabulated on fol. 87b; fol. 258 repeated; foll. 5, 6, 25, 51, 97, 118, 144-150, 168, 205-207 and 341-346 lacking; hence incomplete. Age. Samvat 1661. Begins. fol. r.: engo etc. as in No. 1089. 367. 1880-81.

Page #489
Jaina Literature and Philosophy [1091. Ends.--fol. 372a evamAdi paraloe etc. up to saMmattA as in No. 1090. This is followed by the lines as under :-- cha / zubhaM bhavatu / saMvat 1661 phAlguNazudi 5 budhavAsare ojhArudra - likhitaM // graMthAgraM 18000 pramANA vAcyamAnA ciraM na ( naM) yAdA caMdrArke / zrIrvarNabhramaNa saMghasya // cha // (s) For other details see No. 1089. 452 N. B. AvazyakasUtra niryuktavacUri No. 1092 Size 10 in. by 4 in. Extent. 116 folios; 17 lines to a page; 54 letters to a line. Description.--Country paper thin and greyish; Devanagari characters with occasional S; small, clear and good hand-writing; borders ruled in four lines in black ink; the space between the pairs coloured red; nos. for foll. entered only once; unnumbered sides have mostly a small disc in red colour in the centre whereas the numbered, in the margins, too; red chalk and yellow pigment used; edges of the first fol. slightly worn out; condition very good; complete; composed in Samvat 1440. -- Avasyakasutraniryuktyavacuri Age.-- Not modern. Author. Jnanasagara, pupil of Devasundara of the Tapa gaccha. Subject.--A small commentary to the niryukti having for its basis a bigger commentary (No. 1075) by Haribhadra Suri. Begins. fol. r* jayati iMdriyaviSayaka pAyaghAtikarmaparISahopasargAdizatrugaNaparAjayAt sa vaniSyatizete yazva sarvAtizAyI sa cAvazyaM praNAmAha (I) iti taM prati praNato (s) smIti gamyate / etc. 1092. 1887-91.

Page #490
1093.] III. 4 Malasatras 453 Ends.--fol. II6deg savve0 // tatsarva etc. up to nikSepamicchaMti practically as in No. 1093. This is followed by the lines at under :-- // 71 AcAryazrIharibhadrakRtavRttyanusAreNa zrIAvazyakAvacUriH samAptA // cha / kUTalikhane duHkRtaM mithyA'stu // cha / / zrImat tapA'gaNanabhogaNabhAsvarAbha zrIdevasuMdarayugottamapAdukAnAM / ziSyaiji(ji)nAgamasudhAMbudhilInacittaiH zrIjJAnasAgaraguru(rU)ttamanAmadheyaiH // 1 // khA'bdhiyugeMdumite(5)bde 1440'vacUrirAvazyakasya jayanIyaM / vidadhe bRhAdvivaraNAt zrutabhaktyA svaparAhatahato(:) // 2 // cha / etc. graMthAnaM 9005. Then we have in a different hand : zrIjIvarAjazivarAjakovidAbhyAsamasau pratirmumace citkoze puNyArtha paMDitanIkArSiziSyAbhyAM AvazyakasUtra: niyuktayavacUrNi Avasyakasutraniryuktyavacurni 577. No. 1093 1884-86. Size.- 104 in. by 48 in. Extent.-- 83 folios ; 20 lines to a page ; 64 letters to a line. Description.- Country paper thin, rough and grey; Devanagari characters with pRSThamAtrAs; small, clear and good hand-writing; borders mostly ruled in three lines in red ink; red chalk used ; foll. numbered in the right-hand margin ; edges of the first fol, and those of the last too, slightly worn out; the first three foll. worm-eaten ; condition on the whole very good ; complete. Age.- Pretty old. Begins.- fol. r* namaH sarvajJAya /

Page #491
454 Jaina Literature and Philosophy [1093. prANipatya jinavareMdraM vIraM zrutadevatAM gurun sAdhUna Avazyakasya vRttiM gurUpadezAdahaM vakSye // 1 yadyapi mayA tathA(s)nyaiH kRtA(s)sya (sti) vitistathApi saMkSepAta tadrucisattvAnugrahahetoH kriyate prayAso(5)yaM // 2 ihAvazyakaprAraMbhaprayAso'yuktaH prayojanAdirahitatvAt kaMTakazAkhAmaIna vadityevamAyAzaMkApanodAya prayojanAdipUrva pradarzita ityuktaM ca etc. Ends.- fol. 83deg save0 / tat sarvanayavizuddhaM sarvanayasaMmataM vacanaM yaccaraNaguNa sthitaH sAdhuH / yasmAtsarvanayA bhAvanikSepamicchati // 76 // // iti pratyAkhyAnaniyuktaya'vacarNiH // // zrIAvazyakaniyuktayavacUrNi: AcAryazrIharibhadramarikatavRttyanusAreNa / bhaTTArakaprabhuzrIjJAnasAgara. sUriviracitA samAptA / cha // // cha / bhadraM // N. B.-For other details see No. 1092. AvazyakasUtra AvasyakasutraniryuktayavacUrNi niryuktyavacurni 'No. 1094 1183. 1886-92. Size.- Iog in. by 41 in. Extent.-- 118-1 + 4 = 121 folios; 18 lines to a page ; 66 letters to a line. Description.-Country paper thin and grey ; Devanagari characters with pRSTamAtrAs; small but clear and good hand-writing ; borders ruled in four lines in red ink; edges of the first and the last foll. slightly worn out; foll. 5, 15, 64 and 116 repeated; the 64th fol. has an illustrative diagram ; lacunae on fol. 108b; the fol. following the repeated fol. 116 is numbered as 118; complete ; condition very good. Age.-- Samvat 1516. Author.- Anonymous. Subject.- A small commentary to Avasyakasutraniryukti.

Page #492
1095.j Begins. fol. 1 N namaH zrIpravacanAya || IlI. 4 Mulasutr as Avazyaka sUtraniryuktibAlAvabodha No. 1095 Ends. fol. 1174 sabve0 // tat sarvanayavizuddhaM sarvanayasaMmataM vacanaM // yaJcaraNaguNasthitaH sAdhuH // yasmAtsarvanayA bhAvanikSepamicchati // 75 // iti pratyAkhyAnAni (ni) ryuktavacUrNiH sA ( sa )mAptA ceyaM zrIAva zyakazrutaskandhaniryuktayavacUrNiH // cha // // cha // 1516 varSe caitra 7 // || zubhaM bhavatu // cha // maMgalamastu // cha // 1 // 1 // saM0 prekSAvatAM pravRttyarthe || Adau prayojanAdikamupanyasanIyamanyathA na yukto'yamAvazyakaprAraMbhaprayAso niHprayojanatvAt etc. 455 Avasyakasutraniryuktibalavabodha Size. -- 117 in. by 44 in. Extent.-- 311 + 1 = 312 folios; it lines to a page ; 48 letters to a line. Begins. fol. rb OM namo zrIgaNezAya / Description.- Country paper thin and greyish; Devanagari characters; big, legible and good hand-writing; borders ruled in four lines in black ink; the portions between the pairs of lines coloured red; nos. for foll. entered twice as usual ; complete; there is at least a disc in the centre of each fol. in red colour ; red chalk and yellow pigment used; fol. ra blank ; fol. 102 repeated; the gathas of the niryukti are written in the margins; edges and corners of the first and last few foll. worn out; condition fair. 1090. 1887-91. Age.-- Sarvat 16100 ( 1610 ?). Subject. A commentary on Avasyakasutraniryukti partly in Sanskrit and partly in Gujarati, the latter being practically the translation of the former. jaya jaga | bha( ga )vAn jayati / bhagavaMta paramezvara jayavaMta varttaI / kiMviziSTo bhagavAn jagajjIvayonivijJAyakaH / jaga vizva taNA jIva tehanI yoni utpattisthAnakAH [vi.] vizeSiha kA jANaI chaDa etc.

Page #493
456 Jaina Literature and Philosophy [ 1095." Ends. fol. 3114 yata caraNaguNasthitasAdhurbhavatIti kathyate / yat je vacana caraNa cAritra taNA guNanahaM viSai sthitaH bhaNIi rahiu sAvadhAna sAdhubhavati mahAtmA hui / iti rasiuM kathyate kahIi / etalaI gure ima kahiuM / saghalAi nyAya jUjUraM bolai / jJAnavAdI jJAna thApar3a | kriyAvAdI kriyA thApai / paNi saghalAM nyAya taNu tattva e / jaM zuddhacaritravaMta mahAtmA vakhANIi / jeha kAraNa sUghauM cAritra tehai jinaI hui / je jJAnavaMta hui / eha kAraNa jJAnavaMta zuddhacAritrI RefreSTa jANivu / e sarva nyAya taNuM tattva jANivu / iti zrIAvazyaka sUtrasya bAlAvi (va) bodha samAptaM / zrIrastu etc. saMvat 1610[0] varSe vaizApavadi 3 zukre ma0 govAla likhitaM zrI' sAdhupUrNimA' pakSe mukSa ( khya) bhaTTArakazrI udaya caMdrasUri tatpaTTe pu (pU) jyArAjya(dhya ) zrImunicaMdrasUri tatpaTTe gacchAdhirAjagacchabhAradhuriMdharazrIzrIzrIvidyAcaMdra (?) riM eSA pustikA likhApitA || sarveSAM zazyAnAM vAcanArthaM etc. - Avazyaka sUtra niyuktidIpikA No. 1096 Avasyakasutraniryuktidipika Size.--rog in. by 4g in. Extent. - 423 folios; II lines to a page ; 42 letters to a line. Description.-- Country paper thin and greyish; Devanagari characters with pRSThamAtrAs; big, legible and good handwriting; borders ruled in four lines in black ink ; nos. for foll. entered only once ; foll. ra and 423b blank ; diagrams on fol. 13b ; foll. 65 and 66 damaged in the margin ; condition very good; complete. 373. 1879-80. Age.--- Sarvat 1633. Author.- Manikyasekhara Suri, pupil of Merutunga Suri of the Vidhipaksa. For his other works see " Ends " (p. 457 ). Subject.-- Avasyakasutraniryukti explained in Sanskrit.

Page #494
1096.] Ill. 4 Malasatras 457 Begins.- fol. xb namaH zrIvardhamAnAya / zrImadgacchezamerutuMgamarigurubhyo nmH|| zrIAvazyakasUtraniyuktiviSayaH prAyo durgapadArthaH / kathAmA niyuktyadAhRtaM ca likhyate / iha zrIdevavAcaketyaparanAmA devaddhigaNirjJAnapaMcakarUpaM ni(na)digraMthaM vaktukAmo maMgalArtha pUrvamAvalikA abhidhitsuH sAmAnya to'haMstutimAha / jayai | stutirdvidhA etc. Ends.- fol. 4223 atha pramANamAha / save sarveSAmapi nayAnAM naigamasaMgrahAdInAM jJAnadvayasaMgRhItAnAM bahuvidhAM vaktavyatAM nizamya tatsarvanayavizuddhaM sarvanaya saMmataM jJeyaM / yatsAdhuzcaraNaguNavyavasthitazcAritrakriyAjJAnasthitaH syAta yatpUrva jJAte gRhItavye cArthe yatitavyameva / pazvAkriyAyatnaH kArya eva tatazcAritraM yataH sarvanayA bhaavnikssepmicchNti| bhAvazca ratnatrayA. rAdhanaparaH sAdhuH / 70 / ___ iti pratyAkhyAnaniyuktiH samAptaH // cha te zrI aMcala'gacchamaMDanamaNizrImanmaheMdraprabha___ zrImarIzvarapaTTapaMkajasamullAsollasadbhAnavaH / tarkavyAkaraNAdizAstraghaTanAbrahmAyamANAzvi(zci)2 zrIpUjyaprabhumerutuMgaguravo jIyAsurAnaMdadA // 1 // tatziSya eSa khalu sariracIkarat zrI mANikyazekhara iti prathitAbhidhAnaH / caMcadvicAracayacetanacArumenAM . sahIpikA suvihitavratinAM hitAya // 2 eSA zrIAvazyakaniryuktedI(dI)pikA ciraM jayatAt / muninicayavAcyamAnA tamoharA dIpikA piNddniyuktrodhniyuktidiipikaa| dazavakAlikasyApyuttarAdhyayanadIpike // 3 // AcAradIpikA navatattvavicAraNaM tathA [ya] ekakartRkatayA graMthA amI asyAH sahodarAH // 4 / / iti 'vidhipakSya mukhyAbhidhAnaM zrImadaMcalaM gacchAdhirAjamugurusuvihita. cakravartizrImanmerusuMgamUrIMdrakramakamalamarAlaziSyazrImANikyazekharamUrivira citA zrIAvazyakaniyuktidIpikA samAptA[:] // zubhaM bhavatu etc. saMvat 1633 varSe bhAdravA vadi 13 dine laSitaM // yAdRzaM pustakaM etc. 58 LI.L.P.1

Page #495
458 Jaina Literature and Philosophy [ 1097. AvazyakasUtraniyukti AvasyakasutraniryuktilaghuvRtti laghuvitti 167. No. 1097 1866-68. Size.- Iod in. by 4g in. Extent.-- 152 folios ; 17 lines to a page ; 54 letters to a line. Description. - Country paper tough and grey; Devanagari:cha racters with occasional pRSTamAtrAs; small, legible and good hand-writing ; borders ruled in four lines in black ink ; red chalk and yellow pigment used ; nos. for foll. entered only once, and that, too, just in the right-hand corner, at the end of the fol. ; almost all foll. more or less worm-eaten ; condition poor ; cloth-bound; two foll. preceding the Ist and two following the last blank ; they bear the stamp of the Elphinstone College Library; fol. 1526 blank ; com plete; extent 13000 slokas. Age.- Fairly old. Author.-- Not known. Subject.-- A commentary in Sanskrit to the niryukti on Avasyaka sutra. Begins. - fol. 1 prekSAvatAM pravRttyartha Adau prayojanAdikamapanyasanIyamanyathA na yukto'mAvazyakaprAraMbhaprayAso niHprayojanatvAta kaMTakazAkhAmaInavat nirabhidheyatvAt kAkadaMtaparIkSAvat asaMbaddhatvAt daza dADimAni ityAdi dhAkyavat etc. Ends.-fol. 152deg savve 0 / tatsarvanayavizuddhaM sarvanayasaMmataM vacanaM yaccaraNayaNasthitaH sAdhuH yasmAt sarvanayA bhAvanikSepamicchati // 75 iti zrIAvazyake nA lghuvrttaiH| chaH / etc. graMthAnaM 13000 cha etc. - 1 The opening lines may be compared with those of No. 1094.

Page #496
256. 1098.] III.4 Malasatras 459 AvazyakasUtraniyuktayavacU]i Avasyakasutraniryuktyavacurni No. 1098 1883-84 Size.-- 104 in. by 45 in. Extent.--83-2=81 folios ; 2r lines to a page ; 70 letters to a line. Description.- Country paper rough and greyish ; Devanagari cha racters; small, legible and very good hand-writing; borders ruled in four lines in black ink; red chalk used; numbers for foll. entered only once ; foll. I and 2 lacking; this Ms. ends abruptly; it is however complete up to the commentary of the 65th gatha of pratyAkhyAnaniyukti ; foll. 25 to 34 and 38 to 82 more or less worm-eaten ; edges of the 2nd and 83rd foll. worn out; condition fair. Age.- Old. Author.- Not known. Subject.- A small commentary in Sanskrit elucidating the niryukti ____of Avasyakasatra. Begins.-fol. 3*sAn / oghazrutaM tat samAcaratIti zrutasamAcArakAn // 40 // goviM0 tatto0 etadgAthAdvayaM vRttau nAsti / tato goviMdAcAryebhyo namo'stu / anuyoge'rdhakathane etc. devavAcako vakSye // 50 // iti sthavirAvalyava cUrNiH Ends.- fol. 83deg tRSNA viSayacchA // 64 ||...vccheden atulopazamo madhyasthabhAvaH / manuSyANAM ... // 65 // tatto tataH pratyAkhyAnAt zuddha ... sphurite / tataH karmavivekaH karmanirjarA / tataH krameNa pUrvakaraNamapUrvazrutAdhyavasAya | tataH This ends thus abruptly. Reference.-- See R. G. Bhandarkar's Report for 1883-84.

