Book Title: Epigraphia Indica Vol 17
Author(s): F W Thomas, H Krishna Sastri
Publisher: Archaeological Survey of India
Catalog link: https://jainqq.org/explore/032571/1
JAIN EDUCATION INTERNATIONAL FOR PRIVATE AND PERSONAL USE ONLY
Page #1
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA Vol. XVII (1923-24) LOL pratnakIrtimapAvRNu PUBLISHED BY THE DIRECTOR GENERAL ARCHEOLOGICAL SURVEY OF INDIA JANPATH, NEW DELHI-110001 1983
Page #2
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA Vol. XVII, 1923-24. LO pratnakAtimapAvaNa PUBLISHED BY THE DIRECTOR GENERAL ARCHAEOLOGICAL SURVEY OF INDIA JANPATH, NEW DELHI-110011 1983
Page #3
--------------------------------------------------------------------------
________________ Reprinted 1983 ARCHAEOLOGICAL SURVEY OF INDIA GOVERNMENT OF INDIA 1983 Price: Rs. 75.00 Printed at Pearl Offset Press, 5/33 Kirti Nagar Industrial Area New Delhi-110015.
Page #4
--------------------------------------------------------------------------
________________ PUBLISHED UNDER THE AUTHORITY OF THE GOVERNMENT OF INDIA EPIGRAPHIA INDICA AND RECORD OF THE ARCHAEOLOGICAL SURVEY OF INDIA Vol. XVII, 1923-24. EDITED BY RAO BAHADUR H. KRISHNA SASTRI, B.A., GOVERNMENT EPIGRAPHIST FOR INDIA. CALCUTTA: MANAGER, GOVERNMENT OF INDIA CENTRAL PUBLICATION BRAXCH. BOMBAY: BRITISH INDIA PRESS. LONDON: KEGAN PAUL, TRENCH, NEW YORK: WESTERMANN & Co, TROBNER & Co. CHICAGO: S. D. PEET. PARIS: E. LEROUX.
Page #5
--------------------------------------------------------------------------
Page #6
--------------------------------------------------------------------------
________________ Title-page Contents List of Plates... Additions and Corrections No. 1. Gudimallam Plates of the Bana King Vikramaditya II. By Professor E. Hultzsch, Ph. D.; Halle (Saale) " ,, 2. Tumbagi Inscription of the reign of Satyasraya: Saka 926. By Lionel D. Barnett ,, 3. A Naga Figure in the Mathura Museum. By Y. R. Gupte, B. A. 4. A Vakataka Inscription from Ganj. By V. S. Sukthankar, Ph. D. 5. Mandagappattu Inscription of Vichitra-Chitta. By T. A Gopinatha Rao, M. A., Trivandram 99 " 19 39 CONTENTS. " "" 8. Srirangam Copper-plate Grant of Devaraya II Saka 1349 (1350). By the late T. A. Gopinatha Rao, M. A., Trivandrum " 20 16. Velvikudi Grant of Nedunjadaiyan: the third year of reiga. By H. Krishna Sastri, B. A. PAGE sco sb -nnddsr dd khkrnndd ii iinnddnri ,, 14. Somalapuram Grant of Virupaksha Saka 1389. By K. V. Subrahmanya Aryat, B. A.. M R. A. S. ... 1 15. The Brahma-Siddhanta of Brahmagupta A. D. 628 Mean System By Robert Sewell (I.C.S., Retired) i vii 9. Momigatti Inscription of the 49th year of Vikramaditya VI. By Lionel D. Barnett 117 10. Arasibidi Inscription of the Reign of Somesvara I.: Saka 969 By the same ... 121 ,, 11. The Brahma-Siddhanta of Brahmagupta (A. D. 628). By Robert Sewell (I. C. S., Retired) 123 .. 12. Kedarpur Plate of Srichandradeva. By N. K Bhattasali 13. A note on the dates of the Gupta copper plates from Damodarpur. By K. N. Dikshit. M. A. ... 7 6. The First Arya-Siddhanta: Mean System. By Robert Sewell, I. C. S. (Retired) 7. Two New Grants or Dhruvasena [I.] from Palitana By V. S, Sukthankar, Ph. D. 105 10 12 14 ... 110 188 ... 193 291 17. Nalanda Copper-plate of Devapaladeva By Hirananda Sastri, M.A., M.O.L.. 310 18. Mattepad Plates of Damodaravarman. By Professor E. Hultzsch, Ph.D. 327 19. Urlam Plates of Hastivarman; the year 80. By the same 330 20 Ipur Plates of Govindavarman's son Madhavavarman. By the same 19 .. 21. Ipur Plates of Madhavavarman II. By the same ,, 22. Revised Text and Translation of Two of the Kuram Plates: By the same 205 334 337 340 .. 23. Dhanaidaha Copper-plate Inscription of the Time of Kumaragupta I: the year 113 By Radhagovinda Basak, M. A., Calcutta 345 24. Some Image Inscriptions from East Bengal By N. K. Bhattasali M.A, Curator, Dacca Museum 349 ,, 25. A note on the Vakataka Inscription from Ganj. By K. N. Dikshit, MA, Poona 362 Index 363
Page #7
--------------------------------------------------------------------------
________________ The names of contributors are arranged alphabetically. PAGE, . . . . . . 117 . 14 846 L. D. BAXNATT, M.A.: No, 2. Tumbaga Inscription of the reign of Satyasrays; Saks 926 . . . . 9. Momigatti Inscription of the 19th year of Vikramaditya VI. . . . 10. Arnaibidi Inscription of the reign of Somesara 1 : Saks 969. . . . R. BABAE, M.A.: No. 28. Dhansidaba Coppor-plate Inscription of the time of Kumaragapta I. the year 118 N. K. BHATTASALI, M.A.: No. 12. The Kedarpur Plate of Srichandradevs . . 24. Some Image Inscriptions from Kast Bengal . K. N. DIKSHIT, M.A.: No. 18. A note on the dates of the Gapta eopper-plates from Damodarpur . . . 26. A note on the Vakataks inscription from Gadj . . . . . . T. A. GOPIKATHA BAO, M.A.: No. 6. Mandagappatto Inscription of Vichitra-Chitta . . * 849 193 .862 . ,, 6. Srirangan Copper-plato grant of Devaraya 11: Beko 1549 (1350) :::: . . . . . . . . 850 Y. B. GUPTE, B.A. - No. 8. A Naga figure in the Mathurs Museum HIRAWANDA SASTRI, M.A., M.O.L.: No. 17. The Nalanda copper-plate of Devapaladeva . . E. HOLTZBOH, PE. D.: No. 1, Gudimallam Plates of the Bana king Vikramaditya II . . 18. Mattepad Plates of Damodara varman 19. Urlam Plates of Hastivarman; the year 80 . . . . 20. Ipur Plates of Govindavarman's son Madhavavarman. . . 21. Ipar Plates of Madhavavarman II . . . , 23. Revised Text and translation of two of the Kuram Plates . . A. KRISHNA ASTRI, B.A. No. 16. Velvikadi Grant of Nedunjadaiyan: the third year of reign . . R. SEWELI, 1.C.S. (retired) : No. 6. The First Arya-Siddhanta : Mean System . >> 11. The Brohma-Siddhanta of Brahmagapta (A. D. 828). 16. The Brahma-Siddhanta of Brabmagupta, A. D. 628: Mean System K. V. SUBRAHMANYA AYYAR, B.A., M.B.A.S.: No. 14, Somalapuram Grant of Virupaksba : Saka 1389 . . . 7. 8. SULTHANXAR, PE.D.:No. 4. A Vakataka Inscription from Ganj . . . 7. Two new granta of Dhruvassa I from Palitana. . . . . 205 . . . . . . 12 105 INDEX. . . . . . . . Title page, Content, List of Plates and Additions and Corrections . . . . . . . . . . . . . . H 363 ii
Page #8
--------------------------------------------------------------------------
________________ No. 1. Gudimallam plates of the Bana king Vikramaditya II. 2. Mathura Naga Image inscription; the year 8 of Kanishka n 33 LIST OF PLATES. 30 >> 4. Two Palitana Grants of Dhruvasena [I] 5. Srirangam Copper-plate of Devaraya II: Saka-Samvat 1349 (1350) 6. Velvikudi grant of Nedunjadaiyan: the third year. Plate I. 7. " Plate II 30 >> 8. Nalanda plate of Devapaladeva. n 3. A Vakataka inscription from Ganj and Mandagappatta inscription of VichitraChitta 30 9. Mattepad plates of Damodaravarman. 10. Urlam plates of Hastivarman: the year 80 11. Ipar plates of Govindavarman's son Madhavaraman 12. Ipur plates of Madhavavarman II. 18. Plates III & IV of the Kuram grant of Paramesvaravarman I, 14. Dhanaidaha copper-plate of the time of Kumaragupta I: the year 118 15. Some Image inscriptions from East Bengal.. between pages "" . to face page * between pages " 39 wr 33 33 "9 33 39 to face page 4 & 5 10 & 11 18 108 & 109 114 & 115 208 & 299 300 & 301 320 & 321 328 & 329 332 & 333 334 & 335 338 & 339 340 & 341 347 356
Page #9
--------------------------------------------------------------------------
Page #10
--------------------------------------------------------------------------
