Book Title: Jaina Biology
Author(s): J C Sikdar
Publisher: L D Indology Ahmedabad

View full book text
Previous | Next

Page 209
________________ Jaina Biology muscle of arm bone (Biceps and triceps branhii) is like the shape of a large skinned rat and twice the size.7 198 Mention of 500 muscles of man, 470 muscles of woman and 480 muscles of the neuter in Jaina Biology suggests that in the Vertebrates three types of muscles have evolved to perform various kinds of movements. (1) skeletal muscle, which is attached to and moves the bones of the skeleton, (2) cardiac muscle which enables the heart (hiyaya) to move and moves the blood through the circulatory system (śira, dhamani and srota) and (3) smooth muscle, which makes up the walls of the digestive tract and certain other internal organs, and moves material through the internal hollow organs. The Muscles of Lower Animals. The muscles of all animals from the flat worm to man are similar in that they are all made of long cylindrical or spindle - shaped fibers "which are contractible because of the protein chains."8 Most of the invertebrates (two to four-sensed animals) have only smooth muscle; whereas arthropods (ganḍupada-knotty-legged and Nandyavarta=spiders, Arthropoda, etc.) have only striated muscle. 7. Ibid. (97) "Santthanato janghapinḍikamamsam talapanṇaputabhattasanthanam Ürumamsam nisadapotasa mthanam / Anisadamamsam- uddhanakotisanthanam / pitthimamsam talagulapatalasamthanampasakadvayamamsam kottha ikaya kucchiyám tanumattikalepasanṭhāna mtibanama msam vatjevtvä avakkhittmattikäpindasamthianaṁ.. pakatam hoti" (97). "Disato dvisu disāsu jātam. Okasato sadhikani tini atthisatani anulimpitvā thitam. etc.", Ibid, 93. 8. Biology, p. 350. Jain Education International For Private & Personal Use Only www.jainelibrary.org

Loading...

Page Navigation
1 ... 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340