Page #497
460 130. Jaina Literature and Philosophy [1099. AvazyakasUtravRtti AvasyakasutravrttipradezavyAkhyATippanaka pradesavyakhyatippanaka No. 10991 1873-74 Size.-- 114 in. by 4.} in. Extent.-- 62 folios ; 17 lines to a page ; 75 letters to a line.: Description.-- Country paper thin and brittle ; Devanagari cha racters with TTATEIS; small, legible and good handwriting; borders ruled in four lines in black ink; yellow pigment and red chalk, too, used; nos. for foll. entered twice as usual; edges of several foll. worn out; small bits of paper pasted to fol. 285, last few foll. much damaged ; strips of paper pasted to foll. 59 and 60; condition on the whole poor ; complete ; extent 4600(?) slokas. Age.-- Not later than the 17th century. Author.-- Hemacandra Suri, disciple of Abhayadeva Suri. For his life and works see Anandasagara Suri's introduction ( pp. 9-10 ) of Jivasamasa. There this Suri has quoted a few lines from the Visesavasyakavstti. From this we can see that this Hemacandra has composed the following works : (1) 21:47@qaar, (2) Taurapu, ( 3 ) BUTTERalat', ( 8 ) STRAST, (5) 39EUR TARGETE, (6) HUQAAFfaarur, ( 7 ) Harar, ( 8 ) aaraatiatur, ( 9 ) argiewqata * and ( 10 ) fagrastaraTTU ( Samvat 1175 ). 1 Really speaking, this and the following work No. 11oo ought to have been assigned a place after No. 1078. 2 This is the same work as described here. 3 See Nos. 635-641. 4 This work seems to be lost. It is alluded to in Anuyogadvaravolt: (p. 26). The pertinent line is as under:

Page #498
1099.1 III. 4 Malasairas 461 Subject. A gloss on the commentary to Avasykasutravrtti composed by Haribhadra Suri. Begins.-- fol. ra N namo vItarAgAya || jagattrayamatikramya sthitA yasya padatrayI / viSNoriva tamAnamya zrImadAyajinezvaraM // 1 // zeSAnA namaskRtya jinAnajitapUrvakAn / zrImato vardhamAnAtAna muktizarmavidhAyinaH // 2 // samupAsitagurujanataH samadhigataM kiMcidAtmasaMsmRtaye / saMkSepAdAvazyaka viSayaM TippanamahaM vacmi // 3 // etc. Ends. fol. 625 sAMprataM kulmASAnAbhityAcAmlaM prAyogyaM ca didarzayiSurAha // kummAsA puNa putvamityAdi / saktUnAzrityAha / satugA javANamityAdi subodhaM navaraM godhUmayavabhA (? bhU ) jjikA dhANikAH zeSaM prAyaH sugamaM / yAvatpratyAkhyAnaniryuktiH samApteti // cha // tatsamAptau ca zrImadabhayadevasUricaraNAMbujacaMcarIkazrI hemacaMdrasUriviracita AvazyakavRttipradezavyAkhyATippanakaM samAptamiti // cha || iti gurujanamUlAdarthajAtaM svabuddhyA yadavagatamihAtmasmRtyupAdAnahetoH / tadupacaritametadyatra kiMcitsadoSa afe kRtagutoSaistattu zodhyaM munIMdraiH // chadmasthasya hi mohaH kasya na bhavatIhi mohavazagasya / buddhivirahitAnAM vizeSato madvidhAsutAM || iti / cha / graM. 46...? This is followed by the lines in a different hand as under:saMvignenAMlipadA 'tapa' gaNapativijaya sena sUrINAM / zrIrAmavijayakRtinA citkoze pratiriyaM muktA // 1 // Reference.-Published in D. L. J. P. F. Series as No. 53 in A. D. 1920.

Page #499
462 Jaina Literature and Philosophy [1001. AvazyakasUtravRtti AvasyakasutravrttipradezavyAkhyATippanaka pradesavyakhyatippanaka No. 1100 140. 1881-82. Size.- 101 in. by 4i in. Extent.-- 97+1=98 folios ; 15 lines to a page ; 52 letters to a line. Description.-- Country paper thin and white ; Devanagari chara cters with occasional A rs; small, legible and very good hand-writing ; borders neatly ruled in three lines in red ink; nos, for foll. entered twice as usual ; foll. 1a and 97" blank; fol. 73 repeated ; edges of the first and the last foll. slightly worn out ; condition very good ; com plete; extent 564 slokas. Age.- Not modern. Begins.-- fol. zB FAT affatrite TATAIFFT etc. as in No. 1099. Ends.- fol. 97a pista parar etc. up to ghai gfar as in No. 1099. __This is followed by graMthAnaM 564 / zubhaM bhavatu etc. N. B.--For further particulars see No. 1099. AvazyakasUtravRtti Avasyakasutra vrttiviSamapadaparyAya visamapadaparyaya No. 1101 736 ( 18). 1875-76. Extent.-- fol. 17deg to fol. 236. Description.- Complete. For other details see Pancavastuka paryaya No. 1875-76. Author.- Anonymous. Subject.-- Difficult words etc. occurring in Avasyakasu travstti explained in Sanskrit. paryaya No. 736 (I).

Page #500
1102.] III. 4 Malasatras 463 Begins.--- fol. 17deg 9 jinetyAdi jinAH kSINopazAMtamohanIyakarmANazchadmastha vItarAgAH / kevalinaH aSTamahAprAtihAryAdIMdra tatkAraNatvAt zravaNakAraNa tvAt tadavAte. jJAnakriyAvyApteH / etc. Ends.- fol. 23 iti haDaphau dezamUlaguNa iti zrAvakavratAni / vaudhagoviMda iti ekaviMzativArAn / pravrajita ityAmnAyo draSTavyaH / ityAvazyakavRttiviSamapadaparyAyAH samAptAH // AvazyakasUtravRtti AvasyakasutravrttiviSamapadaparyAya visamapadaparyaya 789(18). No. 1102 1895-1902. Extent.- fol. 26deg to fol. 384. Description.- Complete. For other details see Pancavastuka paryaya No.,789 (1). 1895-1902. Begins.- fol. 26deg 3 jinetyAdi jinAH / kSINopazAMta etc. as in No. IION. - fol. 34deg kathaM mAsetyAdi / vihANAtIti bhedA / ANa tti AjJA kAyaviyA iti karttavyA / pUrva draSTavyamiti bhAvaH // cha / AvazyakatteviSamapadaparyAyAH samarthitAH // cha / - fol. 34* maMgyate aneneti maMgaM dharma / saMzayata iti saMdeho dvidhA arthasaMdeho'narthasaMdehazca / sUtropadiSTamiti sUtraM / naMdI / etc. - fol. 35 aviveti pUrvavidhaH pUrva / evamiti vakkhANavihI / dAravihI / virubhai iti laggai vidhAna iti bhedataH / lehavaNamiti AvazyakATippaNakaM Ends.- fol. 38 iti haDaphau / dezamUlaguNa etc. N. B.-For other details see No. 1101.

Page #501
464 vizeSAvazyakabhASya (visesAvassayabhAsa ) No. 1103 Jaina Literature and Philosophy [ 1103. Visesavasyakabhasya (Visesavassayabhasa) Size.-9 in. by 4 in. Extent. 122 + 2 = 124 folios; 15 lines to a page; 45 letters to a line. Description. Country paper thin and greyish; Devanagari characters with gears; small, bold, clear and good handwriting; borders ruled in four lines in black ink; red chalk used; yellow pigment, too, though very rarely; foll. numbered in the right-hand margin; fol. 1a blank; marginal notes on fol. 1; fol. 30 repeated; the last but one line of the last fol. thrice scratched with black ink; edges of the last three foll. and those of the first fol. partly worn out; condition very fair; complete. Age. Samvat 1458. Author. 1256. 1887-91. Jinabhadra Gani Ksamasramana. He is said to have died in Vira Samvat I115. He is the author of the following works: (i) Sanskrit commentary of Visesavasyakabhasya, (ii) Brhatsangrahani, (iii) Ksetrasamasa, (iv) Visesanavati, (v) Dhyanasataka, (vi) Jitakalpa and (vii) Nisithabhasya. The authorship of the last work is somewhat doubtful. P. 468. See Subject. This important work is a metrical commentry in Prakrit elucidating Bhadrabahusvamin's niryukti on Samayikadhyayana, a part of Avasyakasutra. Vasavadatta and Tarangavati are alluded to in this work. That is what strikes me at present. Begins. - fol. rb namaH zrutadevatAyai // bruarNapaNAmo vocchaM cara(Na) guNasaMgahaM sayalaM / AvasyANuogaM guruvaesAnusAreNaM // 1 etc.

Page #502
1104.] III. 4 Malasatras 465 Ends.- fol. 1224 iya parisamApitamidaM sAmAiyami(ma)tthao samAseNaM / vittharao kevaliNo putvavihU(? o) vA pabhAsaMti // savvANuogamUlaM bhAsaM sAmAiya(ssa) soUNa / hoi parikammiyamaI joggo sesANuogassa // 4314 iti vizeSAvazyakasUtraM samAptaM // cha / saMvat 1458 varSe mArgazara* zudi 7 zanau adyaha zrImada(da)Nahalapure nagare vAcanAcAryajayakIrtimizrAvAcanArtha 'prAgvATa'jJAtIyamaharAmAkena pustikA likhitaa| lekhaka pAThakayoH // zivamastu // cha / / cha // cha / graMthAgraM 5000 mAjanai // Reference.- Published in the Yasovijaya Jaina Granthamala. Publi shed along with Maladharin Hemacandra Suri's commentary in the same series in 7 parts in Vira-Samvats 2437, 2438, 2438, 2438, 2439, 2439 and 2440 (?) respectively. Also published with Kotyacarya's commentary by Rsabhdevji Kesarimalji Svetambara-Samstha, Rutlam, in two parts in A. D. 1936 and 1937 respectively. Its Gujarati translation based upon Hemacandra's commentary has been published in two parts by the Agamodaya Samiti in A. D. 1924 and 1927 respectively. This Samiti has also published an alphabetical index of the gathas of this bhasya in A. D. 1923. For additional Mss. see B. B. R. A. S. vols. III-IV, p. 396 and G. O. Series vol. XXI, pp. 9 and 13. vizeSAvazyakabhASya Visesavasyakabhagya 1336. No. 1104 1886-92. Size.- 10 in. by 41 in. Extent.-- 84 folios ; 15 lines to a page ; 56 letters to a line. Description.- Country paper thin and grey; Devanagari charac. ters with pRSThamAtrAs; neither too big nor too small, legible and good hand-writing ; borders ruled in four lines in black ink; fol. I blank ; yellow pigment used ; numbers

Page #503
466 Jaina Literature and Philosophy [ THos. for foll. entered twice as usual ; the 84th (last) fol. slightly torn ; its edges worn out; condition on the whole good ; complete. Age.-- Seems to be old. Begins.-- fol. I' jai namaH zrIjinabhadragaNikSamAzramaNebhyaH / / kayapavayaNappaNAmo etc. as in No. 1103. Ends.-- fol. 84deg3600 // iya parisamApiyamiyaM etc. up to sesANuogassa as in No. 1103. This is followed by the lines as under :iti samAptaM zrIvizeSAvazyakasUtraM / graMthAnaM gAhA 3672 zrutasalilapAthodhaye kutrApyapratihatabuddhaye jagajjatusaMtatirvihite(?) kAMtikAtyaMtika(?) samAdhAya | bhASyaratnarohaNAya lasadguNAya bhagavate zrIjinabhadragaNikSamAzramaNAya namaH // cha / // shriiH|| zubhaM bhavatuH // kalyANamastuH ||ch|| / / shriiH|| leSakapAThakayo / cha / / / / N. B.- For other details see No. 1103. vizeSAvazyakabhASya Visesavasyakabhasya 56. No. 1105 1880-81. Size.- 25 in. by 2 in. Extent.-131 (2) leaves ; 4 to 6 lines to a leaf; 124 letters to a line. Description.- Palm-leaf thin and greyish ; Devanagari characters with pRSThamAtrAs; small, legible and very good hand-writing : this Ms. presents an appearance of the work having been written in three separate columns; but really it is not so since the lines are continuous; borders not ruled ; there are two holes in each leaf in the interspaces between the columns; red chalk used ; leaves numbered in both the margins as usual ; the first leaf seems to be missing or misplaced ; since the leaves are in a poor condition, with edges worn out in several places, it is not advisable

Page #504
1106. ] 11. 4 Malasatras 467 to make a search for it ; otherwise the work complete ; two wooden boards encompass the Ms.; 4336 verses. Age.- Fairly old. Begins.-- leaf 2a (natthi) visasatthaMtarabhAvAo so khapuSpaM va // jaM aigamazvahArA loyatvavahAratapparA so ya / pAraNa visesamau(o) to te taggAhiNo do vi // Ends.-- leaf 1316(?) ___ hoi parikammiyamatI jogo(ggo) sesANuyogassa // 4336 Pastaras H16T FATE ... ... Aves AET ... ... N. B.- For further particulars see No. 1103. vizeSAvazyakabhASya Visesavasyakabhasya vyAkhyAnasahita with vyakhyana 57. No. 1106 1880-81. Size.-- 25} in. by 2 in. Extent.- 332 leaves; 5 to 7 lines to a leaf; 120 to 140 letters to a line, Description.- Palm-leaf brittle and greyish; Devanagari chara cters with A TS; big, legible and good hand-writing; this Ms. presents an appearance of the work having been written into three separate columns; but really it is not so ; borders not ruled ; this Ms. contains probably both the text and the commentary, some of the leaves broken ; some damaged ; condition on the whole poor ; leaves numbered in both the margins : in the right-hand one as 1, 2 etc. and in the left-hand one as for 4 etc.; red chalk used ; complete; extent 13700 slokas. 1 This is the latter half of the 36th verse of the printed edition.

Page #505
468 Jaina Literature and Philosophy (1106. Age.- Samvat 1138. Author of the commentary.- Kotyacarya. Some identify him with Silanka Suri, the commentator of the 1st two angas probably because it is so suggested in Prabhavakacaritra. But Anandasagara Suri refutes this in his Sanskrit introduction (p. 3) to Visesavasyakabhasya edited by him along with Kotyacarya's commentary on it. Subject.-Visesavasyakabhasya explained in Sanskrit. In this Kotya. carya's commentary on the 234th gatha' of Visesavasyakabhasya we come across the words " fatto a&TTA:". Since neither any tradition nor any other evidence seems to suggest that Kotyacarya had composed a bhasya on Nisithasutra, it may be that this ullekha belongs to the svopajna commentary of Visesavasyakabhasya. If so, Jinabhadra Gaai may be looked upon as the author of the bhasya on Nisithasutra. Kotyacarya's remark " STATUTO TITIFATIAS TX:; canada aic#AUSTETTI a u g gfag gava" made by him while commenting upon the 637th gatha of Visesavasyakabhasya on p. 224 leads us to believe that Kotyacarya cannot be a direct pupil of Jinabhadra, and thus it goes against what is suggested in the pattavalis of the Kharatara gaccha noted in Indian Antiquary ( vol. XI, pp. 243-249). For some of quotations which directly or indirectly mention Jinabhata and Jinabhadra see Jinavijaya's intro duction (p. 15 ) to his edition of Jitakalpasutra. Begins.--- (com.) fol. 16 ... ... ... ... Ogreau AMEIBARASesarzt 1 ... hier aglasaia wafa ... ... craqumaa: 1 8944TUCGOTIAT Scute i etc. --(com.) fol. 325" acca 50ETITA E Toh rear garefapurAha / kiM puNarukkamiUNaM joggaM tivihaM tti / tRtIyasthAne karaNasya vyAkhyAna 1 This gatha begins with " T 1742 " and it is 235th according to the printed edition ( Agamodaya Samiti Series ). 2 See the Gujarati introduction (p. 9) to Jinavijaya's edition of Jitakalpasutra.

Page #506
1106.] III. 4 Malasatras 469 kRtaM na tu yathoddezaM nirdeza iti / nyAyAdde (de)bamastu tiviheNaM na karemi na kAravemi kareMta etc. karmaNa iti bhAvArthaH / tathAhi (de)zi(si)tamityAdi / evaM vyatyAsaM kurvatA sUtrakAreNa darzitaM yata sa yogH| karaNavazAniyatamapradhAna iti / kiM kAraNamityAha / tadabhAve karaNa(bhA)ve bhAvAdyogasya tadabhAve cApyabhAvAtkaraNaM karturanarthAntaramiti / kRtvA tathA tassetyAdi / tasya yogasya tadAdhAratvAt karaNAdhAratvAdasau pradhAna iti tAni kAraNamasyeti / tatkAraNastasmAcca karaNapariNatezca yogasya prAdhAnyaM tathA pariNaturanAntarabhAvAkaraNAnAM karaNamevAsau yogaH Aha yadyevasadezo(5)pyevaM kasmAnna kRta ucyate / yogasya pratyAkhyayatvena prAdhAnyakhyApanArthe yata eva ca evaM tasya tadAdhAratA(s)to sarvo gAthAM paThitvA eto ciya ityAdi / ata etasyApi tanmayatA karaNAtmakatA gamyate / kuta ityAha / karaNayogapariNatirUpatvAtsA(s)vagamyate / ha(na)tAM(yAM)tarAtkadAcitkathaMcitsamaye yato(5)bhihitaM / AyA ityAdi / ihAtmaiva paramArthato(5)hiMsA na bAhyA zubhamanoyogapariNAmAdananyatvAdviparyaye viparyayatastathA ca jo ityAdi evaM kartA karma karaNamiti ko(5)yamamISAM vibhAga ucyate / bhaNitamasakadetattathAhi // tasyaiva paryAyA' ... ... Ends.- ( com.) fol. 332deg bhASyaM sAmAyikasya zrutvA sAmAyikasyemA vRttiM zrutvA kiMviziSTAmimAmityAha sarvAnuyogamUlaM sarvAnuyogasya kAraNaM kimata Aha bhavati saMpadyate kaH yogyo bhavyaH kuta ityAha parakammitamatIti etatparikarmitamatitvAdetatprabodhitabuddhitvAt / kasya yogyo bhavatItyata Aha / zeSAnuyogasya dshvkaalikaacaaraaynuyogsyti| samAptamidaM vizeSAvazyakam // cha / kRtirjinabhadragaNikSamAzramaNapUjyapAdAnAM / / cha // bhASyaM sAmAyikasya sphuTavikaTapadArthopagUDhaM yadeta cchrImatpUjyairakAri kSatakaluSadhiyAM bhUrisaMskArakAri / tasya vyAkhyAnamAtraM kimapi vidadhatA yanmayA puNyamAptaM pretyA drAglabheyaM paramaparimitAM prItimatraiva tena || // likhitaM pustakaM cedaM nemikumArasaMjJinA / 'prAgvATa'kulajAtena zuddhAkSaravilekhinA / / vi. saM. 1138 pauSa vadi 7 // koTyAcAryakRtA TIkA samApteti / / graMthAyamasyAM trayodaza sahasrANi saptazatAdhikAni // 13700 / pustakaM cedaM visra(zru)tazrIjinezvarasUriziSyasya jinavallabhagaNeriti / / Reference.--Both the text and the commentary published. See p. 465.