________________ Page 2, 1. 5.-For-viddhyud- read -viddyud 24.--For (puram) read (puravu). "1 33 33 6, Trauslation of 1. 37-Sivankasrayabhyah translated "who resided near (the temple of) Siva" suggests that the recipient Brahmins had their homes near the Parasuramesvara temple at Gudimallam, for which there are not sufficient indications at present. Perhaps a better interpretation of the compound would be Sivankanam asrayah, the abodes of symbols (such as ashes, beads, linga etc.) of Siva. 39 99 12 29 "1 31 ,, 10, 1. 15.-For Chandala read Chandala, ,, 11, Text 1. 3.-[Possibly Niya was the name of the carpenter (vadaki) who made the gift. H. K. S.] 1. 38.-For Bhami naga read Bhiminaga. 8.-For blocks have read block has. "9 ADDITIONS AND CORRECTIONS. Page 15, f. n. 2, 4th line for zrI mahendravikramavarmA read 18, 1. 16-insert comma after 307. " 25 vil "" last line. For before r, read after r, 13.-Insert at the end of the introduction on page 13. [Prof. Hultzsch and Mr. K. N. Dikshit have simultaneously invited my attention to Dr. Sukthankar's omission to have noted the very important paper on the Poona plates of the Vakataka queen Prabhavati Gupta, the daughter of the Gupta Emperor Chandra Gupta II, which Messrs. Dikshit and Pathak had together published on p. 39 of Vol. XV of the Ep. Ind. From this it is clear that Prabhavati Gupta and her husband Rudrasena II, the sixth in descent from Pravarasena II, were contemporaries of Chandra Gupta II, the son and successor of Samudra Gupta of the beginning of the 5th Century A.C. Consequently, the Ganj inscription which, paleographically is ascribed to be that of Prithvishepa I, must belong to about the end of the 4th Century A C.; but it is very unlikely that the Prithvishena of this inscription is the first of that name. If, however, he is the second, the record may be roughly referred to the beginning of the 6th Century A.C.--H. K. S.] zromahendravikramavarmA 19 >> 106, 1. 11-For bhata-vatadeg read bhuta-vatao. paras. 3 & 4.-[Dr. Sukthankar in criticising Dr. Sten Konow with regard to the meaning of ra has not noted the significance of the word van which occurs in of line 4 of the Khariar grant of Mahasudeva where two villages Navannaka and Sambilaka adjoining Navannaka, were granted. There is, thus, no indication of Navannaka being a territorial division expressed by the term added to it as supposed by Sukthankar, whereas was as an independent word indicates certainly the sense of proximity, or better, a dependence on the village immediately mentioned before it.-Ed.] 107, Text, 1. 10.-Insert af after 1. n. 6.-For rend . 7. - For bAmavA cavya' read grAme vAstavya " 39
Page #11
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [VOL. XVII. Page 108.-Inscription B.-The missing second plate of this inscription has been discovered at Iyaveis by Mr. D. B. Diskalkar, M.A., Curator, Watson Museum of Antiquities, Rajkot, and will shortly be published by him in this journal. Ed. > 108, f. n. 2.--For upadmaniya read upadhmaniya. ,, 109, 1. 10.-Dr. Sukthankar is not right in his guess; for the dutaka of the grant as found in the missing plate is Rudradhara. But the writer was Kikkaka, here spelt Kikaka.-Ed. 109, f. n. 2.- Por Dhravasona read Dhruvasona. , 110, 1. 3.- For Rotgbamitra read Rotghamitra. >> 1. 5.-For Afvina read Afvayuja. >> Text 1.7.-For-gitan read -gitau. >> >> >> 8.-For achchhetta read achchbetta. >> >> 9.-To -vva, add the footnote 'Read -va'.-Ed. >> >> >> 11.-For Kikkakena read Kikkakena. , f. n. 2.- For dgami read agami. .., 111, 1. 3.-For 34' read '33'. >> >> >> 8.-For these two sets' read this set'. >> >> >> 16.-For Tirunalur read Tirunalur. > , For onallar read onalar. ,, ,, -For Sonepuhao" read 'Sanaiptbao.. , 17.-Insert after Narayanambika', " or Naranadevi-auva." 11 from the bottom.- Por Tirunalur read Tiranalar. For operama-nallar read peruma-nalar. For Suneo read Sunai'. For Melmugi read Melemuri. For Mala-nadu read Mala-nada. 8 >> >> Insert before. villages ', "first three". For Tiruchchirappalli read Tiruchchirapalli. Insert after twelve' the following : " harivaras of food should be supplied, one". For lamps read lamp. Insert afterburned ' "one". For garlands read garland. last line. For 1,82 read 1,823. ,, 112, 1. 2.-Insert van-payir' after 'punsey'. >> >> For opperu read Opperuo. > 3.-Cancel (tari-kadamai). > , For alukkuo read olukku". ., 4.-For kattigai-avasaram read kathige-avasara. For palai-kanikkai read padai-kanike. 10.-For Paro read Per. , , ,, 11.-Omit the passage from Alukku to ntrarikkam in l. 13. 13.-For Magamai read mahamai. ,2 , 17.-For Kaffigai-avasaram read Kathige-avasara and add in a foot-note (This term does not indicate any tax on firewood as the anthor suggests but may have to be connected with kaftige-yava, a mace-bearer, or in this into the village servant who carries the staff of office with him.- d.) * The following numerous corrections on pp. 111 to 117 have been necessitated by the proot being paru by the ofice in the belief that it had been revised by the author].
Page #12
--------------------------------------------------------------------------
________________ Page 112, 1. 18.-For -kkapikkai read kanike. 33 33 "3 29 32 99 "" "" 53 39 93 39 33 99 23 33 "" 33 32 " 33 " "3 33 "" r "1 21 33 27 "" 33 93 39 33 31 39 33 35 113 15 37 33 39 23 33 31 33 22 35 33 3" "3 " 33 33 39 "" 27 33 33 33 23 fn. 9. - For asnAna reul amnAnaM. 33 114, Text 1. 29.-For read and add in a footuote" is the letter pa as generally transcribed in Nagari,-Ed.]" ,, 31.-For a read and correct into deg. 35 23 34.-For ma-rallir read "ma-nalur. 35.-For Sunepuha" read Saanipaha". 33 Text, 1. 1.-Remove the unnecessary extra bracket after (:) and insert a hyphen at the end of the line. 31 33 33 23.-For Tiruchchirappalli read Tiruchchirapalli 33 23.-For Tirunalar read Tirunalar. 24.-For Seranai read Seranai and for nallar read nalar. 24.-For Molmuri read Melemuri. 24.-For Mala-nadu read Mala-nadu. 24-For Sune read Sunaideg. 26.-For Tiruchchirappalli read Tiruchchirapalli. 29. For Mala-nadu read Mala nadu. 33.-For Tirunalar read Tiranalar and insert after it, [-Tirunallur], 33.-For Seranai read Seranai. 2.-For read . 3.-For read and cancel font-note. 6. For maMbudhi' reud maMbUdhi'. 8.-For a read a. 14. - For hArihari read hArI hari "3 23.-For a read " 33 "3 19 33 33 ADDITIONS AND CORRECTIONS. ,, 34. - For mAsi read mAsau and correct into mAsi. 36.-Insert after [] the letter '' and correct [1] into [. 37.-Carry the footnote number 14 tot of the preceding word. ,,,,, - For fana real fat and correct into na. Insert space after and 33 29 ,38.-Correct in a foot-note af into fq. for "kaMvA read kaMnya". 33 13 ix 33 33 --Insert as a foot-note on prahanapade :- " [pravRjapade porhaps stands for pANDajanaparda which is perhaps a Sanskritised form of Malanada.-Ed.]" , - Correct sunepu naluradhA into sunepuhanalUgyo in a foot-note. -Insert after it "[*]." 31 40. - Read zrIraMgagaja pari as one word. 33 41.-After"" insert [24]. -For afat reulf and correct the same into af [i]. 39.--Insert "[ 23 ]" after anl add a foot-note "read af [sarfare]. [This word which occurs in connection with Rajagambhira and Rajaraja, both in lines 36 and 38 f, has perhaps to be understood in the sense of the Tamil, a territorial subdivision, as suggested also by its use below, in 11. 52 and 56 f.-Ed.]" 13
Page #13
--------------------------------------------------------------------------
________________ X 39 Page 114, Text 1. 42.-Insert a foot-note on :-"Ready". 41. - For nArAyaNa' read nAraNa'. ,, 46.-For uft read fdeg and insert spaces after and - For vagamAle read banamAle. 37 47.-For fa read faft and correct into fax. The letters at ought to be in [ ]. 9.--Add at the end: "[ Perhaps was meant-Ed.] " 13. - For bhikAveryA read bhidhe kAveryA. 14.-Cancel the hyphen at the end and insert [|| 22*] 15. - For satyakanyAyA read sA kanyAyA 33 19 37 "" 19 33 33 33 29 "3 33 33 33 33 23 39 39 35 33 99 33 33 39 "" 33 13 "" 29 39 33 " "1 33 39 33 "" "" 33 22 39 19 33 19 33 33 33 33 13 22 39 33 115, Text 1. 51.-For a read "3 39 39 33 23 33 33 33 33 "3 23 33 33 11 f. n. "" 33 3) "3 33 33 33 29 "3 33 33 33 33 33 "" 33 "3 33 Vv. 39 " 16 & 17. [Perhaps metrical considerations would require some corrections like zrIraMgarATsaparyArthaM nAbhyAmbAbhidhAnataH --Ed.] 54. - Correct tiramAlUra into timanAra. 31 read ,, 55.-For 56.-In 80 -For 13 33 33 "" 33 39 67.-Carry foot-note No. 15 to the end of gar. 71.-Insert space after the first letter in the line and correct in a foot-note mArca into pAcaM. f. n. 4.-Omit at the end of the correction. 6. 22 " 116, Text 1. 75.-For 22 read 25 and for at read at and correct into 76.-For fad read feat and correct into ufe au. 77.-For 23 read 26. 79.-For 24 read 27. "" EPIGRAPHIA INDICA. 25. - For cAndaka read coMdake. 33 53.-Correct in a foot-note, fe into "fa". 33 35 33 -For 57.-For 58.-For read (:) read 59.-Insert a space after and correct into a put the nought in square brackets with an asterisk. read t 33 read ". and correct in a foot-note into . 9. - For cAndake read cInda ke. 14. - For paca read pace. 15. For hosavara read enuhuMcA. 33 33 [VOL. XVII for kaNDa i. e., mekaNDa - Ed.]" 64.-For read and correct the whole into tai in a foot-note. and add in a foot-note "[ perhaps stands 80. For at read datA aud correct inte dattA'. 82.-For at read degdeg. -For 26 read 29. 83.-For fa read fa and correct into degfa. 6-7.-For kaustabha read kaustubha. 10-12, last sentence.-For Lakshmi read -Sri and for as read the. Change the foot-note thus: "Read as as in the Sanskrit portion in 1. 37."