Page #507
470 vizeSAvazyaka bhASya vRttisahita No. 1107 - Jaina Literature and Philosophy Description. Size. 12 in. by 42 in. Extent. 407 212 = 406 folios; 17 lines to a page; 64 letters to a line. Country paper thin and grey; Devanagari characters with quars; big, bold, beautiful and legible hand-writing; borders ruled in two pairs of lines in black ink; space between the two pairs coloured red; red chalk used; a piece of paper of the same size as the fol. pasted to fol. 1a; same is the case with the 407b (last ) fol. ; unnumbered sides have a small circular disc in red colour in the centre, whereas the numbered, in the two margins also; small strips of paper pasted to foll. 2,5, 56 and 100; edges of the foll. 1-7, 19-20, 53, 115-120, 136, 117-150, 179, 203-211 and 391 more or less worn out; foll. 4 and 188 partly torn; fol. 245 badly burnt and foll. 56, 74, 100, 188 and 264 slightly; condition tolerably good; foll. 115 and 268 repeated; fol. 228 is lacking; fol. 278 etc. up to 399 seem to be mistaken for 378, 379 etc. up to 399; these wrongly numbered foll. 378,379 etc. and the rightly numbered foll. 300 etc up to 403 also numbered in the same margin as 1, 2 etc.; the 300th fol. is rightly numbered; the preceding, of course, wrongly numbered as 399; the fol. 331 also numbered as 332 and 333, the subsequent ones hence numbered as 334, 335 etc. [1107. Visesavasyakabhasya with vrtti (text) fol. 1b Age. Seems to be fairly old. Author of the commentary- Maladharin Hemacandra Suri, pupil of Abhayadeva Suri. For his works etc. see No. 1099. Subject. The text along with its Sanskrit commentary. Begins. P etc. as in No. 1103. 1255. 1887-91.

Page #508
111. 4 Malasutras 1107.] Begins.--(com.) fol. r OM namo bhagavate zrImahAvIrAya / zrI siddhArthanareMdra vizrutakula vyomapravRttodayaH / sadbodhAMzunirastadustara mahAmohAMdhakArasthitiH dRptAzeSa kuvAdikauzika kulaprItipraNodakSamo jIyAdaskhalita pratApa taraNiH zrIvarddhamAno jinaH etc. Ends. -- ( text ) fol. 405 b iya parisamApayamidaM etc. up to sesANuogassa as in No. 1103. - ( com. ) fol. 406 kSamo bhavatIti catvAriMzadgAthArthaH 799 pUrva cAdhyavasAneha gaNitAnItyeSA ziSyahitA [na] paryaMtavyAkhyAtagAthAnAM 288 (10) 3 ubhayaM vyAkhyAta bhASyagAthAnAM 3682 zeSANi tu caturdazAdhikasaptazatAni atidezenaiva gatAni na tu vyAkhyAtAni ato neha gaNitAnItyeSA ziSyahitA nAma vizeSAvazyakavRttiH samAptAH // cha // etc. -(com.) fol. 407a va zrI jina bhadragaNeH pUjyAH saitAni bhASyavacanAni / tarkavyatikaradurgANyatigaMbhIrANi lalitAni // 1 vivRtAni svayameva hi kA grAhyA (ss) cAyaizva budhajanapravaraiH saMgacchate va punarapi mamApi vRtteH prayAso ( ( ) tra // 2 RjubhaNitimicchatAmiha tathApi matto ( ( ) pi maMdabuddhInAM upakAra (:) keSAMcitsamIkSyate ziSTalokAnAM // 3 // tenAtmaparopakRtiM saMbhAvya mayA ( s) pi bhASyavRttiriyaM vihitA zruteti bhaktiM ca (zu) bhavinodaM ca ciMtayatA // 4 ce kimapi vitathaM likhitamanAbhogataH kubodhAdvA / tatsarve madhyasthairmayyanukaMpA paraiH zodhyaM // 5 kRtvA ca vivaraNamidaM yat puNyamupArjitaM kiMcit // tenAbhavakSayAdastu jinamate prItyavicchedaH // 6 // graMthAgraM pratyakSaragaNanayA sahasra 28000 // cha || This is followed by the lines in a different hand as under: zrImat 'tapa' gaNagaganAMgaNagaganamaNiprabhaiH svapuNyArthe / vijayAnaMdamunIMzvitkoze (7) sau pratirmumuce // 1 // Reference. - Published. See No. 1103. 471

Page #509
472 Jaina Literature and Philosophy (1108. vizeSAvazyakabhASya Visesavasykabhasya vRttisAhita with vrtti No. 1108 1228 1884-87. Size.-- 11 in. by 4 in. Extent.-- 440 folios ; 18 lines to a page ; 59 letters to a line. Description.- Country paper thin, brittle and grey; Devanagari characters with this ; bold, big, legible and elegant hand-writing ; borders ruled in two pairs of lines in black ink; the space between the pairs coloured red; unnumbered sides have a small circular disc in red colour in the centre, whereas the numbered, in the two margins, also ; several foll. horribly damaged ; a piece of paper of the same size as the fol. pasted to fol. 1a; the second fol. badly torn in three pieces ; the third half torn; fol. 4, 122, 439 and 440 torn in two pieces ; foll. 5-110, 333 and 357-359 very badly damaged ; so they should be handled very carefully; strips of paper pasted to foll. 406, 42*, 469, 466, 47, 482, 499, 509, 51, 569, 59, 614, 64, 656, 76a, 804, 814, 82*, 93, 97", 10rb, and several other foll.; fol. 174 partly torn ; at times nos. for foll. worn out e. g. those of 201, 202 etc.; condition poor; foll. 365-367 also numbered as 1, 2 and 3 in the same margin. Age.-- Pretty old. Begins.--(text) fol. rb Thayer etc. as in No. 1103. -(com.) fol. rb FAT HTTE stagratare il fa fait etc. as in No. 1107. Ends.- (text) tol. 4398 T afhaal etc. up to Foot as in No. 1107. Then the portion is worn out. -(com.) fol. 4400 stistae etc. up to frizia as in No. 1107. This is followed by the line as under -

Page #510
i 109. 1 111. 4 Malasatras 473 graMthAnaM pratyakSaragaNanayA sahasra 28000 cha / cha / / N. B.-- For further particulars see No. 1107. vizeSAvazyakabhASya vRttisahita Visesavasya kabhasya with vrtti No. 1109 625. 1895-98. Size.- 104 in. by 4 in. Extent.-- 673 - 98 - 94 - 2 = 479 folios ; 15 lines to a page; 44 letters to a line: Description.- Country paper thin and greyish; Devanagari cha racters with occasional galETS ; neither too big nor too small, clear and fair hand-writing ; red chalk used; borders ruled in four lines in black ink ; foll. i to 98, 161 to 254, 429 and 624 lacking ; so incomplete ; edges of foll. 99 to joi slightly worn out; condition fair ; the last two foll. stained with blue ink to a certain extent; extent 28976 slokas. Age.- Samvat 1673. Begins.-- ( text ) fol. 992 iha sajjhamoggahAINa saMsayAittaNaM taha vi nAma | ambhuvagaM tu bhaNNai nANaM viya saMsayAI y|| ,- (com.) fol. 99* abruptly FATTATUT olar #qafa starles (5) maniera dut etc. Ends.-- (text) fol. 6716 iya parisamApiyamidaM etc. up to sesANuogassa as in No. 1103. , -(.com. ) fol. 673" fa sftista (HE) etc. up to torHSER as in No. 1108. Then we have : 60 (J.L.P.]

Page #511
474 Jaina Literature and Philosophy inuo. iti zrIvizeSAvazyakavRttiH / / 28976 // saM0 1673 mAha su. N. B.-- For further particulars see No. 1108. vizeSAvazyakabhASya Visesavasya kabhasya vRttisAhita with vrtti No. 1110 1254 1887-91. Size.-- 101 in. by 4 in. Extent.-- 355 folios ; 17 lines to a page ; 43 letters to a line. Description.- Country paper thick, smooth and greyish ; Deva nagari characters with occasional CEAITIS ; bold, big, clear and good hand-writing; borders ruled in four red lines; foll. numbered in the right-hand margin ; foll. 273 to 291 also numbered in Gujarati as 1, 2 etc.; fol. 297 wrongly numbered as 197; foll. 1a and 3550 blank ; edges of the first sol. slightly worn out; some of the foll. seem to be exposed to rain; condition tolerably good ; red chalk used ; white paste used as a pigment; incomplete, though the last fol, is blank. Age.- Pretty old. Begins.- (text) fol. 1b *99TUOTTOTIAEI etc., as in No. 1103. >> - (com.) fol. 1" $ #A: SHPETT 11 A great etc. as in No. 1107. ,, -( text ) fol. 354 31891 alicut etc. Ends.-- (text) fol. 355a mahi paccakavadhammatareNa tddhmmmettghnnaao| kayagattaupasiddhI kuMbhANiccamettassa //

Page #512
IIII.] III. 4 Malasatras Ends. -- (com) fol. 355 sarvacaitanna lakSyata iti 17000 athavA apratyakSamiMdrayajaM jJAnaM pUrve pratipAditavyutpattyA'kSasya jIvasya sU ( ? sva ) vyatiriktanimittavizeSAjjAyamAnAd dhUmAdagnijJAnavaJca vyatiriktAni ca nimittAnyakSasya jIvasya karaNAnIMdriyANi maMtavyAni yacca pratyakSaM na tajjIvasya nimittAMtarAt jJAyate kiMtu jIvastatra sAkSAdeva jJeyaM pazyati yathA'vadhimanaH paryAyaaaf. This Ms. ends here abruptly. N. B. For further particulars see No. 1107. vizeSAvazyaka bhASya vRttisahita No. 1111 475 Visesavasyakabhasya with vrtti Size.-10 in. by 4 in. Extent. 94+38+1+110+3-2+470+7-5+29 + 77+226-3 +4+201+2=1252 folios, 9 lines to a page; 42 letters to a line. 768. 1875-76. Description. Country paper thick, rough and white; Devanagari characters; bold, big, clear and good hand-writing; borders unruled; the right and the left edges coloured red; the other two, green; red chalk and yellow pigment used; this Ms. contains both the text and the commentary; fol. a blank; numbers for foll. 1 to 94 entered twice as usual; then the following foll. 1 to 38 not marked in continuation but only as 1, 2 etc. in the corner; in the second set the fol. 24 blank; in this set foll. 31 to 38 also numberd as 4, 5 etc.; the 39th is not at all numbered; the fol. 39 blank; then again the subseqnent foll. I to 110 numberd in the left-hand corner; in this third set the foll. 63, 83 and 97 repeated; foll. 108 and 109 lacking; in the 4th set the foll. 1 to 470 numberd as in the 3rd set; the foll. 3, 9, 18, 114, 291, 311, and 432 repeated; foll. 50, 53, 91, 157 and 309 lacking the fol. 479 numbered as 39, too; the follow S

Page #513
426 Jaina Literature and Philosophy IIII. ing foll. up to 68 only numbered as 40, 41 etc. in the right-hand corner ; then commences the fifth set; herein foll. numbered as 1, 2 etc. up to 77 ; then we have the 6th set wherein the foll. are again numbered as 1, 2 etc. up to 226 ; in this 6th set foll. 33, 87 and 143 missing ; foll. 92, 120, 216 and 226 repeated ; then follows the seventh set ; herein foll. numbered as 1, 2 etc. up to 201; the foll. 26 and 143 repeated ; condition very good i complete, Age.-- Appears to be modern. Begins.-- (text) fol. 2b *4929o etc. as in No. 1103, , -(com.) fol. 16 BATTUTTIT AA: 1 FH Hrad HEITTTTTI vifaguais etc. as in No. 1107. Ends.- (text) fol. 1962 iya parisAmApiyamidaM etc. up to sesANuu(o)gassa as in No. 1103. >> -- (com. ) fol. 2006 kva zrIjinabhadra etc. up to prItyavicchedaH 6 as in No. 107. This is followed by the line as under : iti zrIvizeSAvazyaka samAptaM // N. B.- For further particulars see No. 1107. ziSyahitA Sisyahita [vizeSAvazyakabhASyavRtti] [ Visesavasyakabhasyavrtti ] No. 1112 58. 1880-81. Size.- 278 in. by 2 in. Extent.-- 345 - 1 = 344 leaves ; SS 10 7 lines to a leaf ; 110 to 120 letters to a line.

Page #514
1112.] III. 4 Mulasutras 477 Description.- Palm-leaf thin and greyish; Devaragari characters with pRSTamAtrAs; sufficiently big, legible and very good hand-writing; leaves 22 to II are mostly written in a smaller hand ; this Ms. presents an appearance of the work having been written in three separate columns, but really it is not so, since the lines are continuous ; borders of cach of the columns neatly ruled in two pairs of lines in black ink ; the space between these pairs coloured red; red chalk used; there are two holes in each leaf in the interspaces between the columns ; leaves numbered in both the margins : in the right-hand margin as usual ; in the left-hand one as zrI, 3, eka etc ; the Ist leaf missing ; almost every leaf has its edges slightly worn out ; leaves i to 21 are in a fragmentary condition ; the following few leaves worm-eaten ; condition poor; the Ms. placed between two wooden boards; one extra blank leaf in the beginning; colophon composed by Asaditya Age.- Fairly old. Author.-- Maladharin Hemacandra Suri. For details see p. 46o. Subject.-- A Sanskrit commentary elucidating Viscsavasyaka bhasya. It is styled as Sisyahita and Brhadvrtti as well. Begins.- leaf 2* TAdivastuvaditi / evaM prastutanAmasthApanAdravyAyuddezAnAmapi : tyAdi bhedAnedo yo etc. atha samAsodeza vivakSurAha / saMkhevA ityAdi etc. Fnds.-leaf 345 bhavatIti catvAriMzaddAthArthaH // cha / 799 pUrva cAdyavasAnaparyaMta vyAkhyAtAnAM gAthAnAM 2823 ubhayaM bhASyagAthAnAM 3622 zeSANi caturdazA. dhikasaptazatAni atidezenaiva gatAni na tu vyAkhyAtAni ato neha gaNitAni // cha / ityeSA ziSyahitA nAma vizeSAvazyakavRttiH parisamAptA // cha / / yasyAdya pUgakSagha(?)metya zeSA vyAnAdapIhAnyabhave'pi jAtaH / ravarivacchaMtabharaH pratApAt bhavaH pradeyAddaSabho jinaH zaM // 1 // 1 One letter is gone.

Page #515
478 Jaina Literature and Philosophy III2. astIha sadratnanivAsAdhiSNya muktaprapaMcAttabhUmipIThaH / zrImAnanekAMgigaNAzrayazca sammoDhavaMzaH saridIzatulyaH // 2 tasminvaMze pramRtasuyazaHpUritAzAcatuSko dakSatvAdyairvaraguNagaNairanvitaH zrAvako'bhUt / samyaktvAtyo varagurugirA(5)pAstamithyAtvamohaH zAMtyAdvAno jinapatipadAMbhojayugmadvirephaH // 3 // zIlAlaMkRtakAyA dAnadayoyuktamAnasA satataM / jinapUjAratacittA yazomatistasya varapatnI // 4 // tAbhyAmAdijineMdrapUjanavidhAvAsaktacitto'nizaM sUnuH sarvajanopakArakaraNaprahaH kRpAmaMdiraM / nityaM savativargadAnanirato mAnAdidoSojjhito gAMbhIryAdiguNaughalabdhamahimA pradyumnasaMjJo'jani // 5 // itazca // ihaivavaMze jinapAdabhaktaH suzrAvako vosakasaMjJako'bhUt / sudharmakarmodyatamAnasA ca tasyAgrayabhAryA'jani sesikAkhyA / / 6 / / tasyAH sAhaDasaMjJakaH sucaritaH sUnurmahAtmA(s) bhava ccheSTA cArucaritralakSaNavatI putrI ca lakSmIMgitA / yA lakSmIriva kezavasya dayitA pradyamnanAmno gRhe vikhyAtAtmaguNotkareNa janatAcetazcamutkAriNA / / 7 / / apatyasaptakaM tasyA babhUva guNamaMdiram / sutAstrayo mahAtmAnazcatasraH putrikAstathA // 8 // jyeSThaH sUnurudAratAdibhiriha prAptaprasiddhirguNe rAgrayarAmrayazo(5)bhidho jinamahavyAsaMgatannidhva(?)dhIH / svacchaMda vicaran vareNyakarivadyaH kIrtiga(gA)hataiH sadAnAsavalipsayA'rthimadhupatrAtaiH sadA sevyate / / 9 / /

Page #516
1112.] ari fortskhikAryabhAradhUraM sudhare va svapatrA / dasyo'pi yastAM vahati sma dhImAn vizrabdhacetAH parakAryahetoH // 10 // jinamAnarato nityaM dvitIyo dhavalAbhidhaH sadguNAkaracakSuSyastRtIyo jesalAhvayaH // 11 // yazomatirjyeSThatA vareNyA tathA parAzrIriti cAruputrI / suzIlayuktA'tha ca rukmiNIti rAjImatI turyasutA babhUva / / 12 / / tatazrva // 111. 4. Malasatras zrI'varddhamAnA' khyapure variSThe saMtiSThamAnAmadadhA'nyadA ( 1 ) tha | zrIdevabhadrAkhyamunIMdramUle tadyathA / zubhAva lakSmIrvaradAnadharme // 13 vijJAya prabalaprabhaMjanacaladdIpAMkurAlIsamaM yataH // loke jIvitayauvanArthaviSayA mAdyazeSaM sadA / puNyasaMgraha karmakSayaikArthibhiH kartavyaH sunayAjitAtmavibhavaiH saddAnadharmodyamaH || jJAnopaSTaMbhAbhayavibhedatastrividhamuktamiha dAnaM / jinamatajaladhAvAdyaM gRhiNAM tatrApi bahuphaladaM // 1 // mohAMdhakAzavRtacittadRSTe jJAnapradIpo vRSavadarzI / bhavArNavAjjJAnajale nimajjan nRNAM bhavejjJAnamihAyapotaH // 16 // jJAnaM muktipurIpratolI parighapradhvaMsanAne kapo jJAnaM nAkArasyazikharaprArohasopAnakaM / jJAnaM durgatidurga kUpapatatAmAlaMbanaM dehinAM jJAnaM saMzayapAdaporuvipinocchede kuThAraH paTuH // 17 // 479

Page #517
480 jaina Literature and Philosophy [uri. tasyaivamAdhairyatipuMgavedo zvecadvacazcArumarIcibhiH saa| saMbodhitA kairaviNIva pazcAda dujjRbhamANA(55)syasaroruheha // 18 // lekhayitvA(55) tmasAreNa vizeSAvazyakasya hi / vRttariyaM dvitIyAdhaM tasmai sadgurave dadau // 19 // apanayati tamizra(laM ) yAvada dubiMba / dinarajaninilInaM tIvrazItAMzusaMdhaiH / iha jagati variSyaM pustakaM tAvadetadvibudhamunijanaudhaiH paThayamAnaM pranaMdyAt / / 20 // zrIvikramA.........vagrahacaMdrasaMkhya.... tasyAM samarpitaM pravaragurudivase / 21 tadgatAtmA vilikhyedamAzAdityAbhidho dvijaH / nijaprajJAnusAreNa prazastimakarodimAM // 22 // References:--Published. See No. 1103. For a Ms. see Limbdi Catalogue No. 2355.

Page #518
inij.] IV. 4 Malashtras THE FOURTH MULASUTRA piNDaniyukti (piMDanijjunti) No. 1113 Size.-- ro++ in. by 4g in. Extent. -- 19 folios; 15 lines to a page ; 48 letters to a line. Description.-- Country paper thin and white; Devanagari characters with garars; sufficiently big, legible, uniform and elegant hand-writing; borders ruled in two pairs of lines in black ink; red chalk used; foll. numbered in the righthand margin only ; fol. ra blank; complete; condition very good. Age. - Sarnvat 1560. Author. Bhadrabahusvamin. For details see Nos. 709 and 1002. Subject. A Jaina agama dealing with rules and regulations pertaining to food etc. to be accepted by saints. The entire work is composed in 697 verses in Prakrit. Its main topics are as under : Begins. - fol. 1 namo vItarAgAya || 61 []. L. P.] 481 Pindaniryukti (Pindanijjutti) (I) piNDanirUpaNa, (2) udgamadoSa, (3) utpAdanAdoSa, ( 4 ) doSa and (5) grAsaiSaNAdoSa. For detailed information the reader is referred to pp. 164-167 of "zrInandI - anuyogadvAra - Avazyaka oghaniryukti-dazavaikAlika - piNDaniryukti- uttarAdhyayanAnAM sUtrasUtragAthA niryuktimUla bhASya bhASyANAmakArAdikramaH aMkazuddhiH laghurbrahazva viSayAnukramaH (nandyAdigAthAyakArAdikramaH aMkazuddhiH laghurdRzva viSayAnukramaH ) " published by the Agamodaya Samiti in A. D. 1928. piMDe uggamaupAyaNe saNA saMjoyaNApamANe ya / iMgAla dhUma kAraNa aTTavihA piMDa nijjutI // 1 // 388. 1879-80.

Page #519
482 Jaina Literature and Philosophy (1113. piMDa nikAya samUhe saMpiMDaNa piMDaNA ya samavAe / samosaraNa nicaya uvacaya cae ya jjumme ya rAsI ya / / 2 / / piMDassa u nikkhevo caukkao cchakkao ya kaayvvo| kAUNa ya nikvevaM parUvaNA tassa kAyavvA / / 3 / / etc. Ends.--- fol. 190 eso AhAravihI jaha bhANio savabhAvadaMsIhi / dhammo(?mmA basa(ssa)ya(ga)jogA jeNa na hAyati taM kujjA // 96 / / jA jayamANassa bhave virAhaNA suttavihisamaggasa / sA hoi nijjaraphalA ajjhatthavisohijuttassa // 97 / / mahalliyA' piMDanijjuttI sammattA // cha / saMvat 1560 varSe bhAdrapadamAse zuklapakSe aSTamyAM tithau bhaumavAre zrI pattana nagare / zubhaM bhavatu // cha / Reference. The text along with the Prakrit bhasya and Malaya : giri's Sanskrit commentary is published in Sheth D. L. J. P. Fund Series as No. 44 in A. D. 1918. For relation of this text with Dasavaikalikasutra see Preface. piNDaniyukti Pindaniryukti 10. No. 1114 1880-81. Size.- 12Tin. by 2 in. Extent.-- 228-167+1=62 leaves ; 3 to s lines to a leaf ; so letters ___to a line. Description.-- Palm-leaf durable and greyish ; Devanagari charac ters with pRSTamAtrAs; small, legible, uniform and good hand-writing ; this Ms. presents an appearance of the work having been written into two separate columns; but, really speaking it is not so; for, the lines of the first column extend to the second : red chalk used : leaves 1 This word seems to have been used with a view to distinguish this Pindaniryukti from the smaller Pindaisananiryukti of the fifth adhyayana of Dasavaikalikasutra. See p. 488.

Page #520
1115.] IV. 4 Malasutras 483 numbered in both the margins; in the right-hand one as , etc., and in the left-hand one as etc.; thus thu ghu grahA this Ms. starts with the 167th leaf; leaves 167a and 228b blank; an extra blank leaf preceding the 167a leaf; complete; condition on the whole good; there is a hole in the space between the columns of each leaf and a string passes through it; the Ms. is placed between two durable wooden boards; this Ms is well-preserved as it is placed in a card-board box lined with oil-cloth. Age,- Old. Begins.-- leaf 167 I0 | namaH sarve (rva) jjJA ( e jJA)ya || piMDe uggamaupAyaNesaNa Ends. leaf 228a eso AhAravihI etc. up to ajjhatthavi se hijuttassa || as in No. 1113. This is followed by the line as under :cha || piMDanijjutI sammattA || gA 99 N. B. For other details see No. 1113. fquefagin ziSyahitA (vRtti) sahita No. 1115 Pindaniryukti with Sisyahita (vrtti) Size.-29 in. by 2 in. Extent.-226 leaves; 4 lines to a leaf; 135 to 140 letters to a line. Description. Palm-leaf thin, durable and greyish; Jaina Devanagari characters with gears; small, quite legible and very good hand-writing; this Ms. presents an appearance of the work having been written in three different columns; but it is not really so; for, the lines of the first 46. 1880-81.

Page #521
Jaina Literature and Philosophy [1115. column extend to the remaining ones; borders of each of the columns ruled in three lines in black ink ; leaves numbered in both the margins ; in the right-hand one as 3,2,3 etc., and in the left-hand one as %, , , , etc.; leaves 1490 and 1504 not quite legible, ink having faded; the first leaf broken into two parts ; several leaves somewhat worm-eaten ; some have their edges worn out; condition on the whole tolerably fair ; both the text and the commentary complete; extent 7671 slokas; one extra blank leaf preceding the first leaf as well as one following the last one; this Ms. is placed between two wooden boards; there is a hole between every two columns and a string passes through it; the commentary styled as Sisyahita is composed in Samvat 1160 in Dadhipada ( ? Dadhipadra i. e. Dahod) with the help of Mahendra Suri, Parsvadeva Gani and Devacandra Gani, the disciples of Vira Gani's guru Isvara Gani; this was revised by Nemi candra Suri, Jinadatta Suri and others in Asahillapataka. Age. -- Fairly old. Author of the commentary.- Vira Gani alias Samudraghosa Suri, pupil of Isvara Gani of the Saravala gaccha. This author was named as Vasanta before he took diksa. His father's name was Vardhamana and that of his mother Sramiti(?). They belonged to the families Bhillavala and Dharkata respectively. Subject. The text with a Sanskrit commentary. From the latter (p. 485 ) we learn that Haribhadra Suri had commenced to compose a commentary on this text. Begins.- (text) fol. 2a f GTITASCOITOT etc. as in No. 1113. ::- (com.) fol. 16 FA: STATI namrAmarezvarakirITaniviSTazoNa ratnaprabhApaTalapATalitAMhipIThAH / afetaret:f$agria(n) /(HI&UTET niHzeSavastuparamArthavido jayaMti // 1 //

Page #522
1325.] IV. 4 Malasutras lokAgrabhAgabhavanA bhavatI ( bhI ) timuktA jJAnAvalokita samastapadArthasArthAH / zvA(svA)bhAvikasthiraviziSTasukhaiH samRddhAH siddhA vilInaghanakasmamalA jayaMte // 2 // AcArapaMcakasamAcaraNapravINAM (NAH) sarvajJazAsanabhare(rai )kadhuraMdharA ye / testva(?) yo damitadurdamavAdivRMdA vizvopakArakaraNapravaNA jayaMti // 3 // sUtrayataM natipaTusphuTayuktiyuktaM yuktipramANanayabhaMgagamairgabhIraM / ye pAThayaMti varasUripadasya yogyA te vAcakAzvaturacArugiro jayaMti // 4 // siddhayaMganAsama samAgamapaTTavAMcchA: saMsArasAgarasamuttaraNaikacittAH / jJAnAdibhUSaNavibhUSitadehabhAgA rAgAdighAtaratayo yatayo jayaMti // 5 // iti vihitapaMcaparameSTisaMstavo guru (rU) padezena / vakSye ziSyahitAkhyAM vRttimimAM piMDaniryukteH // 6 // paMcAzakAdizAstravyUha pravidhAyakA vivRttimasyAH / Arebhire vidhAtuM pUrvaM haribhadrasUrivarAH // etc. Ends. - ( text ) fol. 225 b eso AhAravisi etc. ( com. ) fol. 226^ iti vIragaNiviracitAyAM ziSyahitAyAM piMDaniryuktivRttau kAraNAkhyamaSTamaM dvAraM samAptamiti // cha // cha // tatsamAptau ca samAptA piMDaniryuktivRttiriti // cha // cha // bho bhavyA iha hi janmajarAmaraNanItikarapUrite bahuprakAraparibhavapAtAlolbaNe mohamaddAvarttasaMvarttana duruttare kaSAyavaDavAnalajvAlAkarAlo (le) rAgazokadAridryaprabhRti etc. kathamapi mahA prAgbhAreNa dRSTvA mA vilaMbadhvaM kiM tarhi yathoktapravrajyApAlanArohaNena rigitatamAruhya nirvRttipuraM gacchata thena tatrAnaMtajJAnadarzana sukhavIrya saMyuktA nirAkulAH sadaiva tiSTatheti // cha // cha // 485

Page #523
486 Jaina Literature and Philosophy [HIS. zrI lATa'dezatilakazrI vaTapadraka'vizAlapuragatayoH / zrI bhillavAla'-'dharkaTa yAtivyomeMdunirmalayoH // 1 zreSTivaravarddhamAna-zramityostIrthanAthamuninamane / ratayorvasaMtanAmnA janmotpattiM samAzcutya // 2 pravrajyAgrahaNaM punarAzrRtya vishuddhsaadhugunnvaanmaaN| basativihArizrI caMdragacchagaganeMdukalpAnAM // 3 satyApi tannAmnA zrIsamudraghoSAbhidhAnasUrINAM / vIra iti prAptAparanAmnA(5)tyaMta vimugdhadhiyA / / 4 dIkSAyAH paripAlanazAzvatyatusakala vasatitilakAnAM / zrI'saravAlaka'gacchasthavAcanAcAryavaryANAM // 5 adhizvaragaNinAmnAM sutena saMprAptavIragANanAmnA / ekAdazazatopari SaSTikasaMvatsarodadhi(ke) // 6 'paTTa'grAme 'karkazoNake pArzvavartini pravare / ghokAusArato(s)kAri piMDaniyuktittiriyaM / / 7 teSAmevAM cezvaragaNinAM zrImanmaheMdrasUrivarAH / sakalAgamapAragatA dharmakathAkathananiratAzca // 8 apare(s)pi pAzva(ca)devAbhidhAnagaNinaH pradhAnamaMtrajJAH / ucitatyA abhyarthitasUrAH saMgrahaparAzca dRDhaM / / 9 anye(7)pi devacaMdrAbhidhAkhyA gaNinaH kriyAparAH saralAH / kSAMtyAdidharmanicayAH parahitaratA yA vinItAzca // 10 ete trayo(Da)pi ziSyAH sakalajanAnaMdadAyino(5)tyarthe / devAnAmapi vaMjjAnaM haMtu ciraMtanA valaye / / 11 yeSAM bhakta pradAnamukhyopaSTaMbhaprasAdena / nitarAM nirAkulenAkAri mayaiSA sphuTA vRttiH // 12 shriinemicNdrsuuri-shriijindttaabhidhaansuuryaayaiH| zrImatyaNahillapATaka pure vyazodhIyamupayuktaH // 13 pazyati tathApi yAde ko(5)pi dUSaNaM kiMcidalpamitaradvA / tanmayi kRtAnukaMpaH sa zuddhadhI(:) zodhayedvibudhaH // 14 kasya na chadmasu syAnAbhoga syAdatIva viduSo(s)pi / nitarAM vimugdhabuddheH kiM punarasmAdRzajanasya // 15

Page #524
1116. ] IV. 4 Malasatras yAvazcaMdra yAvacca bhAskaro yAvadamaragirimukhyAH / tiSThati jagati tAvannaMdatu sutarAmiyaM vRttiH // 16 iti vyastimitAM kRtvA yatkiMcidupArjitaM mayA puNyaM / tene tasyA (:) pAThe samudyato bhavatu sAdhujanaH // 17 evaM sapta sahasrA zataSaGkA(TyA) caikasaptatizvAsyAH // dvAtriMzadakSaramitaiH zlokaiH sarva pramANamiti // piNDaniryukti vivecana sahita 25 cha || graMthAgraM zlokasaMkhyAyAM || 7671 // cha // cha // iti vIragaNiviracitAyAM ziSyahitA nAma piMDaniryuktivRttiH samApteti // cha // cha || zivamastu sarvajagataH // cha || maMgalaM mahAzrIH // cha // No. 1116 Size-- ro++ in. by 44 in. Extent.- ( text ) 1o2 folios; 5 lines to a page ; 27 letters to a line. - (com.) ; IO 535 33 99 33 Description. dr 39 Age.-- Pretty old. Author of the commentary. "" dw wr " 487 Pindaniryukti with vivecana 389. 1879-80. Country paper rough and grey; Devanagari characters with pRSThamAtrAs; this is a paJcapATI Ms., containing the text and its commentary; the former written in a slightly bigger hand ; clear and good hand-writing; borders ruled in three lines and edges in two, in red ink; foll. numbered in the right-hand margin only ; fol. 1(c) blank ; yellow pigment used; both the text and the commentary complete; condition very good. " Manikyasekhara Suri, pupil of Meru tunga Suri of the Ancala gaccha. For a list of his works see p. 457. Subject. The text in Prakrit together with its explanation in Sanskrit, based upon a commentary by Malayagiri Suri.

Page #525
488 Begins. -- text ( fol. rb) Jaina Literature and Philosophy --- piMDe uggamaupAya saNA etc. as in No. 111 3. com. (fol. 1' ) zrIAcArAMge dvitIyazrutaskaMdhe AyaM dazavaikAlike paMcamaM piMDaiSaNAdhyayanaM / astha niryuktirmahArthatvAt zrIbhadrabAhuNA pRthakRtA' sA piMDaniyuktiriti prasiddhA'syA arthamAtraM kathAmAtraM [ kathAmAtraM ] ca likhyate / yA piMDaiSaNAniryuktirdazavaikAlikapaMcamAdhyayanAsti stokArthA eSA tu vistRtArthA / piMDaiSaNAyA niryuktiH piMDaniryuktiriti madhyapadalopisamAsaH / maMgalaM tu " vaMditu savvasiddhe" ityAdinA AcAraniryuktau zastraM (stra) parijJAdhyayane eva zrIbhadrabAhuNoktaM vighnazAMtyai / athAvAdhikArasaMgrahagAthAmAha || piMDe u 0 piMDasaMghAte / piMDanaM piMDa: etc. Ends. (text) fol. 102a [ ri eso AhAravihI etc. up to juttassa || 36 || as in No. 1113. (com) fol. 102 eso A0 eSa AhAravidhiH piMDavidhi (H) yathA e (te) na prakAreNa bhaNitastIrSa (rtha ) karAdibhistathA kAlAnurUpasvamativibhavena mayA vyAkhyAtA / eSA piMDaniryuktiryuktirasthA vinirmitA / stevia tasmai namaH zrIbhadrabAhave // 1 // viSamA piMDa niyuktirvitA yena sUriNA / tasmai zrImalayagirikhe praNamAmyahaM // 2 // zikSayA tasya saMkSipya viSamArthavivecanaM cakre zrIpiMDaniryukto (kteH) sUrirmANikyazeSaraH // 3 // zrI 'aMcala' gacchanAthAH / zrImerutuMgasUrayaH // ziSyasteSAmimAM tene saMzayadhvAMtadIpikAM // 4 // iti zrIpaMDaniryuktidIpikA | cha || saMpUrNa || zubhaM bhavatu // cha // cha // || 1 Cf. Aha-- niryuktayo na svatantrazAstrarUpAH kintu tattatsUtraparatantrAH, tathA tadvyutpanyA zrayaNAt, tathAhi-- sUtropAntA arthAH svarUpeNa sambaddhA api ziSyAn prati niyujyante nizcita sambaddhA upadizya vyAkhyAyante yakAbhistA niryuktayaH bhavatA'pi ca pratyajJAyi, 'piNDaniryuktimahaM vivRNomi tadeSA piNDaniryuktiH kasya sUtrasya praticaddheti ucyate--iha dazAdhyayanaparimANalikA yugalabhUSito dazabaikAliko nAma bhUtaskandhaH, tatra ca paJcamamadhyayanaM piNDeSaNAnAmakaM, dazavekAlikasya ca niyuktiaturdaza pUrvavidA bhadrabAhutvAminA kRtA, tatra piNDaiNNAbhidhapaJcamAdhyayana niryuktiratiprabhUtagranthatvAtpRthak zAstrAntaramitra vyavasthApitA tasyAzca piNDaniryuktiriti nAma kRtaM " -Malayagiri Suri's commentary (p. 1) on Pindaniryukti.