Page #14
--------------------------------------------------------------------------
________________ ADDITIONS AND CORRECTIONS. Page 116, line 3 from the bottom.-For Sera- read Serao. >> >> >> >> -For Sane read Sunaio >> last line.-For Monday real Sunday. , f. n. 3.- Insert and before parfa. , 6.-Insert before fe " , , 7.-Insert dattApa before haraNa. >> >> >> 8.-Cancel apicu. , 117, 1. 3.- For Seranaibenda- read Seranaibanda , , 4.- For Trisirappalli read Tiruchchirapalli. , ,, 6.-Insert Sahyakanya before Kaveri and put the latter in round brackets and add " in the Pravsidjanapada i.e., in the Mala-nada district". para. 2, 1. 3.- Insert at the end of the line "sacred food. of one". ,, 4.-For lamps read lamp and insertone after the comma. 4.- For garlands read garland. 5.-For Narayanao read Narana'. 5.- Insert after Pandamangalam with its hamlets." >> >> >> 6.-For Suneorend Sunaio -For Chirichrapalli read Tiruchchirapalli. 11.-- I'or Sane read Sunai'. >> >> >> >> 12.-For Melamuri read Malemuri. ,,, 12.- Mala read Mala. , 17.---Cancel tarikkadamai at the end of the line. , , 18.-For aliokunipattum, read olukkanirpattam. , ,, 18.-F'or verses 22-26 read verses 25-29. 118, text lls. 5 & 6.-I would add a hyphen at the end of 1, 5 and take mahodaya mahidharendra as one word, thus altering the sense. The chief who is described was a San on the Lord of mountains, viz., the great eminence of the Kadamba fainily.-Ed. 130, 1. 40, for XIV read XVI. 150, coll. 6-7 for Sochana read Sobhana. 189, , 29, for name read name. 191, f. n. 3, for the letter after a (?) read after 78. , , ,, 12, insert length after yo. , 193, 1. 22, for Toramana read Toramana. 194, para. 5, 1.4, for Karnata read Karnata. 196, 2, ,, 13, for Siddhaladovi read Siddaladevi. > 2 , 3, ,, 2, for Karttiga read Karttika. >> 1, 2, for Hastinavati- read Hastinavati.. 3,,, 1, for Durga-Bhatta road Darga-Bhatta. . f. n. 4, for zu read"
Page #15
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA, [Vol. XVII. Page 198, text 1. 12, for 77. read #TA:. >> 200, f. r 8 for 19: read ; for see above, note 1 read see ahove, note 7. , 203, trans. of v. 9. for Udaiya- read Udaya, 204. 1. 8, for kere read kere. , 1.21, lelete who received. 291, 4th line from the bottom, insert the word "after" after " and " in brackats. >> 292, 1.5, for kkoliya read kkoliiya. ,, 293, 1. 27, omit o of Kalabhran. , f. . 4, last line, for Sadaiyan read Sadaiyap. , 294, 1. 35, insert after orator : " thus making it clear that Mangalaraja Madhuratara is identical with Madavikalap Marangari mentioned in the previous paragraph ". 1. 38, insert after certain : "Suttakesari-pPerumpanaikkaran. The document was Bigned by"; and after Perumbanaikkaran "who seems to be identical with the engraver Suttakesari-pPerumtanaikkaran" 295, 1. 10, for Kadungon read Kadungon. ... 1. 22, for Maduratara read Madhuratara. >> >> 1. 27, for grove read drove. , f. n., for Epigraphia Indica read 8. I. 1., Vol. III, Pt. IV. 296, 1. 2, for inscriptions read inscription. , 297, 1. 29, for Malava read Malava. , J. 33, for Kurumadai read Kurumadai. , f. n. 3, for O-Valanadu read -valanadu. , 308, 1. 15, insert" (?)" after Kurumbupada. . . 1. 36, for Kulandevan read Ki!andaivan. , 309, 1. 6, for race read people and omit ottavar of Karavandapurattavar. .. , trans, of v. 19, remove the brackets of (learned) and use roman typu. , trans. of I. 152, for O-pPerum banaikkaran read -pPerambanaikkaran. f. n. 1, for Pandya read Pandya. ,,311, 1. 11, omit made through an ambassador, , 1. 17, for Rajagriha read Rajagriba. para. 2, 4th line from end, for Kalasan read Kalasan. 312, 1. 11, from end, for Prambanam read Prambanan. , 313, 1. 6, for extending read governing. 1. 6, from bottom, for a dutaka or ambassador read dutas or ambaseadors, , f. n. 5, for Sailendras read Sailendras. , 314, 1, 7, for Kalasan read Kalasan. , 315, 1. 14, for Kundinga read Kundinga. , 317, 1, 25, insert -Laya after Pilipinka. 317, f. n. 6, after document.' at the end, add " That Nagara by itself was nged 98 a syuonym bf Kusumapara or Pataliputra is evidenced by the Dhartavitacumudda of Isvaradatta (pp. 8 f.) published in the Chaturbhapi in 1922 by Mr. M. Ramakrishna Kavi, M.A., Teacher's College, Rajahmundry.
Page #16
--------------------------------------------------------------------------
________________ ADDITIONS AND CORRECTIONS. Page 320, text I. 24, for reife read Oeyrarfeq. 321, f. n. 2, for uparik, read uparika. ;, 323, text l. 57, for at read the 's'; for one shonld expect : or the poet might have used Ms derivative of treating it as a stem like a from te; and for to read , 324, f. n. 1, for Sakti read Sakti (twice). , 325 1. 9, for-mahishy dhikrita read-mahishyadhikrita. 1. 13. for Brabmanottaras, road Brahmapottaras, 1 1. 14, for Chandalas read Chandalas. 329, 1. 18, for - Hiranyagarbha- read - Hiranyagarbiu. 1 28 beginniug, for gf read of. , 335, 1, 13, for Gaddadi- read Guddadi.
Page #17
--------------------------------------------------------------------------
Page #18
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA VOLUME XVII No. 1.-GUDIMALLAM PLATES OF THE BANA KING VIKRAMADITYA II. By Professor E. Hultzsco, PA.D.; HALLE (SAALE). These plates were found at Gudimallam in the Kalahasti Zamindarl, and were forwarded to Rao Bahadur H. Krishna Sastri by Mr. K. Raghaviah of Kalahasti. They have been acquired for the Government Central Museum, Madras. The copper-plates are fipe in number and have nine faces of writing, the outer side of the first plate being left blank. The plates are not raised into rims for the protection of the writing, which is, however, in good preservation. They measure 77' in length and 33" in breadth, and are strung on a copper ring, which measures about 2t" in diameter, and the two ends of which are fixed in a circular seal. The hole through which the ring is passed was enlarged after the inscription had been already engraved. This led to the total or partial destruction of some letters, a few of which were subsequently engraved a second time below the ring-hole. The seal bears, in relief, the figure of a bull couchant, facing the proper right, and above it what looks like a lamp-stand and a crescent. The weight of the plates with ring and seal is 133 tolas. The alphabet is old Grantha (11. 1-58) and old Tamil (1. 53 f.). In the Grantha portion the superscribed is not always distinguished from i, nor the subscribed form of pi from that of t. Final forms of m occur in lines 3, 7, 35, 48, 49, 53. In-dhrik (1. 30), chat (1. 37), and ovan (11. 26, 29, 47) the Virama is expressed by a small dash at the right of the final consonant. The Grantha portion consists of Sanskrit prose (11. 1, 14, 33, 37-47, 51-53) and of 22 verses in the Anushtabh and Arya metres. Both the language and the metre of some of the Argi verses are incorrect. In the footnotes on the text I have suggested a few possible emendations, but am unable to furnish a fully satisfactory text and translation of the eight opening verses, which are addressed to Siva. The remainder of the inscription is quite intelligible, but the wording of it is not always correct. The compounds -non-akhya (1. 23), -akhyanamaka (1. 35), and kidrig-vidha (1. 37) are tautological. In lines 37-39 the author violates the rules of composition by comparing words in the dative plural to nominatives singular; cf. Sahityadarpana, Translation, p. 301, j. In line 50 the neuter yuga is used as a masculine, and in line 53 the neuter likhitam forms the predicate of the feminine prajastih (1. 52). The record ends with a short postscript in the Tamil language. As regards orthography, au is expressed by o in = 80 (1. 10) and moli (1. 12). The group ksh is replaced throughout by tsh, dm by tm in patma (11. 4, 37), dh by th. in narathipa (1. 24), and perhape ddh by tth in lines 5, 10, 11. The lingual | is used in gala (1. 2). The
Page #19
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [VOL. XVII. rules of Sandhi are neglected in Nandivarmma iti (1. 19), nsiparat=bhuja- and pradat=graman(1. 34), chet (1. 37), and "bhyah (1l. 39, 42 (twice), 52). In-nipunash=shadguni (1. 30) and in four other cases (11. 38, 40, 41 (twice)) final Visarga is expressed both by its original form and by a sibilant. Consonants are doubled throughout after r, and before y and r in-maddhye (1.2), - viddhyud- (1. 3), -viddra(ddru)ma- (1. 3), -mattras= (1. 5), Ruddra (1. 9), Girittrena (1. 33), and pittre (1. 35), but not in traividya (1. 41), tsha(ksha)tra (1. 23), putrena (1. 32), veda-traya (1. 39), and vikrama (passim). The superscribed r of double consonants is often omitted through carelessness. After lengthy invocations of siva, which have already been noticed in the preceding remarks, the inscription introduces the demon king Bali (v. 9), who is stated to have been the son of Virochana, and to have granted the earth at a sacrifice to Krishna (i.e. to Vishnu in his incarnation as a dwarf). One of Bali's descendants was king Nandivarman (v. 10 f.). His son was Vijayaditya (v. 12), his son Malle-deva of the Bana race (v. 13), his son Jayameru (v. 14) alias Vikramaditya (v. 15), his son Vijayaditya (vv. 16, 20, and l. 44) alias Prabhumeru (vv. 17, 21), and his son Vikramaditya (v. 20 and 1. 44) or Vikramadityavarman (v. 18). According to verse 19 a king named Nandal (who may be meant for the Nandivarman of verse 10 f.) had granted to Brahmanas the village called Viprapitha. With the sanction of his father (v. 20 and 1. 45) Vijayaditya's son Vikramaditya granted protection (raksha), i.e. a confirmation of the former grant, to the Brahmanas of this village (1. 45), because he had obtained a boon from the god of the Parasura mesvara temple (1. 43). In verse 21 f. the donor, Prabhu. meru's son, requests future kings to protect his grant. Lines 50-53 record the names of the composer and of the writer of this eulogy (prasasti). A postscript in Tamil states that the revenue assessment (puram) of the village amounted to 500 kadi of paddy and 10 (kalanju of) gold (1. 53 f.). Before discussing the historical information which is supplied by this inscription, I may state that Viprapitha (v. 19 and 1. 45) is clearly a Sanskrit equivalent of Tiruvippirambedu, the ancient name of Gulimallam, where the temple of Parasuramesvara (1. 43) exists to the present day. When my late friend Venkayya wrote his learned article on five Bana inscriptions at Gudimallam, which was destined to remain his last contribution to the Epigraphia Indica (above, Vol. XI, pp. 222 ff.), no other genealogical inscription of the Bana dynasty was available but the Udayendiram plates published by Kielhorn (above, Vol. III, p. 74 ff.). From the new plates we now learn that the king Prabhumeru of the Udayendiram plates had also the name Vijayaditya, and that his father, who is called Banavidyadhara in the Udayendiram plates, had the two additional names Vikramaditya and Jayameru. These fresh facts may be used for locating in the genealogical tree a few Bana kings who are referred to in other inscriptions. A viragal which was published by Mr. Rice belongs to the reign of Vikramaditya-Jayameru alias Banavijya(dya)dhara, and mentions a military commander Prabhumeru who may be identified with his son and successor Vijayaditya-Prabhumora. Inscriptions both of Vikramaditya-Jayameru alias Banavidyadhara and of Vijayaditya-Prabhumeru exist also 1 An early Rashtrakuta king Nandarijn is supposed to be mentioned in the Maltai plates of Saka 631 (Ind. Ant., Vol. XVIII, p. 234); but the actual reading of the plate (1.9) seems to be an. In the Tiwarkhed plates of the same king (above, Vol. XI, p. 279) the reading is distinctly WTS. The genealogy, of this Nannaraja is the same as in the Multai plates of Saka 681, but the date of the Tiwarkhed plates is Saka 553, which would mean that Nannaraja reigned at least 78 years (!). . See Venkayya's remarks, above, Vol. XI, p. 222. . & Ind. Ant., Vol. X, p. 39, No. II, and Ep. Carn., Vol. x, Arinivaspar Talak, No. 6.