Page #526
1117.1 piNDaniryuktavacUri No. 1117 IV. 4 in. Malasairas Size.- 11++ in. by 5 Extent. 85 folios; 15 lines to a page; 42 letters to a liue. Description.--Country paper tough and white; Devanagari characters; big, clear and good hand-writing; borders ruled in three lines in red ink; yellow pigment profusely used; foll. mostly numbered in the right-hand margin; fol. 1a blank ; condition very good; complete ; this Ms. contains the ass of the text. Age. -- Samvat 1931. Author.-- Ksamaratna, pupil of Jayakirti Suri. Pindaniryuktyavacuri 489 Subject. A small commentary in Sanskrit based upon the brhadvrtti to Pindaniryukti. Begins. fol. 1 zrIgaNezAya namaH // 1 In a different hand we have: gra. 3001. 62 [L. L. P. 1 169. 1873-74. zrIpiMDaniryuktiravacUrirlikhyate pUrvamadhikArasUtraM gAthA piMDe gAhApiMDe AhAraviSaye udrama 1 utpAdanA 2 eSaNA 3 saMyojanA 4 pramANa 5 iMgAla6 dhUma 7 kAraNa 8 bhedASTavidhA piDaniyuktibha ( ) vati etc. Ends.fol. 85 jA jagAhA yatamAnasya sUtroktavidhiparipAlanapUrNasya adhyAtmavizodhiyuktasya rAgadveSAbhyAM rahitatvAt yA bhavedvirAdhanA apavAdapratyayA sA bhavati nirjarAphalA 70 // zrIbRttimAlokya gaMbhIrArthA (tha) vinizvitaM yA zrIpiMDaniyuktiH prakaTArthA vinirmame 1 iti zrIpiMDa niryuktiravacUritA 1 iti zrI vidhipakSa gaccha gaganara vimaMDala zrI gacchezvara zrIjayakIrtisUriziSyakSamAratnena svaparAvabodhAya zrI piMDaniryukteravi (ba) cariralekhi // 1 // yatkicinmayA daurbalyAdasaMgata mihAgataM tacchodhane vidhAtavyA kRpA sadbhiH subuddhibhiH // cha // yAvadiduravI vizve pramodaM kuruto bhRzaM / tAvanaMda sAdhUnAM hitaiSA ( 5 ) vyartha saMtatiH // 2 //

Page #527
490 Jaina Literature and Philosophy [1117. zrIrastu etc. saMvat 1931 varSe mAsottamamAse prathama ASADhamAse kRSNapakSe aSTamyAM ravivAre likhitamidaM vyAsa gopIdAsAtmajena malAkhyena nAmnA || zrI | etc. piNDaniryuktiviSamapadaparyAya No. 1118 Pindaniryuktivisamapadaparyaya Extent. - fol. 25b to fol. 262. Description. Complete. For other details see Pancavastukapar736 (1). 1875-76. yaya No. Author. - Not known. Subject.-- Difficult words etc. occurring in Pindaniryukti explained in Sanskrit. piNDaniryuktiviSama padaparyAya Begins. fol. 250 parisaMTiyamiti svacchaM / pAINa iti prAcInaH / saraDu phala iti avaddhAsthi / amilA iti gaDarikA / etc. 736 (21). Ends. - fol. 262 atha bullIti avalhakaH / aicchA ci (utthAvi ) u iti nAsti bhedicchAH / piMDaniryuktiviSamapadaparyAyAH / - 1875-76. No.11.19 Extent.-- fol, 414 to fol. 41. Description.-- Complete. For other details see Pancavastukapar yaya No. 789 (1). 1895-1902. Begins. - fol. 414 parisaMThiyamiti etc. as in No. 1118. Ends. fol. 41 atha vulhIti avalhakaH etc. N. B. * For further particulars see No. 1118. Pindaniryuktivisamapada paryaya 789 (21). 1895-1902.

Page #528
1121.] IV. 4 Malasairas 491 piNDaniyuktiviSama Pindaniryuktivisama padaparyAya padaparyaya No. 1120 332 (4). A.1882-83. Extent.- fol. 23deg to fol. 23". Description. -- Complete. For other details see Nandisutravisama padaparyaya No. 623. Begins.-- fol. 234 parisaMThiyamiti etc. as in No. III8. Ends.- fol. 23deg avabhullIti avakaH etc. N. B.-- For additional information see No. 1118. piNDaniyuktiviSamagAthA PindaniryuktivisamagatheavivaraNa vivarana No. 1121 736 (22). 1875-76. Extent.-- fol. 26. to fol. 284. Description.- Complete. For other details see Pancavastukapar yaya No. 736 (1). 1875-76. Author. - Not known: Subject.- Explanation in Sanskrit of difficult gathas pertaining to _Pindaniryukti. Begins.--- fol. 26deg dasasasihAgA gAhA / iha sAdharmikarci(?ciM)tAyAM pravacanaliMga. darzanajJAnacAritrAbhigrahabhAvanAkSaNeSu saptapadeSvekaviMzatirdikasaMyogA bhavaMti etc. Ends.-- fol. 284 yAnugrahatrayamadhye sA cirasthApitA kevalamasau na parihAryA(:) caritatvAja dhanyavyAhRtavadityarthaH / piMDaniyuktiviSamagAthAvivaraNaM samAptam / This is followed by the verse as under :

Page #529
492 piNDaniryuktiviSamagAthAvivaraNa No. 1122 Jaina Literature and Philosophy yAvalokyazAlaH kamalapativarmUlajAlapratiSThA nAgeMdra kaMdhabaMdha stridazapatinadIpalatrazrcaMdraguccha / AzAzAkhA prazAkhaH zivasadanazilAsatphalo dhiSNyapuSpo tAtyAmevaya (?) tAvaddAlatakale ( li) malaH pustakaH paThacamAnaH // piNDaniryuktiviSamagAthA vivaraNa [ 1 122. Pindaniryuktivisamagatha vivarana Extent.-- fol. 4rb to fol. 45. Description.-- Complete. For other details see Pancavastukapar yaya No. 789 (1). 1895-1902. dasasasihAgA gAhA / etc. as in No. 1121. Begins.-- fol. 4rth Ends.-- fol. 45b yAtugRhatrayamadhye etc. up to pustaka: paThyamAnaH as in No. 1121. N. B. -- For further particulars see No. 1121. 789 (22). 1895-1902. Pindaniryuktivisamagathavivarana No. 1123 Extent. fol. 236 to fol. 294. Description. Complete. For other details see Nandisutravisama padaparyaya No. 623. Begins.-- fol. 230 dasasasihAgA grAhA // etc. as in No. 1121. Ends. -- fol. 291 yAmugrahatrayamadhye etc. N. B. For additional information see No. 1121. 332 (5). A. 1882-83.

Page #530
1124.] IV. A Malasatras 493 oghaniyukti Oghaniryukti (ohanijjutti) (Ohanijjutti) 94. No. 1124 1872-73. Size-104 in. by 4i in. Extent.-- 20 folios ; 17 lines to a page ; 70 letters to a line. Description.-- Country paper thin and grey ; Devanagari charac ters with occasional pRSThamAtrAs; bold, clear, small and good hand-writing ; borders ruled in two lines in black ink ; red chalk and yellow pigment used ; complete ; most of the foll, more or less worm-eaten ; condition rather unsatisfactory. Age.- Fairly old. Author:- Bhadrabahusvamin. For details see Nos. 709, 1002 and 1113. Subject. This agama deals with rules and regulations prescribed for a Jaina saint and is an extract taken out of the 20th prabhtta of Samacari, the 3rd vastu of the ninth purva. This work mainly deals with the following topics :- . (1) pratilekhanadvAra, (2) piNDadvAra, (3) upadhinirUpaNa, (4) anAyatamavarjana, (5) pratiSevaNAdvAra, (6) AlocanAdvAra and (7) vizuddhidvAra. ____For additional particulars see "nanyAdigAthAyakArAdiyuto viSayAnukramaH" (pp. 149-155) published in the Agamodaya Samiti Series as No. 55 in A. D. 1928. Begins.--fol. ! OM namaH zrIsarvajJAya arihaMle vaMdittA caudasapubbI taheva dspubbii| ikkArasaMgasuttasthadhArae sabbasAhU ai(y)|| 1 etc. Ends.-- fol. 206 esA aNuggahaTTA phuDaviaDavisuddhavaMjaNAinnA ikkArasahiM sarahiM saTTIahipahiM saMgahiyA // 1164

Page #531
494 Jaina Literature and Philosophy [1124. zrI oghaniryuktisUtraM // navamapratyAkhyAnapUrvota ( )rttitRtIyasAmAcArI vastugata viMzatitamaprAbhRtAnnirvyUDhaM zrIbhadrabAhu svAmipraNItaM samAptaM // cha etc. maMgalamastu likhitaM lIMbAkena // Reference. Published along with the commentary of Dronacarya in the Agamodaya Samiti Series in A. D. 1919. For quotations etc. see Weber II, p. 622 and p. 816. For additional Mss. see G. O. Series vol. XXI, p. 15 and Limbdi Catalogue Nos. 402 and 404. For a portion of this wrok (gathas 1160 to 1164, 1160 beginning abruptly) see p. 108. enrafagian No. 1125 Size.-12 in. by 1 in. Extent. 110 leaves; 4 to 5 lines to a leaf; 50 letters to a line. Description.-Palm-leaf thick, durable and grey; Jaina Devanagari characters with frequent qarars; big, quite legible, uniform and very good hand-writing; this Ms. presents an appearance of the work having been written into two separate columns ; but really it is not so; for, the lines of the first column are continued to the second; borders of each of the columns ruled in three lines in black ink; red chalk used; the central portion of the unnumbered sides and this portion as well as the middle portion of each of the margins of the numbered sides decorated with a red spot; there is a hole between the two columns in each leaf; leaves numbered in both the margins: in the righthand margin with ordinary numerical figures beginning with 57 and the left-hand margin with letter-numerals such as }, } }, } 525 9 Oghaniryukti 9. 1880-81. IS, IS, TIS, EIS, &

Page #532
1125.] 495 for 61 to 69 ; for 99 etc., leaf ra blank ; so is the leaf 1668 ; astring passes through the holes ; leaves are placed between two wooden boards; left-hand corners of several leaves gone ; on leaf 59 even some letters are gone; condition on the whole good; the Ms is well-preserved as it is placed in a card-board box lined with oil cloth; complete ; 1162 gathas in all. Age.-- Fairly old. Begins.--leaf 57b IV. 4 Malasutras Ends. --leaf 166a || OM namaH sarvavide || duhika mAlo sAmAyArI ahAugaM caiva / sAmAyArI tivihA bhoha ( hai ) dasahA payavibhAgo // 11 NavamayapaJcakakhANAbhihANaM puvvasta taiyavatthUo / pAhuDAo tato ihAnINiyA jaiyA // 2 so u okkamakAlo tayatthaNizviggha siika (kakha) NaM tthaM ca / AyakayaM ci puNo maMgalamAraMbhaye taM ca // 3 arahaMte vaMdittA etc. as in No. 1124. sAma(a)ggahatthA etc. up to saMgahiyA // as in No. 1124. This is followed by the lines as under: cha // // cha // gAthA 1962 / / cha / cha / 6 // cha // * // cha // la // 8. N. B. -- For additional information see No. 1124. Reference- This Ms. having some special symbols for decoration given on the last leaf has been described by F. Kielhorn in his Report for 1880-81 on p. 9. But the title is given there as " Ohasamayari [ ohasAmAyArI ] " 1 This is not the symbol in the Ms. It differs from this to some extent. 2 This verse is quoted by Drona suri in his commentary (p. 16 ) on Oghaniryukti.

Page #533
496 oghaniryukti No. 1126 Size. 123 in. by 4g in. Extent. 26 folios; 16 lines to a page; 52 letters to a line. Description. Country paper somewhat thick, rough and grey; Devanagari characters with gas; bold, big, legible and good hand-writing; borders ruled in two pairs of lines; the space between these pairs coloured red; fol. 1a blank; unnumbered sides decorated with a disc in the centre ; the numbered, with two more, one in each of the two margins; red chalk used; complete; condition very good; the last gatha numbered as 1154. Age.-- Pretty old. Begins.--fol. 1 aga afar etc. as in No. 1124. Ends. fol. 26b Jaina Literature and Philosophy N. B. For further particulars see No. 1124. siranaifen esA aNuggahatthA etc. up to saMgahiyA / / 1154 as in No. 1124. This is followed by the line as under :-- || ohanijjuttIsa (mma)ttA // cha // zrIH etc. No. 1127 [1126. Oghaniryukti 17. 1877-78. Size.-93 in. by 49 in. Extent. 47 folios; 13 lines to a page; 36 letters to a line. Description. Country paper thick and whitish; Devanagari characters with as; bold, big, uniform, legible and good hand-writing; borders ruled in two pairs of lines in black Oghaniryukti 1212. 1886-92.

Page #534
1128. ] IV. 4 Mulasutras ink; the space between these pairs coloured red; numbered sides decorated with three small discs, one in the centre and one, one in each of the two margins; complete ; yellow pigment used; condition very good; the last gatha numbered as 1164. Age.--Samvat 1720. Begins. fol. 1b Ends.-fol. 47a esA aNuggahatthA etc. up to saMgahiA / 1964 // as in No. 1124. This is followed by the following lines:(3)fagim: 11 vara egofik?: 11 fa yAdRzaM pustake etc. Then run the lines as under:-- shafayith fr etc. as in No. 1124. saMvat 1720 varSe jyeSTa (Ta) mAse zuklapakSe pUrNimAtithau ravivAsare zrI ' sthaMbha 'tIrthe la ( li) pIkRtaH // zubhaM bhavatu // kalyANamastu // zrI // sA / rAghava pApitaM paropakArAya[:] // N. B. For other details see No. 1124. No. 1128 497 Size.-- 11 in. by 4g in. Extent. 32 folios; 14 lines to a page; 48 letters to a line. Description.-- Country paper thin, rough and greyish in colour; Devanagari characters; bold, clear and fair hand-writing; borders ruled in four lines in black ink; the edges of the first fol. ruled in two lines; foll. 1 and 326 blank; yellow pigment used; complete; condition very good; the last gatha numbered as 64 i. e. 1164. 63 J. L. P. 1 Oghaniryukti 652. 1892-95.

Page #535
498 Jaina Literalure and Philosophy [1128. Age.--- Sarivat 1671. Begins.--fol. 10 se hI ho) namaH // zrIjinAya namaH // arihaMte vaMdittA etc. as in No. 1124. Ends.-fol. 324 esA aNuggahatthA etc. up to saMgahiyA // 64( 64) as in No. 1124. This is followed by the lines as under: iti zrIohanijjuttI sNmttaa| zubhaM bhavatu cha saMvat 1671varkhe (rSe) kArtikasadi ujavAlI 5 tithau zrIvIra(?)vAre zrI mUlacakramahAnagare zrI vRhatkharataragacche zrIyugapradhAnazrIjinacaMdrasUri tatpaTTe zrIyugapradhAnazrIzrIzrIjinasiMhamUrivijai( yi )rAjye 'rIhaDa 'vaMzaziromANazrIyugapradhAnazrIjinacaMdramarizAkhAyAM tatsi(cchi)dhyaprazastaguNaviziSTazreSTa(Ta)pa(paM)DitAtmatilakakamalamunInAM tatsi(cchikhya(Sya)mukSa(khya)pravaravAcanAcAryazrIpadmahemagaNiguNagariSTA(STA)nAm tatsi(cchi)kSya(vya)paM. nemasuMdaragaNinA lilekhya(khi) svavAcanArthe / / 1 kalyANaM bhavatu. N. B.--- For additional particulars see No. LI24. odhaniyukti TIkAsahita Oghaniryukti with tika 95. No. 1129 1872-73 Size.--124 in. by 48 in. Extent.-- 155 folios ; 15 lines to a page ; 60 letters to a line. Description.-- Country paper thin and grey; Devanagari charac ters with pRSTamAtrAs; big, clear, uniform and good handwriting; borders ruled in two pairs of lines in black ink; the space between these pairs coloured red rather indifferently; unnumbered sides decorated with a small disc in the centre; the numbered with two more, one in each of two margins ; red chalk used ; the yellow pigment, too, in some cases; the numbering of the foll. originally wrong, but corrected later on, e. g. in the case of foil. 112, 113

Page #536
1129. IV, 4 Malasutras 499 etc. ; small strips of paper pasted to fol. 19; the edges of the 155th ( last ) fol. worn out; a piece of paper pasted to the fol. 1556; condition on the whole very fair ; this Ms. contains the text and the commentary as well; both com plete ; extent 7385 Slokas. Age.- Pretty old. Author of the commentary.-- Drona Suri of Nivrtti kula. He had assisted Abhayadeva Suri, the navangivittikara. He had a pupil Suracarya whose life is : narrated in Prabhavaka caritra ( pp. 245-261 ). Subject.-- The Prakrit text along with the commentary in Sanskrit. Begins. -- (text) fol. 20 arahaMte vaMdittA etc. as in No. II24. ,, (com ) fol. 1' namaH sarvajJAya // namo arahaMtANaM / namo siddhANaM / Namo AyariyANaM / Namo uvajjhAyANaM / Namo loe savvasAhaNaM / eso paMcanamukkAro savvapAvalpaNAsaNo maMgalANaM ca sajvesiM paDhamaM havai maMgalaM // 1 etc. ahaM(I)dbhayastribhuvanarAjapUjitebhyaH siddhebhyaH / mR(?)taghanakarmabaMdhanebhyaH / AcAryazrutadharasarvasaMyatebhyaH siddhayartha satatamahaM namaskaromi / / 1 etc. Ends.--(text) fol. 155 esA aNuggahatthA etc. ikvArasahi saehiM eguNavannehi sammattA ||ch / ,, -- (com.) fol. IS5* sugamA oghaniyukti TIkA samAptAH / / kRtiriyaM droNA cAryasyeti / / cha / zubhaM bhavatuH kalyANamastuH // cha // graMthAyaM 7385 // cha / zrI zrI zrI // cha / cha // cha / cha / 'naMdurabAra nivAsI bhIma saMghAdhipo(s)bhavad bhavikaH / zrIjinadharmadhArastattanayo DuMgarassukRtI // 1 tadvaMzakavilAsI 'prAgvATaH ' prakaTajinamatAbhyAsI zrIguNarAjo guNavAn padapre(? pra)di(? ti)TAdikArayitA / / 2

Page #537
500 Jaina Literature and Philosophy [ 1129. zrI ' zatruMjaya' - 'raivata' - ' jIrApallya' - (S) 'rbudA' diyAtrAyu ( ? su ) vittavya saphalIkRtajanmA taca laSamAi ( 2 ) // 3 tanayastayo ( : ) suvinayaH kAlUnAmA kRtAnutkRta sukRtI / tajjAyA jasamAI lalanAdevI ca vIrAI // 4 zrI jinabhavanajinAcayu ( ? ) srakasaMghAdike sadA kSetre | vittavyayasya karttA dAnArthijanAna samuddharttA // 5 yugma ( m ) zrImatkAlUnAmnA nijakarakamalArjitena vittena | cikoze siddhAMtAH sasUtrakA vRttisaMyuktAH // 6 zrImadvAcaka nAyakamahI samudrAbhidhAnamukha kamalAt / labdhA (bdhvA ) varopadezaM naMdatu ca lekhitAsu rvi (?) mahopAdhyAyazrImahI samudragaNiziSyapaM kanakajayagANe likhApitAH / / Reference. Both the text and the commentary are published. See No. 1124. For additional Mss. see Limbdi Catalogue No. 404 and G. O. Series vol. XXI ( pp. 15 and 16 ). There is a palm-leaf Ms. of the commentary written in Samvat 1389. See G. O. Series vol. XXI, p. 41. o niyukta TIkAsahita No. 1130 Size.-- 11++ in. by 4g in. Extent. - 121 folios; 15 lines to a page ; 68 letters to a line. Description.- Country paper thin, rough and greyish ; Devanagari characters with gears; small, quite legible and good hand-writing; borders ruled in three lines in red ink ; foll. numbered in the right-hand margin only; foll. ra and 121' blank ; yellow pigment used; edges of the first fol. slightly worn out; some of the foll. worm-eaten ; condition on the whole very fair; this Ms. contains the text and the commentary as well ; both complete. Age. Pretty old. Begins-- ( text ) fol. 1 arihaMte vaMdittA etc. Oghaniryukti with tika 1175. 1884-87. as in No. 1124.

Page #538
1131.] IV. 4. Malasatras 501 Begins--(com.) fol. 10 FAT PANTATTI TAET STERTON etc. up to 9TH THE ANOS 11 3 11 BEETLENYHATA etc. Ends.-- (text) fol. 1212 esA aNuggahatthA etc. up to sammattA as in No. 1124. ,s --(com.) fol. 121deg TTA[ : ] itafagittichai HATH:(H1) liell grand auaritatat ll 3 11 811 N. B.- For further particulars see No. 1124. For an addi tional Ms. see Limbdi Catalogue No. 404. oghaniyukti Oghaniryukti TIkAsahita with tika No. 1131 1213. 1886-92. Size.- 104 in. by 43 in. Extent.- 362 folios ; 14 lines to a page ; 52 letters to a line. Description.- Country paper thin and greyish ; Devanagari cha racters with prs; bold, big, clear and good handwriting; borders ruled in two lines in black ink; the first two and the last few foll. slightly worn out at the corner; condition very fair ; foll. numbered twice : once as 88, 878 etc. and once as l, P etc. ; so this Ms. seems to be a part of some other Ms. ; the first fol. is numbered as 433 only ; yellow pigment used; red chalk, too ; both the text and the commentary complete ; extent 8385 slokas, Age.-- Samvat 1436. Begins.-- (text ) fol. 2a surga diatas etc. as in No. 1124. ,, --(com.) fol. 1b namo sarvajJANAM AHT sfigarui etc. as in No. 1130, CTP HTAT etc.

Page #539
502 Jaina Literature and Philosophy [III. Ends.-- (text ) fol. 162b esA aNuggahatthA etc. as in No. II24. ,, -- ( com.) fol. I62' sugamA / oghaniyuktiTIkA samAptA // cha / kRtiriya droNAcAryasyeti // cha / zreSTI(STI) 'prAgvATa'vaMze(s)sti somaH soma iva priyaH / dRDhasamyakatvasadbrahmaguNagrahaNasAgrahaH // 1 // nijanyAyArjitaM vittaM matvA sArataraM hRdi / saphalIkartumuyuktaH saptakSetrInivezanAt // 2 tathA ca zrAvikAcArapravaNA vidurAzayA / / karamIti nAmnA dharmakarmaThA(55)sId vivekinI // 3 // gurUNAM zrIjayAnaMdasUrINAM guNazAlinAM dharmopadezamAkarNya sAdarau tau jinAgamau // 4 // ubhAbhyAM levitaM zrImadoghaniyuktipustakaM / caturdazazate patriMzadvarSe zubhaM bhuvi // 5 // __ cha / zubhaM bhavatu // zrIsaMghasya // cha etc. graMthAnaM 8385 // cha / sasUtra // cha // cha / cha / / Then in a different land we have : Si N. B.-- For additional particulars see No. 1129. odhaniyukti Oghaniryukti TIkAsahita with tika ____417. No. 1132 1882-83. Size.- II in. by 4 in. Extent.- 134 - 18 = II6 folios ; I7 lines to a page; 48 letters to ___a line. Description.- Country paper thin, rough and white; Devanagari characters with CEASTS ; clear, big and good hand-writing; ink faded at times ; borders ruled in four lines in black ink; red chalk used ; most of the foll. have their edges more or less worn out; so even the written portion gone

Page #540
1133.1 Age.-- Fairly old. wr Begins.--( text ) (abruptly) tol. 19 tattha pAhANajalaM aJcaM (kaM) tamaNakAMte ca na etc. IV. 4 503 in some cases e. g. the beginning of the 19th fol. ; numbers of some of the foll. worn out; so it is difficult to ascertain whether the matter is continuous or not; condition poor ; fol. 1 to 18 seem to be missing; otherwise both the text and the commentary appear to be complete ; total extent 8635 slokas. -- " Ends.-- ( text ) fol. 134 Mulasutras (abruptly) (com.) fol. 19a jalapoSaNagAhA / 'pASANajalaM madhusiktha (?) jalavAlukAku (ja) laM kardamajalaM ceti te tatra pASANajalaM yatpASANAnAmupari vahati etc. I atha saMghaTTAdijala (la) kSaNapraNinISayA bhASyakRdAha / cha | jaMghe (gha) DA(a) gAhA jaMghArthamAtrapramANa (NaM) jalaM etc. ( com. ) fol. 134deg sugamA / oghaniyuktikA sUtrasahitA samAptA / TIkAyAM akSaragaNanayA graMthAgraM 6025 tadA stragAthApramANena graMthAgraM 1460 ubhayagraMthAgraM 8385 // zubhaM bhavatu // cha // N. B. -- For additional particulars see No. 1129. oghaniryuktiTIkA No. 1133 esA aNuggaha etc. up to saMgahiyA // as in No. 1124. This verse is rumbered as 1148. Size.-- 1o++ in. by 4g in. Extent.-- 144 folios; 15 lines to a page ; 46 letters to a line. Description. Country paper thin and grey; Devanagari characters with gears; bold, clear, big, uniform and good This occurs on page 32a of the printed edition (Agamodaya Samiti Series) Oghaniryuktitika 1114. 1887-91.

Page #541
504 Jaina Literature and Philosophy [133. hand-writing ; borders neatly ruled in three lines in red ink : numbers for soll. entered twice on one and the same side but in different margins ; foll 1" and I44deg blank ; this Ms. contains the gates of the text ; yellow pigment used ; complete ; condition very good. Age.-- Samvat 1662. Author.-- Dronacarya. For details see p. 499. Subject.- A Sanskrit commentary to Oghaniryukti. Begins.- fol. 16 zrIsarvajJAya namaH namo arihaMtANaM etc. as in No. 1129. Ends.-fol. 1342 sugamA // eyaM gAhA // cha / iti oghaniyuktiTIkA samAptA graMthAsaMkhyA 6545 vRttisaMkhyA yAzaM pustakaM dRSTaM etc. 1 tailAdrakSeta etc. 2 adra(dRSTidoSA(?nmomativibhrameNa / yadArthahInaM likhitaM mayebhyaH / te(ta)nmArjanayitvA parazodhanIyaM / kopaM na kuryAt khalu leSakasya // 1 // bhagnapRSTi(SThikaTigrIvA / baddhamuSTiradhomukhaM / kaSTena likhitaM zAstraM / yatnena paripAlayet // 2 // saMvat 1662 varSe dvitIyacaitra badi 14 zukre 'Idala'puravAstavyapaM0 zavasI likhitaM // cha / cha / Reference.- Published. See No. 1124. In "A Descriptive Cata logue of Manuscripts in the Jaina Bhandars at Pattan ": ( vol. I, pp. 215 and 323) published in the Gaekwad's Oriental Series as vol. LXXVI, two palm-leaf Mss. of the commentary are noted. Out of them, at least one noted on p. 215 is certainly composed by Drona Suri. - - 1 This will be hereafter referred to as "The Pattan Catalogue vol. I".

Page #542
1134.] stanfyin avacUrNisahita No. 1134 dr - dr Size. 10 in. by 4 in. Extent. (text) 43 folios; 12 to 15 lines to a page; 40 letters to a line. - (com.),, ; 28 a line. Description. Country paper thin, rough and white; Devanagari characters with gears; this is a qarat Ms.; the text written in a much bigger hand than that for the commentary; quite legible and good hand-writing; borders ruled in three lines in red ink; red chalk used; foll. numbered in the right-hand margin only; edges of the first and last few foll. slightly worn out; condition on the whole good; both the text and the commentary complete; this Ms. is lacking in the two verses of the colophon to be found in No. 1135. 22 IV. 4 Mulasutras ~~~( com. ) fol, 14 dr Ends.-(text) fol. 43b dr dr 23 Oghaniryukti with avacarni 147. 1881-82. Age. Samvat 1527. Author of the commentary- Jnanasagara. For his another work see No. 688. Subject. The text along with a small commentary in Sanskrit. Begins. (text) fol. 1a e namo (maH) sarvajJAya // gafar etc, as in No. 1124. 505 ; 49 nama ( : ) zrI pravacanAya || prAMto (S) mAvazyakAnuyoga etc. as in No. 1135. 35 "" esa aggahatthA up to saMgahiyA 64 (1964) as in No. 1124, This is followed by the lines as under: iti zrI zodhaniyukti mahAsiddhatisUtraM // iti zrI oghraniryuktimahAfagiaga gara: || daa ?429 ad grenfaia v gu signinska |

Page #543
Jaina Literature and Philosophy [1134. Ends.-(com.) fol. 43b etc. practically up to Ia as in No. 1135. 506 Reference. For a Ms. containing the text and an anonymous avacuri see Limbdi Catalogue, No. 403. For palm-leaf Mss. of the text see the Pattan Catalogue Vol. I (pp. 40, 95, 98, 107, 112, 119, 161, 175, 177, 309, 378, 385, 390, 406 and 409). ogha niryuktavacUrNi No. 1135 Oghaniryuktyavacurni Size.-- 101 in. by 48 in. Extent. 35 folios; 24 lines to a page; 64 letters to a line. Description.-- Country paper very thin and greyish; Devanagari characters with as; very small, quite legible and good hand-writing; borders ruled in three lines in red ink; foll. numbered in the right-hand margin only; the first 15 foll. more or less worm-eaten; condition on the whole good; complete; composed in Samvat 1439; fol. 35b practically blank; for, the title is written on it; pratIkas of the text given. 1116. 1887-91. Age. Samvat 1534. Author.- Jnanasagara Suri, pupil of Devasundara Suri. Subject. A small commentary in Sanskrit to Oghaniryukti. Begins. fol. ra namaH zrutadharebhyaH prakAMto(S)yamAvazyakAnuyogastatra sAmAyikAdhyayanamanuvarttate / tasya catvArya (yoga) dvArANi upakramau nikSepo'nugamo neyaH // etc. tadanena saMbaMdhana pUrva namaskAra mAha || arihaMtetyAdi / vyAkhyA mA saMhitAmedena paridhA bhavati etc.

Page #544
1136.] Ends. fol. 35 ArA0 // ukRSTazabdo'trAtizayArthe draSTavyo na tu bhAvAnaMgIkRtya || 1962 esoha0 || spaSTA0 // 63 e aMsA0 // spaSTA0 // 64 esA a0 // spaSTAdeg // / 1165 / / iti zrIdroNAcAryanirmita vRttyanusAreNa edaMyugIna - suvihitaziro'laMkaraNa koTIrakaraNibhaTTArakaprabhuzrIjJAnasuMdarasaripAdaviracitA oghaniyuktyavacUrNiH samAptA || cha || zrI || zrImat 'tapA' gaNana bhogaNa bhAskarAbhAH zrI deva suMdarayugottamapAdukAnAM / 1V. 4 Malasutras ziSyairjinAgamasudhAMbudhilA (lI) nacittaiH zrIjJAnasAgara gurUttamanAmadheyaiH // 1 nidhivahnimanu1439miti (te)bde'vacUrNirekhA (pA) kRtaughaniryukteH svaparopakRtikRte tadvivRterupari sphuTA jayatAt // 2 // prazasti || cha || cha || saM0 1534 varSe zrAvaNasudi 12 bhaume // zrI'rANapura' nagare devAkena likhitamasti cha / zubhaM bhavatu || This is followed in a very big hand by the lines as under:oghaniyuktyavacUriH kartA jJAnasAgaramUriH / Reference -- See No. 1134. 507 oghaniryuktavacUrNi No. 1136 Size.--- ro++ in. by 4g in. Extent.- 37 folios; 21 lines to a page ; 68 letters to a line. Description.- Country paper rough and white; Devanagari characters with occasional gas; very small, quite legible and good hand-writing; borders ruled in three lines in red ink; red chalk used; foll. numbered in the right-hand margin only; a presented as sssssssss etc., on the 4th fol. perhaps referring to the q; another on fol. 188; complete; edges of some of the foll. slightly damaged ; condition on the whole very good; complete. Age.- Fairly old. Oghaniryuktyavacarni 1115. 1887-91.

Page #545
508 Jaina Literature and Philosophy [1136. Begins.--fol. I namaH zrIsarvajJAya prakAMto(G)yamAvazyakAnuyogastatra etc. Ends.-fol. 37' aaraa|| utkRSTa etc. practicaily up to jayatAt / / 2 // ___ as in No. II35. This is followed by the line as under:-- ityopaniyuktayavacUrNiprazastiriyaM // cha // zrIH // etc. N. B. - For further particulars see No 1135. 18 oghaniryuktayavacUrNi Oghaniryuktya vacurni No. 1137 1877-78. Size.- 104 in. by 4s in. Extent.-43 folios; 19 lines to a page; 68 letters to a line. Description. --- Country paper thin, rough and white; Devanagari characters with qualats; small, quite legible and elegant hand-writing ; borders ruled in four lines in black ink ; red chalk used; this Ms. contains the gafas of the original text; foll. numbered in the right-hand margin only; fol. 436 blank; complete ; extent 3400 slokas; almost every fol. awfully worm-eaten ; condition poor. Age.--Fairly old. Begins.-fol. .. namaH zrutadharebhyaH // prakAMto'yamAvazyakAnA(nu)yogastatra etc. Ends.- tol. 43* aaraa0|| utkRSTazabdo(5)jAtizayArthe etc. up to prabhuzrI jJAnasAgaramaripAdaviracitA zrIoghaniryuktyavacUrNiH samAptA(tA) as in No. 1135. This is followed by jo 3800. N. B.-For additional information see No 1135.