Page #20
--------------------------------------------------------------------------
________________ No. 1.] GUDIMALLAM PLATES OF THE BANA KING VIKRAMADITYA II. in the Punganur Zamindari of the North Arcot District. One of Venkayya's Gudimallam inscriptions contains a Saka date-820-which must be assigned to the reign of VijayadityaPrabhumeru, because it calls the Bana king Vijayaditya, to whose reign it belongs, the son of a queen of Banavidyadhara, i.e. of Vikramaditya-Jayameru. Another queen of Banavidyadhara, named Kundavvai, was the daughter of Pratipati-Araiyar, i.e. of the Ganga king Prithivipati I, who was a contemporary of the Rashtrakuta king Amoghavarsha I' and of the Pandya king Varaguna. Two further inscriptions of Vijayaditya (Prabhumeru) furnish the Saka dates 827 and 831.6 According to the Udayendiram plates, Prabhumeru's great-grandson, VikramadityaVijayabahu, was a friend of Krishna-Raja, who used to be identified with the Rashtrakuta king Krishna II (about A.D. 900). This identification cannot be upheld, because we have now for Prabhumeru Saka dates ranging about A.D. 900, but Vijayabahu's friend Krishna-Raja must have been the Rashtrakuta king Krishna III (about A.D. 950), of whom we know from other sources that he made and held extensive conquests in the South. The Ganga prince Prithivipati II Hastimalla, who received the title Banadhiraja from the Chola king Parantaka I,7 and whose inscriptions are dated in the 9th and 15th years of the same kings (i.e. A.D. 915 and 921), would thus have been a temporary usurper and a predecessor of Vikramaditya-Vijayabahu. He was the Chola king's candidate for the Bana throne, while the legitimate ruler Vijayabahu was the protege of the Rashtrakuta invader. To facilitate reference, I subjoin a tabular statement of the two Bana genealogies. Gudimallam plates. Nandivarman. Vijayaditya (I). Malla-deva. Vikramaditya (I) Jayameru. Vijayaditya (II) Prabhumeru. Vikramaditya (II) (heir-apparent). Udayendiram plates. Jaya-Nandivarman. Vijayaditya (I). Malla-deva. Banavidyadhara. Prabhumeru. Vikramaditya (II). Vijayaditya (III) Pagalvippavarganda. Vikramaditya (III) Vijayababu. REMARKS. Son-in-law of the Ganga Prithivipati I, who was an adversary of the Pandya Varaguna and of the Rashtrakuta Amoghavarsha I. Inscriptions dated in Saka 820, 827, 831. Friend of the Rashtrakuta Krishua III. 3 1 See above, Vol. XI, p. 285. Ibid., pp. 227 f. In his Annual Report for 1908-09, p. 18, Mr. R. Narasimhachar has suggested that the actual name of this chief may have been Dindika. South-Ind. Inscr., Vol. III, Nos. 47 and 48. See above, Vol. IX, p. 87. 6 Above, Vol. XI, p. 228, and Ep. Cars., Vol. X, Mulbagal Taluk, No. 229. Above, Vol. IV, p. 225, verse 5. 8 Ibid., p. 224, and South-Ind. Ineer, Vol. II, p. 389. A 2
Page #21
--------------------------------------------------------------------------
________________ 4 EPIGRAPHIA INDICA. TEXT.1 First Plate; Second Side. 1 Namas-Sivaya svasti Jayati sa sarvva-vyapi yat-krita-pa 2 riuaddha-kandhara-maddhye [] gala-bhushan-ahi-pratibimbam-iva su 3 ra-dahana-visham || [1] Jayati hutasana-viddyud-viddra (ddru)ma-samghata-ni4 bha-jata-bharah [*] yach-chhirasi mani-jata-[bh]a-rakta-sarit-patma(dma)-mal-e5 va [2] Jayati pranavapyattho3 lekha-mattras-sikha-sasi yasya [*] dri6 dha-nahana-khinna-vishadhara-van-anala-dagdha iva latshyah (kshyah) || [3] Second Plate; First Side. 7 Jayaty=abdhara-samkasa-kandharan-ch-ahi-kundalam [*] lalat-etsha (ksha)pam-Akasasa8 r[i]n-mala-dharam vapuh || [4] Jayati vrish-eso devo lalata-nayan-agni 9 niva(pa)tit-Anamgab [*] asura-par-ari(ri) Ruddro jagad-udaya-layamkaro bhimab [5] 10 Jayati sa-nad-attho-so sakti-dvaya-gun-akaro vibhu 11 s-Sambhuh [1] samvrita-mantr-artth-artthas-"sabd-adi-gunair-anupalabbyah | [6*] 12 Jayati jata-dhara-mo(man)lir-Mmandakini-parita-mah-makut-tah [] Si(G)13 ritanay-arppita-bhago guna rahitos vibhu [r]=vvyapih(pi) || [7*] Second Plate; Second Side. 14 Namas-Sivays svast(sti) ir [1] Jayati Kam-mga-dahan 15 mastaka-nyasta-mugdh-enduh [1] k-adi(di)-trip-antasy-es810 gupty-u16 tpatti-laya-hetub [] [8] Bali[r]-V vairochanoll-nama Dana [VOL. XVII. 17 v-endro maha-balah [*] pradat-sa gam-makha-vare Krishnay=ami18 ta-tajnse [1] (9) Tasy-Anvayi ama[d]bhatab prithivi(vt)pala-sa 19 ttamah [] Nandivarmm[a] itis khyatah prasamsita-maha-balah || [10] Third Plate; First Side. 20 Jayati1 sa Nandiva[r]mma narapati-mapi-makuta-li(li)dha-pada 21 yugah [] tena nirakrita-kalina samprati rajanvati(ti) prithi 22 vi[h] | [11] Tasya sanur-mmaha-viro vela-paryyanta-dipakah [*] Vi 23 jayaditya-nam-akhyo dharmma-tsha(ksha)trabhritam varah [12] Tasy-abhava 24 n-maha-bahur-Mmalla-devo narathi(dhi)pah [*] Bana-vamsasya tilaka 25 a-samasta-vasudh-adhipah [] [13] Tasya jajne maha-suro Ja From two sets of ink-impressions supplied by Rao Bahadur H. Krishna Sastri. 2 For the sake of the metre, a wond like bhoga- may have to be inserted after -aki-. Read perhaps pranavasy=arddho. Read perhaps da-rddho[or ritho P-F. W. T.]sau. For the sake of the metre, iakty-arddha- may have to be read. Read perhaps -arddhas. 7 For the sake of the metre, -purita- may have to be replaced by its synonym bhrita- [and perhaps makutich is for makutah. But the scansion seems too irregular in many places.-F. W. T.]. Read perhaps gunatva-rahito [or guna-gana, since gunatra is found only in gunas ?-F. W. T.]. The metre is wrong here. For the sake of the metre, yo may have to be inserted here. The second half of the o of no is very faintly seen. 1 The correct Sandhi 'earmm-eti is precluded by the metre. 1 Road Vijayati on account of the metre. 12 Cancel the Visarga. 15 Cancel the Visarga.
Page #22
--------------------------------------------------------------------------
________________ F. W. THOMAS SCALE THREE-FIFTHS WHITTINGHAM & GRIGGS, PHOTO-LITH. 6 14 18 26 28 30 2 b. k <, ndhss - n3dpyris- 122232425 1222222 lhohaahmS~%<>^##228, 211222222 hahahjukh@22) Jue ii b. hay28225 8 2 2 1 3 2 2 4 your ew: 2 182 10:432222228 2 6 21 22 Togo god ganz gz grozyzviz 16 211 b. < 320 B2 = 1 8 22 12 21 8 2 2 1 2972 78: 28212@
Page #23
--------------------------------------------------------------------------
________________ iv b. 12h4 21 23:17 13: 12:27 ? 3 4 @ 2:228 1396272 27572 702182704-1218 JUU PRIN3342174D J 8 2 2 2 exy 227602457. 42013222 44 46 15 27000282: 1257128 40 42 44 48 50 52 54 Va. 7 com 21 222 223 hen hyb Do z goin Pontspa 2122818815222 228) 329 28 27 28 2 37822 1823 2882122711 84 21au8 y 8 2 3, l->>7rk vinnnh:5832 12: 22725 rwl lkrt 2 0 1 1 21 v b. SCALE THREE-FIFTHS 40 42 46 48 50 52 54
Page #24
--------------------------------------------------------------------------
________________ No. 1.) GUDIMALLAM PLATES OF THE BANA KING VIKRAMADITYA II. Third Plate ; Second Side. 26 yameruh pratapavan [1*] samasta-ripu-chakranam=bhettachintya-pa27 rakramah || [14"] Samasta-dharanipala-kirit-arkita-sasanah [*] sa jiyat-shi(kshi)28 tipal-endro Vikramaditya-bhupatih | [15] Vikramaditya-bhapasya su29 [n]uh parama-viryyavan [1] dor-ddand-oddhrita-spisht-arir-IV vijayaditya30 nama-dhrikh || [16*] Panchamga-mantra-nipunahsh=-shadgune sakta-chinta31 kah [] nay-Opayukta-sachivah Prabhumeruremmaha-yasah || [17] 32 Tasya putrena mahata Vikramadityava[r]mmana [1] prasadita Fourth Plate; First Side. 33 Girittrina dhvasta-duhkhena dhimata [ll 18*] Api cha [ll] Nando nama maba-sa34 tvottvo) nlipa-rat="bhuja-vikramah [*] pradat="graman-dvij-ondranam Vi. 35 prapith-akhya-namakam" | [19] Tasya pradat=sa ratsha(ksha)n=ta pittre vijna36 (pya] sah? prabhuh [*] Vijayaditya-sunus =80& Vikramadityagaretah' [ll 20*] 37 Ki(kl)drig-vidhebhyd ratsha(ksha)n=dattavan=iti chet(d=) Brahm=cva patm(dm)-aspa38 dobhyo Narayana iva bhrita-sach-chakrebhyahs 10$iva iva sita-bhati39 priyabhya[h*] Kumara iva siv-ark-asrayabhyah(bhyo) veda-tray-adhya Fourth Plate; Second Side. 40 yana-makhara-mukhobhyahs=10gushthu-kpit-anushthana-Paramoshthi41 charitebhyahs 10traividya-vriddhobhyahs. 10samasta-sastra-pa42 ragobhyah (bhyo) brahmadey-anusantanobhyah(bhyo) dharmma-vi[a]bhyo 43 [v]ichchhinna-somapithebhyah [Il*] Parasuramesvara-bhattara44 ka-var-avapti-nimittad=Vijayaditya-sinu[r*).Vvikramaditya45 8-8va-pita[r*]=nniyogad=Viprapith-akhya-nivasinan-dvi46 j-ondranam samasta-[pa)rikara-samanvitam ratshi(ksha)n-datta Fifth Plate; First Side. 47 van | Sa[ro]vvams-tu prithivipalan=bhavinah pra[r*]tthaya48 ty-ayam [1] Prabhumeros-suta[ho] srIman-ari-marddanu-karmma-krita' [ll] [21] 49 Yo tu ratsha(ksha)m-imam=panti vipr-endreshu sama[r]ppitam [l] te50 [sh]am-pada-yuga minni(rdhni) tishthantu mama sa[r"]vvada || [22] Siva-bhatta51 raka-snnos-Sivatamasy=Eyam kritih [ll] Svasti go-bra52 hmanebhyah(bhyo) namah Iyameprasasti[h] Parahit-acha53 rina likhitam[h](ta) A[yu]nuruz18kkadi nellu[m] pat 1 Read-dript-arira. [Read T4 ?-F.W.T.) ? Cancel the Visarga. * Those two words are entered below the line, and the place at which they have to be inserted is narked by a cross or caret (kakapada); cf. Sir Aurel Stein's Translation of the Rajatarangini, IV, 117 and noto. * Read -tads. 5 Read pradada * Cancel the Visarga. The syllable sa is ontered below the line; read perhaps sat.prabhun. & Rend perhaps sunurayyo. Read perhaps itya-rifrutah. 1. Cancel the Visarga. 11 Read -krit. 11 After this wond the syllable la is written below the line. 13 Read annu.
Page #25
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. (VOL. XVII. Fifth Plate ; Second Side. parava (1) 54 tu popgum idin TRANSLATION. (Line 1.) Obeisance to Siva! Hail ! [Verses 1-7 are addressed to Siva.] (Line 14.) Obeisance to Siva! Hail! Prosperity ! [Verse 8 is again addressed to Siva.] (Verse 9.) (There was a powerful lord of demons (Danava), Bali by name, the son of Virochana. He presented at an excellent sacrifice the earth to Krishna of immeasurable lastre.1 (Verse 10.) In his lineage was born the best of kings, called Nandivarman, whose great power was praised. (Verse 11.) Victorious is that Nandivarman, whose pair of feet was kissed by the diadems, (set) with jewels, of princes. Through him, who drove away (the sins of) the Kali (age), the earth is now (!) provided with a just king. (Verse 12.) His son (was) a great hero, illuminating (the earth) as far as the coast of the ocean), called Vijayaditya by name, the best of just rulers. (Verse 13.) His (son) was the long-armed king Malla-dova, the ornament of the Bana race (and) the lord of the whole earth. (Verse 14.) To him was born the powerful great hero Jayameru, the breaker of the circle of all enemies, (and) whose valour was inconceivable. (Verse 15.) Let that king Vikramaditya be victorious, the lord of princes, whose orders were marked (i.e. bowed to) by the diadems of all rulers of the earth! (Verse 16.) King Vikramaditya had a very brave son, who bore the name Vijayaditya, (and) who uprooted prond enemies by (his) strong arm. (Verse 17.) The renowned Prabhumeru knew the spell of five members; his thoughts were occupied with the six measures of politics; (and) his ministers were employed with polity. (Verse 18.) By his great wise son Vikramadityavarman, who propitiated Giritra (Siva), (and) who removed distress, (this grant was made). (Line 33.) Moreover : (Vene 19.) The noble ruler of princes, Nanda by name, whose arms were powerful, (had) presented to chiefs of Brahmanas the village called Viprapitha by name. (Verse 20.) But Vijayaditya's son, that virtuous lord who was celebrated by the name of) Vikramaditya, granted & confirmation of the former grant) to this (village), after having submitted (this matter to his father. (Line 37.) If you ask) to what kind of people) he granted the confirmation :-to those who were abodes of prosperity (padma), as Brahmi dwells on a lotus flower (padma); who supported a circle (chakra) of virtuous men, as Nariyapa (Vishan) holds an excellent discus (chakra); who were beloved by bright welfare (bhet), as Bivs is fond of white ashes (bhuti); who resided near the temple of) Siva, as Kumara rests on Siva's lap; whose mouths resounded with the recital of the three Vedas; who practised in a suitable manner the conduct of 1 Cf. vorne 3 of the Udayendiram plates, above, Vol. III, p. 78. ? Vis, the five syllables namas-Sivaya," obeisance to Siva !" C. 11. 1, 14 (consisting) of five subdivisions'; see Monier Williams 1.7. anga.-H. K. S.) [Panchanga-mantra is counsel
Page #26
--------------------------------------------------------------------------
________________ No. 2.] TUMBAGI INSCRIPTION OF THE REIGN OF SATYASRAYA. Parameshthin (Brahma); who had advanced in the study of) the three Vodas'; who had mastered all sciences; who (possessed) & series of gifts to Brahmanas; who knew the sacred) law; (and) whose draughts of Soms were uninterrupted. (Line 43.) Because he had obtained a boon from the god Parasuramesvara, Vijayaditya's Bon Vikramaditya granted, at the direction of his father, the confirmation, accompanied by all exemptions (parihara), to the chiefs of Brahmanas residing in the village) called Viprapitha. (Verse 21.) But the destroyer of enemies, that glorious son of Prabhumeru, requests all future rulers of the earth : (Verse 22.) "Let there rest for ever on my head the pairs of feet of those (kings) who protect this confirmation granted to chiefs of Brahmanas !" (Line 50.) This is the oomposition of Sivatama, son of Siva-bhattaraka. Hail! To cows and Brahmanas obeisance! This enlogy (prasasti) was written by Parahit-achari. (Line 53.) The revenue assessment of this (village amounted to) five hundred kadi (of) paddy and ten-kalanju of) gold. No. 2.-TUMBAGI INSCRIPTION OF THE REIGN OF SATYASRAYA: SAKA 926. BY LIONEL D. BARNETT. Tumbagi, or, as the name was anciently spelt, Tumbige, is a village lying in lat. 16deg 34' and long. 76deg 20, in the Muddebiha! taluka of Bijapur District, and formerly was included in the Pagalatti Three-hundred. The name is given as " Toombgee" on the Indian Atlas sheet 57 and as "Tumbgi" on the Bombay Survey sheet 350. It contains a monastery known as "Polayya's Math," at the well of which there is (or was) & stone inscribed with the present record. A bad copy was made by Elliot's pandit, and appears in Vol. I, fol. 17a. of the Elliot Collection (Royal Asiatic Society's copy). I now edit the text from good ink-impressions prepared for the late Dr. Fleet, which are now in the British Museum. The stone is a long narrow block, with an upper compartment in front containing sculptures, viz. in the centre a liriga on a stand, with an upright figure of a votary facing it on the proper right of it, and still further to the right a cow with sucking calf. Underneath this is the inscribed area, which seems to include three faces of the slab. The first face, containing 11. 1-17, is about 1 ft. 1 in. wide and 3 ft. high; the second, containing ll. 18-40, is about 10 in. wide and 3 ft. 7 in. high; the third, containing ll. 41-end, is about 3 ft. 8} in. high and 6 in. wide, except at the bottom, where it runs out towards the right to a width of 104 in., enclosing the last two lines. The character is fair Kanarese, somewhat inclined to angularity, with letters varying from 1 in. to 1} in. in height. Its whole tendency is towards the later type, rather than the archaic. The cursive v is found only in the ligature ruva (11. 51, 58).--The language is Old Kanarese, except for the concluding Sanskrit verses. We may note the sporadic change of m to v in -achchhadanavarn (1. 32) and mahajanaruve (11. 43-4), and the conditionals ddade (1. 37) and appade (1. 45), which all shew a tendency towards the medieval dialect. The record opens (11. 1-8) by referring itself to the reign of Akalankacharita Ifivabedanga Satyasraya (Dynast. Kanar. Distr., p. 482), while his officer Setti Brahmayya was administering Tumbagi (11. 8-15), and registers gifts to local religious foundations by the latter and a lady named Aychakabbe, with rules for their management (11. 15 ff.). achari, an artisan,' is a Tamil form of acharya. * Puratu oscurs also in South-Ind. Inscr., VOL. II, p. 386, text line 99, and above, Vol. IV, p. 224, text line 19. For its meaning see the Madras Epigraphical Report for 1920, p. 96. * The same measure in mentioned in South-Ind. Inscr., Vol. I, pp. 117, 140. * A notice of the inscription has been given by Dr. Flpet above, Vol. XII, p. 306.
Page #27
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [VOL. XVII The date is specified on 11. 11-15 as Saka 926 (expired), Krodhi; Ashadha amavasyd; an eclipse of the sun. This is quite regular. The Southern cycle is used, and according to the Sarya-siddhanta (true system) the tithi quoted was connected with Thursday, 20 July, A.D. 1004, ending 3 h. 33 m. after mean sunrise (for Ujjain). On that day there was an eclipse of the sun at 3 h. 18 m. after sunrise by Lanka time. Mr. R. Sewell, who has kindly examined this date at my request, remarks that by the true system of the Arya-riddhanta the result is the same, but that by the mean system of the Arya-siddhanta the tithi was connected with the previous Wednesday, 19 July. The place-namos mentioned are: the Pagalatti Three-hundred (1. 10); the Tumbige Agrahara (1. 11); and Kalkere (11. 23-4). On Pagalatti I may refer to the remarks of Dr. Fleet above, Vol. XII, p. 306 ff., where he identifies it with the district Variously called Hagaritige, Hagarittage, or Hagaratage and connected with the village formerly designated Hagaritage, Hagalittage, or Hagarittage, and now known as Hagarattagi, Hagaritige, Hagarittige, or Hagarittigi, in the Shorapor taluka of Gulbarga District in the Nizam's Territories. Kalkere cannot be identified with certainty; there are several places of the name. TEXT. 1 Svasti samasta-bhuvan-dyra2 ya Sri-Pri(ppi)thvi-vallabha 3 maharajadhirija para4 mosvara paramabhattarakam 5 Batyasraya-kula-tilaka6 n-Akalamkacharitan-Irive7 bedamgam srimat Satya8 araya-devara pada-padm-o9 pajivi Setti Brahmayyam 10 Pagalatti 800rars bali11 ya Tumbige-agrahara 8812 khs-varishg 926neys Kro13 dhi-samvatsargd-Ashadadha)d-ami14 vasyeya[m]dave guryya-gra[ha]. 15 padandu Betti Brahmayyam Bra16 h[m]esva(sva)ra-devargge bitta ke. 17 y-matta 200 ads . . 18 pasekara-salle yargge kotta key=ma20tta 30 mata(tha)kke kotta ke21 y=matta 50 devalaya22 nimittam kotta ke23 y=matta 120 [1deg) Kalke24 roya Gennayyana 25 magal-Ayohakabbeta26 mma manyad=olage max 27 ta(the)kke kotta key=matta 28 50 antu mata(tha)kke ma29 tta 100 [1] Inn-alliya pha 30 ladalt brahmacharyya From the ink-impressions. * Read Baka-canela.