Page #546
1139.] IV. 4 Malasatras 509 oghaniyukta yavacUri Oghaniryuktyavacur. 1214. No.1138 1886-92. Size.-- 101 in. by 4in. Extent.-- 39 + 1 = 40 folios ; 19 lines to a page ; 64 letters to a line. Description.- Country paper very thin and grcyish ; Devanagari characters with pRSThamAtrAs; very small, legible and good hand-writing ; borders ruled in four lines in black ink ; red chalk and yellow pigment used; foll. numbered in the right-hand margin only; fol. 28 repeated ; fol. 39deg blank ; some of the last foll. slightly worm-eaten ; condition good; complete ; this Ms. contains the gates of the text. Age.--- Pretty old. Author.-- Not mentioned. Subject. -- A small commentary in Sanskrit to Oghaniryukti. Begins.--fol. I prakAMto(s)yamAvazyakAnuyogastatra sAmAyikAdhyayanamanuvartate / tasya catvAryanuyogadvArANi / etc. Ends.--fol. 39' ArA0 // utkRSThato'tizayane samyagArAdhAnaM kRtvA bIn bhAvAn gatvA nirvANamavazyaM prApnoti / utkRSTazabdo'trAtizayArthe draSTavyo na tu bhavamaMgIkRtya // 29 / / esA // 1130 eaM / / 31 esA // 1132 zrIoghaniryuktayavacariH smaaptaa|| cha / zrIH // etc. 286. oghaniyuktayavacUri Oghaniryuktyavacuri No. 1139 A.1883-84. Size - 104 in. by 4; in. Extent.- 24 folios ; 23 lines to a page ; 62 letters to a line.

Page #547
Jaina Literature and Philosophy [1139. Description. Country paper tough and white; Devanagari characters with occasional gars; small, legible and tolerably good hand-writing; borders ruled in four lines in black ink; red chalk used; a right-hand corner of almost every fol. partly worn out; condition very fair; this Ms. contains only the aes of Oghaniryukti; complete; foll. must have been numbered, but the portions containing numbers have perished, that is way we do not find them now; this is the only paper Ms. dated so early as Samvat 1333 that I have handled up till now. ' S10 Age. Samvat 1333. Author. Not known. Subject. A small commentary in Sanskrit elucidating Ogha niryukti. Begins. fol. 1 qaeiaisq$?razPaergoin: || as sAmAyikAdhyayane catvAryanuyogadvArANi / etc. AcAryo maMgalAvarthe gAthAdvayamAha / arihaMte azokAyaSTamahAprAtihAryAdirUpAM pUjAmahaitItyarhataH etc. Ends. fol. 24deg AyasaMhananamAzritya trayastu chevATikAsaMhanane // 61 // e0 e0 esA || 1164 zrI oghaniryuktayavacUriH samAptA || cha || saMvat 1333 mArgazira zuddha 10 gurudine || pustakaM likhitaM padma. This Ms. ends thus. odhaniyuktiparyAya No. 1140 Extent. fol. 25a to fol. 25. Description.--Complete. For other details see Pancavastukapar yaya No. 736(1). 1875-76. Oghaniryuktiparyaya 736 (20). 1 For a discussion in this connection see my paper "The Jaina Manuscripts" (p. 106) published in "Journal of the University of Bombay "(vol. VII, pt. 2, September 1938 ). 1875-76.

Page #548
1142.] IV. 4 Malasatras SII Author.- Not known. Subject.-- Difficult words etc. occurring in Oghaniryukti explained in Sanskrit. Begins.--fol. 25a Toistaha TTEITT I SITTAI NE A SOUTHAHI etc. Ends.-- fol. 256 Ha sieATIT (stizari) ar Tera / a 5713 iti prastAvaH / siMheti behaH / oghniyuktipryaayaaH| oghaniyuktiparyAya Oghaniryuktiparyaya 789 (20). No. 1141 1895-1902. Extent.--fol. 409 to fol. 414. Description.-- Complete. For other details sec Pancavastukapar 789 (1). yaya No. 1895-1902. Begins.--fol. 404 Farfa etc. as in No. 1140. Ends.-- fol. 41a a etc. N.B.-- For additional information see No. 1140. oghaniyuktiparyAya Oghaniryuktiparyaya 332 (3). No. 1142 A.1882-83. Extent.- fol. 225 to fol. 234. Description.-- Complete. For other details see Nandisutravisama padaparyaya No. 623. Begins.--fol. 22TTTH Trafat etc. as in No. 1140. Ends.-lol. 24* ita etc. N. B.--For further particulars see No. 1140.

Page #549
512 Jaina Literature and Philosophy [1143. pAkSikasUtra Paksikasutra (1987) ( Pakkhiyasutta ) No. 1143 750 (a). 1892-95. Size.-10 in. by 48 in. Extent.- 11 folios ; 13 lines to a page; 36 letters to a line. Description.- Country paper thick, rough and whitish; Deva nagari characters ; bold, big, clear and good hand-writing; borders ruled in three lines in red ink ; edges singly; fol. Ia blank ; red chalk used ; numbers for foll. entered twice: once as usual and once as q ?,9 R, etc.; edges and corners of the first fol. slightly damaged ; condition tolerably good ; complete ; this Ms. contains @ENTATIE. See No.953. Age.- Samvat 1842. Author.- Not mentioned. Subject.--- One of the sutras to be recited by Sadhus at the time of the fortnightly pratikramana. It deals with mahavratas and srutakirtana thus giving us a list of canonical treatises. Prof. Winternitz says on p. 471 of pt. II of 'A History of Indian Literature 'as under : "The Pakkhi or the Paksika-Sutra is a liturgy in verse for the Pakkhi-Padikamanam ( Paksi-Pratikramana), 1. e. the fourteen days' confession. The confession of the "five great vows" ( mahavrata ), with which the work begins, also includes the worship of the patient ascetics" ( khamasamana ), who are accounted the authors of the "sacred scriptures which stand outside the Angas" (angabahiram ) and of the the twelve Angas, which gives rise to a solemn enumeration of the sacred writings (suttakittanam)." The following observation made by him in this very work (pl. II, pp. 429-430 ) may be here noted :-- "The third and fourth Mula-Suttas are also sometimes given as Ohanjjuiti (Ogha-Niryukti ) and Pakkhi ( Paksika

Page #550
1143.] IV. 4 Malasutras 513 Sutra) and sometimes the Pimdanijjutti and Ohanijjutti appear in the list of the Cheya-Suttas." See Weber, Ind. Stud. XVII, 85. Begins.-fol. 1' zrIjinakuzalasUrijI sadA sahAya chai / titthaMkare atitthe atitthasiddha ya titthasiddha ya / siddhe ya jiNe risI maharisI ya nANaM ca vaMdAmi // 1 // etc. -fol. 104 || namo tesiM khamAsamaNANaM jehiM imaM vAiyaM aMgabAhirayaM kAliyaM bhagavaMta taM jahA uttarajjhayaNAI dasAo kappo vavahAro isibhAsiyAI nissAhaM mahAnisIhaM jaMbUdIvapannatI sUrapannatI caMdapannatI dIvasAgarapannatI khuDiyAvimANapavibhattI mahalayAvimANapavibhattI aMgacUliyA vaMgacUliyA vivAhacUliyA aruNovavAe varuNovavAe garuNovavAe vesamaNovavAe velaMdharovavAra deviMdovavAe uhANasue samudANasue nAgapariyAvaliyAo nirayAvIlayAo kappiyAo kappavaDaMsiyAo puphiyAo pupphacUliyAo vaNhIdasAo AsIvisabhAvaNAo dihIvisabhAvaNAo cAraNasamaNabhAvaNAo mahAsuviNabhAvaNAo teagginisaggANa savvehiM pi eyaMmi aMgabAhirie kAlie bhagavaMte samutte saatthe sagaMsthe sannijuttIe sasaMgahiNIe etc. Ends.-fol. IA suyadevayAi bhagavaI nANAvaraNIyakammasaMghAyaM / tesiM khaveo sayayaM jesiM suyasAyare bhattI 1 // iti zrIpAkSikasUtraM / saM0 1842 rA zrAvaNasudi 9 dine / pAlI'madhye / paM. vivekakalyANena likhitaM / Reference.-- Published along with Yasodeva Suri's commentary in the D. L. J. P. F. Series as No. 4 in A. D. 1911. See Weber II, p. 819. For additional Mss. see B. B. R. A. S. vols. III-IV, p. 394, G. O. Series vol. XXI (p. 25) and Limbdi Catalogue Nos. 1544-1547. Nos. 1545, 1546 and 1547 recorded in this Catalogue contain Ksamanaka, Yasobhadra Suri's vrtti and tabba respectively, over and above the text. For description of a Ms. having the bare text see Keith's Catalogue No. 7504. For palm-leaf Mss. of the text see the Pattan Catalogue vol. I (pp. 24, 33, 58, 64, 107, 143, 150, 158, 300, 406, 409 and 4II).

Page #551
514 pAkSikasUtra No. 1144 Jaina Literature and Philosophy Extent.--fol. 5b to fol. 11. Description.-- Complete. For other details see Namaskaramantra No. 735. Begins.-- fol. 5b Ends.-- fol. IIb farfar etc. as in No. 1143. sudevayA bhagavaI etc. up to bhattI / 1 // N. B. For further particulars see No. 1143. ( 1 ) praNipAtasUtra ( No. 886 ) (2) pAkSikakSAmaNasUtra (No. 960) ( 3 ) gurusthApanAsUtra (paMcidiya) ( 4 ) caraNa saptatikaraNasaptatigAthA 1202 (e). 1887-91. Age. Samvat 1864. See No. pAkSikasUtra No. 1145 Size. 10 in. by 4 in. Extent.-8-17 folios; 15 lines to a page; 42 letters to a line. Description.-- Country paper thick, tough and white; Devanagari characters; sufficiently big, broad, legible and good handwriting; borders ruled in three lines in red ink; red chalk used; foll. numbered in the right-hand margin only; the 6th fol. lacking; otherwise complete; edges of the first fol. slightly damaged; condition on the whole very good; this Ms. contains in addition the following four works: as in No. 1143. Paksikasutra 1269 (41) 1887-91. [1144. dr fol. 8a dr dr Paksikasutra 1202 (a). 1887-91. 8a to fol. ga 8b 8b

Page #552
145 IV. 4 Malasatras 515 Begins.-fol. ra facciano a parete etc. as in No. 1143. Ends.--fol. 8a suyadevayA bhagavaI etc. up to bhattI ? as in No. II43. This is followed by the line as under :- .. iti zrIpAkSikasUtraM sammattaM cha. pAkSikasUtra Paksikasutra No 1146 613 (8). 1884-86. Size.-- 118in. by 4 in. Extent.- 53 folios ; 15 to 16 lines to a page ; so letters to a line. Description.- Country paper thick and tough ; Devanagari cha racters with pRSTamAtrA ; bold, big, legible and good handwriting ; borders ruled in four lines in black ink; red chalk used; corners of some of the foll. worn out; condition tolerably good; this work ends on fol. sa ; this Ms. contains over and above this, the following I2 works :-- (1) dazavaikAlikasUtra ( No. 705) foll. so to 211 (2) yati(sAdhu)pratikramaNasUtra , 21, 220 (3) upadezamAlA ,, 22deg ,, 360 (4) zIlopadezamAlA ,, 36",, 39 * (5) piNDavizuddhi ( No. 410) (6) praznottararatnamAlikA (7) jIvavicAra ,, 43* ,, 44 (8) navatattva ,, 44 ,, 45 (9) catuHzaraNa ( No. 274) , 45, 478 (10) gautamapRcchA ,, 47* ,, 48b (1) vivekamArI , 48deg ,, 52 (32) paryantArAdhanA ( No. 403) , 52 ,, 53b ___, 39deg ,, 42 " 42',

Page #553
516 Jaina Literature and Philosophy (1146. Age.-- Old. Begins.--fol. 18 farjat o farao a etc. as in No. 1143. Ends.--fol. 59 great anug etc. up to ufft as in No. 1143. This is followed by gfa quienes FAH:. N. B.- For additional information see No. 1143. 751 (a). pAkSikasUtra Paksikasutra No. 1147 1892-95. Size.-- 101 in. by 49 in. Extent. -- 4 folios; 15 lines to a page ; 46 letters to a line. Description.- Country paper tolerably thick and greyish ; Deva nagari characters ; bold, clear and good hand-writing; borders ruled in three lines in red ink; yellow pigment used ; unnumbered sides decorated with a small circular disc in the centre whereas the numbered, with two more, one in each of the two margins; edges of the first fol. slightly torn ; a strip of paper pasted to fol. 1b; condition tolerably good; complete so far as it goes ; this Ms. contains on fol. 46 an additional work viz. Paksikaksamanasutra which is already described as No. 956 (vide this very pt., pp. 318-319 ). Age.- Samvat 1540(?) See No. 956. Begins.--fol. ra fart 31 fare etc, as in No. 1143,

Page #554
1149.] IV. 4 Malasatras 517 Ends.- fol. 4. duvAlasaMgaM gaNipiDagaM bhagavataM samaM kAyeNa / phAsaMti pAlaMti pUrati tIraMti kiTRti saMmaM ANAe ArAhati / ahaM ca nArAhami / tassa micchA mi dukkddN| iti zrIpAkSikasUtraM samApta / N. B.--For further particulars see No. 1143. pAkSikasUtra Paksikasutra No. 1148 1171 (b). 1887-91. Extent.-- fol. 30deg to fol. 420. Description.-- Complete. For other details see No. 708. Begins.--fol. 30% titthaMkare a titthe etc. as in No. II43. Ends.-- fol. 42 saMmaM kAraNa etc. up to dukkaDaM as in No. 1147. This is followed by suyadevayAi etc. up to bhattI // 1 // as in No. II43. Then we have :-- pakkhiyapaDikkamaNasuttaM sammattaM // N. B.-- For further particulars see No. 1143. pAkSikasUtra Paksikasutra 434 (1). No. 1149 1882-83. Extent.- fol. 14. Description.-- Incomplete as it ends abruptly. For further details see No. 706.

Page #555
518 Begins. fol. 14b pAkSikasUtra graaika No. 1150 Ends.--fol. 14b tattha khala (lu) paDhame bhaMte mahatvae pANAivAyAo veramaNaM / savvaM bhaMte pANAivAyaM paJcakkhAmi / sa (se) suhamaM vA bAyaraM vA / tasaM vA / thAvaraM / vA neva saNaM (yaM) pANe ai. It ends thus abruptly. N. B.--For further particulars see No. 1143. Jaina Literature and Philosophy titthaMkare ya titthe / atitthasiddhe ya titthasiddhe ya siddhe jeNe risI mahArasI nANaM ca vaMdAmi // 1 // Size. 13 in. by 21 in. 1 Extent. - [1149. 189 12 177 leaves; 5 to 6 lines to a leaf; 45 letters to a line. Paksikasutra with vrtti 45. 1880-81. Description. Palm-leaf durable and greyish; Devanagari characters with IS; sufficiently big, legible, uniform and good hand-writing; this Ms. presents an appearance of the work having been divided into two columns; but really it is not so; for, every line of the first column extends to the second; borders of each of the columns ruled in three lines in black ink; leaves numbered in both the margins: in the right-hand one in numbers as 1, 2, etc and in the left-hand one as af, R, 3, s, etc.; leaves 22b 1 and 23a illegible, since the ink has faded; leaf 189b blank; red chalk used; last few leaves stuck together; leaves I to 157 are followed by leaves 170 to 189; both the text

Page #556
1150.] IV. 4 Malasatras 519 and the commentary incomplete; the 189th leaf ends abruptly; condition unsatisfactory; for, edges of almost every leaf partly worn out. Age.-- Old. Author of the commentary.- Yasodeva Suri, pupil of Sricandra Suri, pupil of Vira Gani. Subject. The text together with its explanation in Sanskrit. The latter is composed in Vikrama Samvat 1180. See No. 1155. Begins.- ( text ) leaf 64 22 (com.) 1" namo vItarAgAya || tithaMkare ya tithe etc. as in No. 1147. " zivazammAnamittaM etc. as in No. 1151. Ends--( text ) leaf (?) This cannot be written, since this coresponding leaf has stuck together with another. ~ (com.) leaf 1885 evaM paDikkamaNakAlaM etc. up to mAnataH as in No. 1155. This is followed by the line as under : cha // 11 // maMgalaM mahAzrIH // cha // cha || zubhaM bhavatu lekhakapAThakayoH // cha // Then on leaf 189b we have: yoganivRttAH vibhAgazo aSTAdazapApasthAnavivarjakAnapi tathApi keci danAbhogAtsahasA ... karaNAta mUlottaraguNAticAra sUkSmetaravizuddhayarthe ubhasaM. prAkAle guptasannikai rAjarSizuddhabhAvaprayuktAlocanA uparyupari vizuddhazuddhataracAritrasthAna rohiNaH saMvegataH AtmaniMdA gardA prayuktAH / evaM pratyahaM pratikramaNena vizuddhA api prApte pakSAMte vizeSapratikramaNena pratikramitumicchaMtaH // imANattimapurisANa baMdaNaM kareMti nANAisatyabhAvabhAvaNaM ca // cha // titthaMkare ya gAhA || coyaga Aha // ciTTaDa tAva gAhattho / imaM ta banAumicchAmi paidiNamAloiya paDikkatta (?) kayapacchittavisuddhissa / kiM pakkhacaummA. It ends thus. Reference. Both the text and the commentary are published. See No. 1143. For an additional Ms. see No. 1546 of the Limbdi Catalogue.