Page #28
--------------------------------------------------------------------------
________________ No. 2.] TUMBAGI INSCRIPTION OF THE REIGN OF SATYASRAYA. 31 m-ulla tapasviya 5 32 rggel asan-achchhadanavam 33 nadeyisuvar-alli 34 y orvvar-pradhanar-appa35 vargge uttamagra [m] na. 36 deyisuva[r] brahmacha 37 ryy-adi-lopam-adade 38 pora-vadisuvar=[u] 39 ttamar-appar-amt-appa 40 r1 sthitiyol-1 dharmmamam 41 pratipalisuva 42 r-ur-odeyarum 43 mahajanavu 44 v-idan-upakshi 45 sidar-appade gu 46 pa-dosham-ava 47 [ra]n-erugum || 48 ur-odeyara 49 l-akke mahaja 50 nadol-akke - 51 van-orvvan-I sthi 52 tiyol-allade 53 perat-ondu sthi 54 tiyo kidi 55 suv-avam svana 56 g (ga)rdabha-chandalam 57 same(ma)ya-bahiram [*] 58 Sarvvatha palaniya 59 m tta(tu) tad-desas-tais-tu 60 bhimipai[h] [*] ya 61 sya yasya ya 62 da bhami[s"]-tasya 63 tasya tada phalam [1] [1] 64 Sva-dattam para-da 65 [t]ta[m v]a yo ha 66 reta vasumdhar[am] [*] 67 shashthim varisha-sa 68 hasrani vishtha 69 [7]am jayate krimih [* 2* 70 [Malmgala maha-sri || 9 TRANSLATION. (Lines 1-9) Betti Brahmayya, who finds sustenance at the lotus-feet of-hail !-the refuge of the whole world, darling of Fortune and Earth, great Emperor, supreme Lord supreme Master, ornament of Satyaaraya's race, Akalankacharita Irivabedanga Satyasrayadeva : (Lines 10-23) (While governing) the Agrahara of Tumbige, forming part of the Pagalatti Three-hundred, during the last lunar day of Ashadha in the cyclic year Krodhi, 1 Read 5 tapasviyargge. Read shashfir=varsha-,
Page #29
--------------------------------------------------------------------------
________________ 10 EPIGRAPHIA INDICA. (VOL. XVII. the 926th year) of the Saka era, during an eclipse of the sun, Setti Brahmayya granted for the god Brahmesvara a field, 200 mattar; ... for the drummers and public women he granted a field, 30 mattar; for the monastery he granted a field, 50 mattar; for the benefit of the temple he granted a field, 120 mattar. (Lines 23-29) Aychakabbe, daughter of Gennayya of Kalkere, granted for the monastery out of her own honorary estate a field, 50 mattar. Thus (there are) for the monastery 100 mattar. (Lines 29-47) Likewise out of the revenues of this land they shall provide food and clothing for the 5 ascetics living in celibacy. In the case of any superiors of this place, if there should be committed a breach of celibacy or the like in conducting the highest offices, they shall expel (them). The leading men shall be such. They shall preserve this pious foundation, under this constitution. If the mayors of the town and the burgesses should have neglected it, guilt shall accrue to them. Any person, whether of the mayors of the town or of the burgesses, who should violate this constitution or any other constitution, (will become) a dog, an ass, or a Chandala, an outcast from society. (Verses 1 and 2: Sanskrit formule.) (Line 70) Happiness! great fortune ! No. 3.-A NAGA FIGURE IN THE MATHURA MUSEUM. BY Y. R. Gupte, B.A. On page 18 of the Annual Progress Report of the Archeological Survey of India, Northern Circle, for the year 1908-1909 an inscribed pedestal from Ral (No. 45) is mentioned. The upper part of the image must have been found since I examined the sculpture at Mathura. It represents a Naga standing between two Nagis. The height of the sculpture is 4' 2". The inscription measures about 2 ft. in breadth and 7 in. in height. The imago came from a mound near the village of Bhadal about six miles from Mathura. From local enquiries it appeared that people from the neighbouring villages used to visit the epot and vows were made to the deities by barren women. When they got sons, they resorted to the place for tonsuring their hair. The Naga in the centre has & canopy of seven hoods with forked tongues, as is usually the case with the other Naga images of Mathura, and is similarly dressed. The threefold triangular necklace is a little damaged on the breast. We can see the bracelet on the right wrist, and a similar one on the left is hidden by the upper garment. The position of the hands is similar to that of the Naga figure from Mathura city of the Kushans year 52 (A. S. R. for 1908-9 Plate LIV). The left hand holds a small vessel ; and a lotus bud is visible in the right. The Nagis are dressed in garments of the same stuff as the Naga and have the same appartenances in their hands. Beneath the feet of the deities were short inscriptions, now much defaced, which probably contained their names. The vestiges that remain favour this view. On the pedestal are five males and five females and also two boys with folded hands. They are worshippers. The right hand of the man to the extreme proper right is gone. The male to the left and the female to the extreme proper left have their hands folded, the others holding lotus stalks in their right hands. On the lower part of the pedestal is an interesting inscription [ Odamagram means 'samptaous meal '; see South Indian Inscriptions, Vol. IIT, Part III, p. 256, footnote 1. (The meaning is : One of the superior members of these will be provided with sumtuous meal'.-H, K. 9.]
Page #30
--------------------------------------------------------------------------
________________ From a photograph kindly supplied by Mr. H. Hargreaves SCALE ONE-SIXTH
Page #31
--------------------------------------------------------------------------
________________ Mathura Naga Image inscription: the year 8 of Kanishka. SEE BEA110suko-su WHITTINGHAM & GRIGGS, COLL F. W. THOMAS SCALE ONE-HALF
Page #32
--------------------------------------------------------------------------
________________ No. 3.) A NAGA FIGURE IN THE MATHURA MUSEUM. 11 of three lines, of which the second and third are much damaged, making the decipherment of a part of the third line impossible. Several images of Naga deities, both inscribed and without inscriptions, have been found in Mathura. Of these the following are dated : Image of Dadhikarpa, of Samvat 26 va 3 di 5 (Ind. Ant., Vol. XXXIII, p. 102, and Ep. Ind., Vol. I, pp. 380 f. and 390, No. XVIII, and Dr. Vogel's paper in the Arch. Survey Roport for 1908-9, pp. 159. ff.). Naga image of the year 40 of Huvishka, in the second month of winter, the 23rd day (Dr. Vogel's catalogue of the Arch. Museum at Mathura, No. 13, pp. 88-9; 4. S. R. for 1908-9. p. 161). Naga image of an 52 va 3 di 25 (Dr. Vogel's catalogue of the Arch. Museum at Mathura, p. 91), Arch. Survey Report for 1908-9, p. 161. Besides, there is a fragment which Dr. Vogel assigned to the 3rd century of the Christian era (Dr. Vogel's catalogue of the Arch. Museum at Mathura, p. 90; 4. S. R. for 1908-9. p. 162). The image described in this note dates from the year 8 of the Kushana era and is the earliest dated Naga one at Mathura. The palaeography does not call for many remarks. The general characteristics are dealt with in Dr. Buhler's Indian Palaeography, edited by Dr. J. F. Fleet, p. 41. The peculiar. ities observable in the present inscription are these :-(1) The kha is triangular below, but its hook is large ; (2) the upper horizontal stroke of ra is turned into a curve, while the lower is split up into lines ; (3) ta in the 3rd line shows a loop ; (4) the lower part of da is more slanting than in all examples given by Dr. Buhler ; (5) va is rounded on the left ; (6) the left limb of sa is never turned into a loop. TEXT. L. 1 Maharajasya rj-[&]tirajasya (Shahi] Kanikkhasya Sal 8 gri 4 di 5 L. 2 a[y] p[arvv]ay[]m bhagavatah [Bhumi-niga]sya (1) pukshirini ar[a]mo cha prasti]. L. 3 (shthapito ... patras[y]a. turasya niya(mada]kisya (sarvva]sat[v]a hi(hita)-40 (sukhartham) (2) ...... REMARKS. (1) There can be little doubt about the reading Sudmi-ndyasya. I have examined the stone in all lights and shades. (2) Hi and su at the end of the third line stand for hita-sukhartham. This abbreviation is due to want of space. TRANSLATION. In the year 8 of the great king, the king of kings the Shahi Kanikkha in the fourth (month of summer, on the 5th day on that (date specified as) above, a tank and a garden of the holy Bhimi naga was founded ......... otura, son of ..... for the welfare and happiness of all sentient beings. The Prikritized form Kanikkha deserves notice. The form with the long d in the first syllable has already been observed in two inscriptions, namely those on the statue of Kanishka 1 From the original. * It appears that the engraver first cat eya, bat afterwards found out his mistake and dooply ongraved only a.
Page #33
--------------------------------------------------------------------------
________________ 12 EPIGRAPHIA INDICA. (VOL.XVII. himself and the Bodhisattva statue of the Kushana year 3, in the Sarnath Museum. Bhominaga is first met with in this record, No. 4.-A VAKATAKA INSCRIPTION FROM GANJ. BY V S. SUKTHANKAR, PH.D. This inscription, which is now brought to notice for the first time, was discovered by my friend Baba Rakhaldas Banerji, Superintendent, Archeological Survey of India, Western Circle, in 1919, during one of his tours of inspection in Central India. The excellent estampages from which the accompanying blocks have been prepared were made under his direct supervision, and very kindly placed by him at my disposal for publication, The inscription, Mr. Banerji tells me, is engraved on a detached slab of stone which he found lying at the bottom of a doriga, adjoining a hill called Maluha-tongi near Ganj in the Ajayagadh (Ajaigarh) State in Bundelkhand. Close by is a ruined stone structure, probably dam to hold the waters of the stream passing along the doriga. The find-place of the record is not far removed from the ruined city of Kuthara, where Cunningham discovered in 1883-84 the N&chand-ki-talat inscription, which was first brought to notice by him, in 1885, in Archoalogical Survey of India, Vol. XXI, pp. 97 f., and re-edited by Fleet in Gupta Inscriptions, pp. 233 ff. and Pl. xxxi B. The Ganj inscription, like the one discovered by Cunningham, is one of the oldest records of the V&kitaka dynasty, and as such is worthy of being carefully preserved. From the subjoined transcript it will be seen that the text of our inscription is practically identical with that of the Nachane-ki-talai record of the reign of Maharaja Prithivishona, edited by Fleet in Gupta Inscriptions; it differs from the latter only in the length and the number of lines, and in the spelling of a couple of words. But our inscription is in a much better state of preservation than that edited by Fleet; at all events the stone has yielded an impression far superior to the one from which the block accompanying Fleet's article was prepared. Conse, quently we can study the forms of the letters in the subjoined facsimile much better than in that of the Nacbane-ki-talai version. Moreover, the writing of this inscription being perfectly distinct, we can give & transcript which is more reliable, and which at the same time discloses oertain minor inaccuracies in Fleet's transcript, errors which even then could bave been avoided by & more patient study of the available material. The writing covers a space about 25" broad by 12" high. In the centre of the first line of the inscription there is a sculpture of a wheel, of which only a part is visible in the facsimile. The average size of such letters as m, p and is about 2".-The characters belong to the southern' variety of alphabets, of which the distinguishing features, in our inscription, are the hooks at the lower ends of the verticals of k and r. In particular, we may say that the letter, are a specimen of the Central Indian alphabet of the period, which on account of the peculiar 'box-headed' tops of the letters is known as the "box-headed' sub-variety of the southern alphabet. In our specimen the boxes are very conspicuous, and uniformly hollow. The letters are unequal in size and unconth in appearance. It may be added that they betray & conscious effort to substitute angles for curves in the configuration of letters. The letters t and are sharply distinguished from each other : the latter has always a knot at its lower end. The language is Sanskrit, and the inscription is in proge.-Ag regards the orthography tho only point calling for remark is the phonetic doubling of the d of dh, in od-a(h)nuddhyatoo (1.2). before y, and of the t of th, before r, in punyd-rttha (1. 3). Sve Buhler, Indische Palaographie, p. 62,
Page #34
--------------------------------------------------------------------------
________________ 1. A Vakataka Inscription from Ganj. 18into 2. Mandagappattu Inscription of Vichitrachitta. rumi ri ganno and yo82180 38 WHITTINGHAM & GRIGOS, PHOTO-LITH. F. W. THOMAS SCALE ONE-FIFTH
Page #35
--------------------------------------------------------------------------
Page #36
--------------------------------------------------------------------------
________________ No. 4.] A VAKATAKA INSCRIPTION FROM GANJ. The inscription, which is a record of the reign of Maharaja Prithivishona [I.) of the Vakataka family, states merely that a feudatory of his, Vyaghradeva by Dame, had made some. thing or other for the sake of the religious merit of his parents. The exact nature of this act of piety has been left unspecified, just as in the other version discovered by Cunningham. The silence of these records on the point leads us to infer that the slabs on which the inscriptions are inscribed must have been built into that the making of which they were intended to record. Our information regarding the Vkataka dynasty is unfortunately very scrappy. All the important events in its history known to us have been succinctly summarized by Kielhorn in his article on the Balaghat plates of Prithivishena II. ; we can even now add nothing of con. sequence to what has been said there. We do not possess exact dates for any of the kings of this family, nor can we form any clear idea of the extent of the country ruled over by them. Regarding Prithivishena I. we know that he was the son of Rudrasena I. and the great-grandson of Pravarasena I., the latter being either the very first king or one of the early kings of this house. It should seem that the Vakataka king at whose hands the lord of Kuntala' had suffered defeat, as recorded in the Vakataka stone inscription at Ajanta, was this same Prithivishepa. Beyond these few facts we know nothing of much consequence regarding the king referred to in our record. About Vyaghradeva, the feudatory of Prithivishena, we know still less. Indeed, Vyaghra appears as the name of chieftains in several well-known inscriptions ; : but it is not possible to identify our Vyaghradeva with any of them. Buhlert assigns the copper-plates of the Vakataka Pravarasona II., the grandson of Prithi, vishena I., to the fifth or sixth century A.D.; it is not known to me on what grounds. I have examined the inscriptions of the Vakataka dynasty and compared them with the allied inscrip tions engraved during the time of the Guptas, of the kings of Sarabhapura, of Trvara, of Kosala and of the early Kadamba kings, without being able to arrive at any definite conclusion regarding the age of the Vakataka inscriptions. Buhler's date, however, appears to me to be far too early. My impression is that thpre can be no objection, on palaeographic grounds, to assigning this record of the Vakatakas to as late an epoch as the seventh century A.D. I conclude this short notice by drawing attention here to the remark of Kielhorn that the Balaghat plate of Prithivishopa II., who was the son of the great-grandson of the Prithivishena of our inscription, "may be assigned with probability to about the second half of the eighth century A.D." TEXT.10 1 llVikatakan maharaja-sri 19. 2 Prithivishana-pad-a(m)nuddhyats Vyaghrade, 3 vo matapitro[b] Spuny-artthe 14kpitem=iti [ll] Abovo, Vol. IX, pp. 268 f. Arch. Surt. Weat. Ind., Vol. IV, p. 124, verse & Kielhorn's List of Insoriptions of Northern India, Nos. 270, 387 and 600. Indische Palaeographie, PP. 62 f. Corpw Inscriptionum Indicarun, Vol. I, No. 2-8. Gupta Inscriptions, Nos. 40-41. Ibid., No. 81. Ind. Ant., Vol. VII, PP. 35-7. Above, Vol. IX, p. 270. 10 From a set of estampages prepared and kindly lent to me by Mr. R. D. Banerji. 11 Read Vakafakanan. Fleet in bis transcript has wrongly spelt this word with the dental # in Gupta Inscriptions, Nor. 53-54. >> Read fry. 18 Read puny artthi. Here also Fleet hoe wrongly transcribed the worl, both as regards tho dental # and the case-ending. In Cunningham's version the word 18 spelt exactly as here. 1 The construction is faulty. The verb should be in the active voice.
Page #37
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [VOL. XVII. TRANSLATION Vy ghradeva, who meditates on the feet of the Maharaja the illustrious Prithivishona, (of the family) of the Vakatakas, has made (this) for the sake of the religious merit of (his) parente. No. 5.-MANDAGAPPATTU INSCRIPTION OF VICHITRA-CHITTA. BY T. A. GOPINATHA RAO, M.A., TRIVANDRAM. The small village of Mandagappatta is situated in the Villupuram Taluka of the South Arcot District and is about five miles south-west of Peranai, a station on the main line of the South Indian Railway. In a small hill near Mandagappattu is cut out a shrine, on the facade of which is engraved the inscription which is edited below. The shrine has at its back end three niches, which are dedicated to the gods Brahma, favara and Vishnu respectively. On the panels on either side of this shrine is carved a deara-palaka; the figure on the right very much resembles those which are found in the rock-cut shrines attributable to the Pallava king Mahondravarman I. From this and other considerations based upon its architectural peculiarities Mons. G. Jouveau-Dubreuil has attributed its excavation to Mahendravarman I. A photograph of the front view of this rock-cut shrine is given by him in his Pallava Antiquities, Vol. I, Pl. XXVIII. The cave was visited by the staff of the office of the Madras Epigraphist, and the inscription was copied in 1905. Regarding this cave Mr. Venkayya wrote in his Annual Report on Epigraphy for that year thus :-"The cave at Dalavantir in the Tindivanam Taluka consists of a shrine and a mandapa in front of it, thus resembling to a certain extent the upper cave at Trichinopoly, while that at Mandagappattu (mentioned in Mr. Sewell's List of Antiquities, Vol. I, p. 209) is a smaller one, which looks as if it had been left unfinished....... There is only one inscription in the Mandagappattu cave, which is so much damaged that the name of the king cannot be made out. To judge from what remains of it, we may say that it must also belong to the Pallava period. And, as we know that it was Mahendravarman I of that dynasty that excavated almost all the hitherto known monolithic caves in the Tamil country, we may not be altogether wrong, if we suppose that the one at Mandagappattu also came into existence during his reign." Depending upon probability, Mr. Venkayya hazarded a guess which has now turned out to be quite correct. It is true that the shrine was excavated during the reign of Mahendravarman I; but no serious attempts were made by the Madras Government Epigraphists at deciphering this epigraph. The credit of having made out the name of the king belongs to the French Professor, Mons G. Jouveau-Dubreuil, of Pondicherry. He has visited Mandagappattu more than once to obtain eye-copies and mechanical impressions, and also to acquire any further knowledge by studying the inscription directly from the stone. His zeal and perseverance have been richly rewarded by his discovery of the name of the king in whose reign the shrine was excavated. At this stage he sent me the impression of the inscription and his eye-copy, so that I might complete the reading of the document, translate and annotate it. When my notes, translation, etc., went to him, it had become impossible for him to edit the inscription himself; for he had to proceed to Cocbin China on military duty. He therefore sent me a good photograph of a very carefully prepared eye-copy and asked me to edit the epigraph as early as possible. From the mechanical impression kindly lent to me by Mons. Jouveau-Dubreuil and the photograph of the eye-copy prepared jointly by me and that gentle man I edit this important inscription below. The record consists of four lines of writing in Grantha characters of the first half of the 7th centnry A.D., and is a Sanskrit verse in the Giti metre. As has been remarked by Messrs. Venkayya and Jouveau-Dubreuil, the inscription is somewhat badly damaged, and it is only with difficulty that one can read it successfully; but one need not on this score imagine that the
Page #38
--------------------------------------------------------------------------
________________ No. 5.) MANDAGAPPATTU INSCRIPTION OF VICHITRA-CHITTA. reading is fanciful. The inscription states that the shrine was caused to be made by the king Vichitra-ohitta for the accommodation of the three deities Brahma, Isvara and Vishnu, without using in its construction bricks, timber, metal or mortar. This short record is of importance in more ways than one. The most important information conveyed by it is that before the time of Vichitra-chitta bricks, timber, metal and mortar were the common temple building materials. Evidently the basement and walls of the buildings were of brick work, plastered with chunam, and the superstructures were composed of wood work held in position by the use of metallic nails and bands. This, in fact, is even to this day the mode of construction of temples on the Malabar Coast. It is difficult to find a single temple in Southern India which belongs to a date prior to the 7th century of the Christian Era. One would naturally be inclined, therefore, to surmise that temple building was never in vogue before that century. But immediately after this period we see a number of temples which have sprung into existence, and this also seems to lend weight to the surmise that no temples were built before the time of Mabondravarman I in Southern India. The statement made in this inscription that Mahendravarman did not employ bricks, timber, metals and mortar clearly warrants us in drawing the conclusion that the temples built before his time were all of such easily perishable materials as bricks, etc., that they were all ruined in course of time, and that this is the first rock-cut shrine of his. This is clear from the special mention of anishtaka, etc., in the case of this shrine. It is impossible for a number of temples to have come suddenly into existence from the beginning of the 7th century, unless the building of temples had been practised long before. We know from the inscriptions of the cave temple at Pallavaram that Vichitra-chitta was one of the birudas of Mahendravarman I (see Pl. XXI in the Pallava Antiquities of Mons. G. Jouveau-Dubreuil, wherein the name Vichitra-chitta is clearly legible; vide also for the biruda Vichitra-chitta, p. 74, para. 14, of Ep. An. Rep. for 1909). It is, therefore, patent that the shrine was caused to be excavated by Mahondravarman I. Again, the biruda Vichitra-chitta means the curious or inventive-minded one. One can easily concede to the king Mahendravarman the title 'inventive-minded,' in so far as he avoided bricks, etc., commonly used by all in the construction of their buildings, and devised quite a new path, namely the cutting out of rock-temples, which needed neither bricks, timber nor mortar. His country extended far north of the river Krishna, where he must necessarily have seen some of the earlier rook-cut temples and so have introduced into Southern India the new style of cut. ting temples in rock. That he was the first to introduce into Southern India the method of excavating temples in the solid rock is certain; for we do not find even a single rock-cut shrine which belongs to a time before the reign of Mahendravarman. We know of no less than fifty rock-cut shrines in Southern India, not one of which is earlier than the time of this Pallava king. In fact, the art of cutting temples out of rock was contemporaneous with the Pallava dynasty and disappeared after them.! The birudas of Mahendravarman are not mere boasts, each of them has a meaning which is based upon some act done by him. We have seen that the biruda Vichitra-chitta is assumed by him for his invention of a new method of raising temples. Similarly, the biruda Matta-vilasa is, in fact, indeed due to his having composed the pleasant little burlesque the Mattavilasa-prahasana, in which he ridicules an actual matta or madman, a drunken Kapalika and meat-esting Bauddha Bhikshu. Mention is made of this burlesque in his inscription found in Mamaudur; [See South Indian Images, Introduction, pp. 1 f.-H. K. S.) ? The following extracts from this work will show that it was the composition of Mabendravarman : WWWC-Hafer! Ta i wageutfenugreuta f afa #0 wewsamaparAkramazriyaH zrImahimAnupadAnavibhUtiparibhUtarAjarAjastha zrIsiMhavizu varmaNa: puca: zatrughaDurganirahaparaH parahitaparatantratayA mahAbhUtamadharmA mahArAja: zrImahendra vikramavA maam| The birndas Avani-bhajana, Guna-bhara, Matta-vilass and Satra-malla are also introduced ingeniously in the play; these, we know, are the birudas of Mabendravarman 1.