Page #557
Jaina Literature and Philosophy [HI. 520 pAkSikasUtravRtti Paksikasutravrtti No. 1151 1284. 1886-92. Size.- 114 in. by 4 in. Extent.-- 63 folios ; 14 lines to a page ; so letters to a line. Description.- Country paper thin and rough ; Devanagari cha racters with pRSThamAtrAs; bold, big, legible and good handwriting; borders ruled in four lines in black ink; red chalk and yellow pigment used; fol. ra blank; edges of the first fol. slightly damaged; condition on the whole good; foll. doubly numbered: once as 1, 2 etc. and once as 766, 767 etc; over and above this, fol. 3 and the following are also numbered as 79, 80 etc.; this work seems to be incomplete so far as the colophon is concerned. Age.-- Pretty old. Author.--- Yasodeva Suri, pupil of Sricandra Suri, pupil of Vira Gani. Subject.-- A Sanskrit commenrary to Paksikasutra. Begins.- fol. 10 OM namaH // zivazamaikanimittaM vighnaughavighAtinaM jinaM natvA / vakSyAmi sukhavibodhAM pAkSikasUtrasya vRttimahaM // 1 etc. Ends.-fol. 634 evaM ca paDikkamaNakAlaM tuli(la)ti jahA paDikkamaMtANaM / zuiavasANe ceva paDilehaNavelA bhavai ti // samAptA ceyaM zAstrAnusAriNI pakSapratikramaNavRttiriti // cha / 'caMdra' kulAMbarazazino bhavyAMbujabodhanakadinapatayaH / guNagaNaratnasamudrA Asan zrIvIragaNimizrAH // 1 //

Page #558
rig2.] IV. 4 Mulasitras zuddhadhyAnajalApanItakalilAH sajjJAnadIpAlayA niHsaMgavratabhAradhAraNaratAstIne tapasyuyatAH grIvAtapravedanaM gurutaraM jetuM sadopasthitA / hemaMteSu ca zArvaraM himabhavaM (raM) soDhuM sadA nizvalAH // 2 // zrIcaMdrasUrinAmA teSAM ziSyo babhUva guNarAziH / AnaMditabhavyajanaH zaMsitasaMzuddha siddhAMtaH // 'kAla' kAladurlabhAnAM guNaratnAnAM nidhAma (na) manavadyaM / samayAvadAtabuddhistathA paro devacaMdragaNiH / 'zrI[:] 2 caMdranAmasUreH pAdapaMkaja sevinA bdheyaM prastutA vRttiH zrIyazodevasUriNA // 5 ' gaMbhIta ( ra?) metadAkarSe nivohazaktirasti mama dakSA || nApI saMpradAyaH samyagbahavazva pAThagamAH // 6 zAstrAnusArAtsukhabodhapAThe (Thai) rAtmIyazaktyA vivRtaM tathApi / yaJceha kiMci. It ends thus abruptly. pAkSikasUtravRtti No. 1152 Reference.- Published. See No. 1143. For additional Mss. see G. O. Series vol. XXI (pp. 8, 18 and 35) and Limbdi Catalogue No. 1546. For a palm-leaf Ms. of the commentary styled as " pakSapratikramaNavRttiH" see the Pattana Catalogue (vol. I, p. 310 ) . Size.-- 11++ in. by 44 in. Extent. - 78 folios; 13 lines to a page 48 letters to a line. Description, 1 ' zrI zrIcaMdra' iti / 2 In the printed edition we have:-- 521 Country paper thin, grey and brittle; Devanagari characters with as; bold, big, legible and very good " gambhIratA na cAhane zaktirasti mama vRkSA 33 Paksikasutravrtti 168. 1873-74.

Page #559
522 Jaina Literature and Philosophy [ 1152. hand-writing; borders ruled in four lines in black ink ; red chalk used; foll. 26-35, 48, 49, 54-66 and 70-75 very grey ; edges of some of the foll. somewhat damaged ; corners of one and all the foll. badly worn out; a piece of paper of the same size as the fol. pasted to fol. 1; condi tion fair; complete. Age. Saihvat 1519. Begins. fol. 1 OM namaH sarasvatyai // zivazamaikanimittaM etc. as in No. 1151. Ends. fol. 77b evaM ca paDikkamaNakAlaM tu etc. up to graM0 3100 as in No. 1155. This is followed by the lines as under : saMvat 1519 varSe zrAvaNa zudi 8 zanivAre liSitaM / iti zrIpAkSI (kSi)kasUtravRttiH samAptA // maMtrikelA likhAvitaM / AMbAlikhitaM / This is followed by the following lines written in a different hand: 'prAgvATa' maMtriThAkurasiMhasRtaH puNyakRjjayati maMtrI | jhabakUdarakhaniratnaM karmAdevallabhaH kelhaH // 1 // yo 'girinAre' yaddaradurgA ttuMgatridevakulikAnAM / kArayitA cA ('s) haMmada nagarottamadharmazAlAyAH / 2 // paMDitapadapratiSThAdevAlayapacakAdikArayitA / sakalavibudhayeSArpaNasAdharmika samaha bhaktikaraH / 3 // zrI. sUrIzvaropadazena tena siddhAMtaM / lekhayatA lekhi pratireSA 'rasazazitithimite (S) bde / 4 // This is followed in a still different hand by the versc as under:-- zrImad 'bRhattapa'nAthazrIsUrasuMdaragurUNAM / ziSyo (S) vAcadetAM pratimasamAM samayamANikyaH / 5 // N. B.- For further particulars see No. 1151. 1 Letters are gone since the folio is worn out. 3 1519.

Page #560
113. IV. 4 Malasatras 323 pAkSikasUtravRtti Paksikasutravrtti 764. No. 1153 1699-1915. Size.- 121 in. by 4t in. Extent.-49 folios ; IS lines to a page ; 64 letters to a line. Description.- Country paper rough and greyish ; Devanagari cha racters; bold, big, clear and good hand-writing ; borders ruled in four lines in black ink ; red chalk used ; yellow pigment, too; edges of the first fol. slightly damaged; on fol. I we have patra 38 aMtormadhyavicAra // 1, patra 4 pAkSIvicAra 2 written ; otherwise it is blank ; condition tolerably good; complete ; composed in Samvat 1180; extent 2700 slokas. Age.- Fairly old. 3egins.- fol. ib ahe namaH zivazarmaikanimittA(ta) etc. as in No. IISI. Ends.-fol. 49 evaM paDikkamaNa etc. up to graMthamAnataH // 11 // as in No. 1155. This is followed by the lines as under : graMthAnaM 2700 / AgamikazrIamarasiMhamUribhiralikhyate / pajjUjasaNe caumAse pakkhi ya pavvadramIsu nAyavvA / tAu tihiu jAsiM uDayau sUro na annAo // 1 // dazAzrutaskaMdha bhASyate / iti pAkSikasUtraTIkA saMpUrNA. Then in a different hand we have :ityAdyA sasUtrA vRttiH) 3100 / zrIyazodevamUribhiH kRtA / saMvat 11800 varSe 'aNahallapATake' nagare vRtti kRtA N. B.-- For further particulars see No. IISI.

Page #561
524 pAkSikasUtravRtti No. 1154 - Size.-101 in. by 41 in. Extent. 63 folios; 15 lines to a page; 48 letters to a line. Description.-Country paper whitish and tough; Devanagari characters with gears; bold, big, legible and good handwriting; borders ruled in four lines in black ink; foll. numbered twice as usual; fol. 1a blank; foll. 55 to 60 slightly worm-eaten; condition tolerably good; complete; extent 2700 slokas. Age.- Pretty old. Begins. fol. 1: Ends.-fol. 63b Jaina Literature and Philosophy pAkSikasUtravRtti No. 1155 etc. as in No. 1151. evaM ca paDikkramaNa etc. up to vikramAgataiH as in No. 1155. This is followed by the lines as under a aga gacfii: aeafidgarza: 11 [1154. Paksikasutravrtti 227. 1902-1907. ara`gan'aysi arasdagamieai 'A$?(t:) | yAvaccaMdrAdityau tAvadidaM pustakaM jayatu | zrI // graMthA 2700 cha / etc. N. B.--For further particulars see No. 1151. Paksikasutra vrtti Size. 131 in. by 5 in. Extent. 57 folios; 15 lines to a page; 56 letters to a line. 1203. 1887-91.

Page #562
1155.1 IV. 4 Malasatras 125 Description.-- Country paper thin and tough ; Devanagari cha. racters with occasional pRSThamAtrAs; bold, big, legible and elegant hand-writing ; borders ruled in two thick red lines; the interlinear space coloured yellow ; numbers for foll. entered twice as usual ; the first fol. slightly torn ; foll. 6 to 17 somewhat worm-eaten ; so are the foll. 31 to 42; condition tolerably fair ; complete; unnumbered sides decorated with a small pattern in the centre, whereas the numbered, in the margins, too ; extent :3100 slokas ; composed in Samvat 1180. Age.-- Pretty old. Begins.-fol. 10 OM namaH sarasvatyai / / zivazammaikanimittaM etc. as in No. IISI. Ends-- fol. 57a evaM ca paDikkamaNa etc. up to vivRtaM tathApi as in No. IISI. This is followed by the lines as under :paJceha kiMcidvitathaM nibaddhaM tatrAstu mithyA mama duHkRtaM hi // 7 // 'aNahilapATaka'nagare sauvarNikanomacaMdrasatkAyAM / varaSauSadhazAlAlA(yAM) rAjye jayasiMhabhUpasya / 8 / vizAradaiH mUrivaraivihAribhi vizodhitA yalaparAyaNairiyaM tathApi yajUnamutAdhikaM padaM tacchodhinIyaM kuzalaiH kRpApadaiH // 9 // zubhAzayavazAJceha yanmayA sukRtaM kRtaM tena bhUyAnmamAbhyAsaH sarvadeva jinAgame // 10 // ekAdazazapta(te)radhikarazItyA vikramAgataiH / trINi zlokasahasrANi zatakaM graMthamAnataH // 11 // graMthAgraM 3100 zubhaM bhavatu // cha / cha / N. B.-- For further particulars see No. IISI.

Page #563
526 Jaina Literature and Philosophy [rigo. Paksikasutravrtti pAkSikasUtravRtti No. 1156 1283. 1891-95. Size.-144 in. by i in. Extent. -- 259-2=257 leaves ; 3 to 4 lines to a leaf ; 44 letters to a line. Description.- Palm-leaf durable and greyish ; Jaina Devanagari characters with ATS; big, legible, uniform and good hand-writing ; this Ms. presents an appearance of the work having been written in two separate columns; but, really speaking, it is not so; for, the lines of the first column extend to the second ; borders of each of the columns ruled in four lines in black ink; red chalk used; leaves numbered in both the margins; in the right-hand one as 8, 4, 6 etc. and in the left-hand one as us, & etc.; the first two leaves missing; the leaf placed before the fourth is taken here to be the third; but since the marginal portions etc. are worn out, it is difficult to ascertain its real number ; almost half the part of several leaves worn out; condition unsatisfactory ; leaf 2596 blank ; leaves : 276 and 128a illegible, ink having faded; an extra blank leaf at the end; a hole almost in the centre of each leaf through which a red string passes ; leaves are placed between two wooden boards. Age.- Samvat 1275. Begins.-leaf 36 (?) Tafta sintraatan taifa 1 3991 alffa aati ng pala S ALT at eto ar....... sata v maria etc. Ends.-leaf 2583 evaM ca paDi kamaNa etc. up to vivRtaM tathApi as in No. 1151. This is followed by the lines as under : yaha kiMcidvitathaM nibaddha tavAstu mithyA mama duHkRtaM hi // 7 // 'aNahilapATaka'nagare saurNiNakanomicaMdrasatkAyaM( yAM) gharapauSadhazAlAyAM rAjye jayasiMhabhUpasya // 8 //

Page #564
157.] IV. 4. Malasatras 527 vizAradaiH sUrivarai :]vi(vi)hAribhi vizodhitA yatra parAyaNariya ... ... zIlarupAparaiH // 9 // zubhAzayavazAha yanmayA sukRtaM kRtaM tena bhUyAnmamAbhyAsaH sadaiva jinA... ekAdazazatairadhikarazItyA vikramAdrataiH / / dve sahasra zatairadhike saptabhigraMthamAnataH // cha / saMvat 1275 varSe kArtikazudi 5 gurau aoha zrIma(5)daNahilapATake' pUjyazrIkulaprabhasUriyogyA Thakkara AzApAla Tha0 sUhadevyAH sutayA sUmalazrAvikayA pAkSikasUtravRttipustikA lekhitA' // cha / zivAya bhavatu // cha / / etc. N. B.- For further particulars see No. 1151. pAkSikasUtrAvacUri Paksikasutravacuri 214. No. 1157 1871-72. Size.-- 104 in. by 48 in. Extent.- 6 folios ; 23 lines to a page ; 7o letters to a line. Description.-- Country paper very thin and greyish ; Jaina Deva nagari characters with occasional pRSThamAtrAs; very small, clear and good hand-writing; borders ruled in four lines in black ink ; edges of the 6th fol. slightly damaged ; con dition on the whole good ; red chalk used ; complete. Age.-- Pretty old. Author.- Not mentioned. Subject.-- A small commentary on the Paksikasutra based upon the bigger commentary by Yasobhadrasuri. Begins.- fol. I titthaM cazabdAdatItAnAgatAdIn / tIrtha vibhaktivyatyayAt / pAThAMtarato vA titthaM ti / etc. 1 If this is to be taken as likhitA meaning ' written', then this is a Ms. written by a female For a Ms. of Malayagiri Suri's con]. on Avassaya written by a braviki pamed Rupade, soe Jainacitrakalpadruma (Punyavijayaji's article, p. 53 loot-note 70).

Page #565
528 Jaina Literature and Philosophy ( 1157. Ends.-- fol. 1 TE H ALIA ITT: 1 yTao face to factant to hear nijapratijJAyA bA pAragAH saMsArasamudratIragAmino bhavata yUyamityAzIrvacanaM // cha // iti zrIpAkSikasUtrAvacUriH // zrIcaMdrasUriziSyazrIyazobhadra sUrikRtavRttito likhitA // cha / graMthAya 621 Reference. - In the Limbdi Catalogue there are two Mss. of CINE anaf one of which is anonymous and the other by Balacandra. Their Nos, are 1548 and 1549 respectively, pAkSikasUtra Paksikasutra avacUrisahita with avacuri No. 1158 1282 (a). 1891-95. Size.-- 101 in. by 44 in. Extent.- 4 folios ; 13 to 14 lines to a page ; 56 letters to a line. Description. - Country paper very thin, rough and white; Jaina Devanagari characters with frequent TEATS; small, legible, uniform and good hand-writing ; this is a quart Ms., the commentary written in a very very small handwriting ; borders ruled in four lines in black ink; red chalk used; yellow pigment, too; soll. numbered in the right-hand margin only; condition very good ; the text complete ; but the avacuri ends abuptly, on fol 36; this Ms. contains an additional work viz. GITHEPHUT which commences on fol. 46 and ends on the same fol. 4b; it is described as No. 958. Age.- Fairly old. Author of the avacuri.-- Not mentioned. Subject.--- The text with a small commentary in Sanskrit. Begins.--( text ) fol. 12 faciat o faco etc. - (com.) fol, 1 nafargatava: Hraquintare par warraroente el ......farfrancatatea freirvard cic,

Page #566
I159.] IV. 4 Malasfiras 529 Ends.- ( text ) fol. 4' imaM vAi duvAlasaMga gaNipiDagaM bhagavaMtaM saMmaM kAraNa phAsaMti pAlaMti pUraMti tIraMti kiTRti samaM ANAe ArAhati ahaM va nArAhAmi tassa micchA mi dukkaDaM // cha / iti pAkSikaM // ,, -(com.) fol. 30 evaM naJcaNeNa bhaviyavvaM ti // 8 // pRthivyaptejovAyuvana ......tricatu paMceMdriyabhedAt // . navabaM navabraha. This ends thus abruptly. Reference.- For description of a Ms. having the text and an anonymous avacuri see Keith's Catalogue No. 7505. See also G.O. Series, vol. XXI, p. 35, No. 275 (4). pAkSikasUtrAvacUrNi Paksikasutravacurni No. 1159 1182(b). 1884-87. Extent.- fol. 14b to fol. 224. Description.-- Complete. For other details see No. 728. Age.- Pretty old. Author.- Not mentioned. Subject.--- A small commentary in Sanskrit on Paksikasutra. Begins.- fol. 34 OM natvomaH zrIsudharmasvAmine / titthaMka 0 cazabdo(s)tItAnAgatAditIrthabhedasaMgrahArthe etc. Ends.---fol. 22 zrutadevatAstutimAha | sua0 zrutAdhiSThAtrI devatA zrutadevatA bhavati ca zrutAdhiSThAtrI || yaduktaM kalpabhASye salaM ca lakakhaNoveyaM samahinaMti devyaa| suttaM tu lakakhaNoveyaM teNaM savannabhAsi // 1 // pAkSikasUtrAvacUrNi(:) samAptA // Reserence. See Nos. 1157-1158.

Page #567
530 Jaina Literature and Philosophy [I160. Paksikasutravacuri pAkSikasUtrAvacUri No. 1160 1285. 1886-92. Size.-- 101 in. by 41 in. Extent.- Io folios ; 19 lines to a page ; 64 letters to a line. Description.-- Country paper thin and greyish ; Devanagari cha racters with occasional pRSThamAtrAs; bold, small, clear and good hand-writing ; borders ruled in three lines in red ink; red chalk used; edges of foll. 9 and 10 partly torn ; condition tolerably good ; complete ; extent 1000 slokas. Age.- Pretty old. Author.-- Not mentioned. Subject.- A small commentary on the Paksikasutra. Begins.-fol. ! titthaMkare tIrthaMkarAMzcazabdAdatItAnAgatAditIrthAn / tIrtha jina pravacanaM tadAdhAratvAccaturvarNasaMghazca / etc. Ends.-- fol. Io" ihAcAryavacana nitthAragapAragA hoha / nistArakA saMsArasamudrAta prANAnAM pAragAH saMsArasamudratIragAmino bhavaMtu yUyamityAzIrvacanamiti // 4 // ____ iti pAkSikasUtrasyAvacUriH samAptaH / cha / etc. zreyo'tra zrIzramaNa saMghasya / yAdRzaM etc. leSakaDAhAliSitaM / 'senApUra vAstavyaH / leSaka etc. Then in a different hand we have : graMthAMka 1000 // Reference.-- Sce No. IIS7-II58.

Page #568