Page #39
--------------------------------------------------------------------------
________________ 16 EPIGRAPHIA INDICA. [Vol. XVII. the portion where it occurs is somewhat damaged, but the name of the work is tot broken; the passage runs thus : Mattavilasadi-padam-prahasan-ottaman ... and in the other fragments of the inscription we see that mention is made of poets like Vyasa and Valmiki, as also of talas, etc., of music. Thus then each biruda of Mahendravarman appears to have been bestowed on him or assumed by him for some ostensible reason. The biruda Sankirna-jati of this king is rather curious; it means of mixed caste.' Perhaps the parents of Mahendravarman were of different castes. The significance of the other birud as will become patent as further researches are made. It is interesting to note that at the time of Mahendravarman the three deities Brahma. Siva and Vishnu were enshrined together in the same temple in adjacent niches. Such a group consisting of Brahma, Vishau and Siva is called Hari-Hara-Pitamaha or Dattatreya. (See my Elements of Hindu Iconography, Vol. I, pp. 251-256, as also Pl. LXXII, fig. 1 of the same volume.) At Mahabalipuram also there exists a Trimarti cave; but, strangely enough, the cell which is supposed to have been dedicated to Brahma is occupied by a figure which has only one face. The figure of Brahma ought, according to the agamas, to be always shaped with four faces, and in practice also we find that three faces are always shown in sculpture, the fourth being supposed to be at the back of the figure. In spite of the fact that the figure in the Mabbalipuram rock-cut shrine has only one face Dr. Vogel in his Iconographic Notes on the Seven Pagodas, contributed to the Director-General of Archaeology's Annual Report for 1910-11, identifies the figure with Brahma (see page 58). Prof. Jouveau-Dubreuil has sent me a note containing his own explanation concerning this image for publication here, which I reproduce below. "The Trimarti cave at Mahabalipuram is formed of three cells; the one on the right contains an image of Vishnu, and the middle one an image of Siva. It is, therefore, but natural to suppose that the left cell contains an image of Brahma. I was the first author to remark (vide Archeologie du Sud de l'Inde, Vol. II, Pl. XVIII B) that the god in the left cell has only one head and so could not be identified with Brahma. I have thought fit to affirm that this unknown god is Subrahmanya, who is represented also on the ground-floor of the Dharmaraja Ratha (Archeologie du Sud de l'Inde, Vol. II, Pl. XVIII B). However, the problem why the trinity Subrahmanya, Siva and Vishnu is found in place of the usual trinity Brahma, Vishna and Siva has remained till now unsolved. I believe I shall be able to explain why Subrahmanya is substituted for Brahma in the group of the trinity at Mahabalipuram. Mr, T. A. Gopinatha Rao says in his Elements of Hindu Iconography, Vol. II, Part II, page 439, Brahma-sasta : This is the aspect of Subrahmanya in which he put down the pride of Brahma by exposing his ignorance of the Vodas. He should be represented with a single face and four arms; he should have only two eyes. In the back hands there should be the akshamala and the kamandalu, and the front hands should be held in the varada and abhaya poses. The colour of Brahma-sasta should be the red of the lotus flower.' If we note that the image of Subrahmanya in the Trimurti cave wears on its breast a double chaplet of rudraksha beads, and that at the entrance to the sanctuary there are two personages dressed as Sannyasins and having pointed beards, we shall conclude that the sculptors of Mahabalipuram have put Subrahmanya in the place of This fact was also discovered by Prof. Jouveau-Dubreuil : see his Palluns, p. 38. Sankirnajati is the name of a variety of musical time. Perhaps Mahendravarman I held this biruda u an inventor of this method of keepiug musical time.-H. K. S.] Behind the rock bearing the Trimurti shrine are executed the figures of a peacock, an elephant and a monkey carved in balf relief. We know that the peacnek is the characteristic vehicle (rahana) of Subrahmanya. The elophant is generally associated with the temple of Sasta, and is here perhaps intended to show that the image is that of Brahma-sista. (Temples of Traipurushoideva nre found dedicated to Sun, Sivs and Vishna. Why should not the Brahma-sasta figare represent the Sun -H. K. S.] * Dr. Vogel takes the objects in the back hands as a flower and a ring, neither of which is right. The hands carry unly a kumandals and an akshamala, as required by the agamas.
Page #40
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA-SIDDHANTA, MEAN SYSTEM. 17 Brahma because they have placed there Brahma-sasta, a deity superior to Brahma in his knowledge of the Vedas. I think fit to draw attention to the existence of the trinity consisting of Subrahmanya, Siva and Vishnu and also to explain it with the help of the above-mentioned excellent work of M. R. Ry. T. A. Gopinatha Rao."'! TEXT. 1 CaefaTETHE[0] 2 Tagv[fafayfa]ia [*] 3 facuffunrara[u] - 4 trayalfaruana [1*] TRANSLATION This brickless, timberless, metalless and mortarless temple, which is a mansion for (the Gods) Brahma, Isvara and Vishnu, was caused to be created by the king Vichitra-chitta. No. 6.-THE FIRST ARYA-SIDDHANTA. MEAN SYSTEM. (A continuation of the author's "Indian Ohronography."). BY ROBERT SEWELL, I.C.S. (RETIRED). 303. It has long been known that in earlier years the Panchang Brahmans in India framed their local almanacs on calculations made by the use of the mean, as opposed to the true or apparent, motions of the sun and moon. The change from the mean to the true systems of calculation was advocated by Sripathi (A.D. 1040), and the latter system may have been adopted in some places about that time; becoming more general from about A.D. 1100 onwards. India, however, is a very conservative country, and the late Dr. Fleet was of opinion that, the mean system may have been adhered to, in some tracts at least, till a far later date. 304. With this opinion in mind I have prepared the Tables which follow, so as to cover the period of nine centuries from Aryabhata's date, K.Y. 3600 (A.D. 499-500), to 4500 (A.D. 1399-1400). It would be well if all dates of inscriptions that have hitherto been set aside as irregular by epigraphists could be re-examined, seeing that the difference between the two systems of the Arya Siddhanta constantly leads to differences in the computed positions of the sun and moon on the same civil day, and consequently to differences in the almanac; let alone the differences caused by the use of different Siddhantas. Thus, to give an example. The civil day, Monday, 21 October A.D. 1090, was by the Arya Siddhanta true system described as "Monday, 25 Tula, nija Afyina kr. 10," wbile by the mean system it was "Monday, 27 Tula, Karttika kr. 10." Thuesday, 31 Oct., in the same year was by the true system "Thursday, 5 Vpischika, Karttika sukla 6," while by the mean system it was "Thursday, 7 Vriechika, Margasira sukla 5." 305. The present Tables are based on the First Arya Siddhanta as amended by Lalla. The principal Table LXXVI is framed on the lines of the Indian Calendar, Table I, so as to meet the convenience of epigraphists who have become accustomed to the use of that work. The numbers of the columns are made to correspond in both Tables. Results of calculation carried out by the present Tables will be found to correspond with those worked by use of Professor H. Jacobi's skeleton Tables published in Vol. XI above. There is no need for me to dwell on the great services he has rendered to the cause of Indian history and epigraphy. These are well known. All I have done is to follow in his footsteps, 1 This note in reproduced here exactly as it was sent by Mons. G. Jouveau-Dubrouil; no corrections bave been effected in it. [For Plato see the article on ' A Vakataka Inscription from Gadj. -F.W.T.)
Page #41
--------------------------------------------------------------------------
________________ 18 EPIGRAPHIA INDICA. [VOL. XVII. verify his figures to the best of my ability and apply the results to practical use. Any little differences that exist between us have been fully set forth and their cause explained. Elements. Arya Siddhanta, mean system. 306. (i) The length of the mean sidereal solar year is 365 6h 12m 30, or 3654, 2586805. (ii) For the sun's mean motion per day, hour, etc., see Tables XLIII, XLIV, above, Vol. XIV. (iii) The distance of mean moon from mean sun (our a), measured in 10,000ths of the circle, i.e. 10,000ths of the mean synodical revolution of the moon and excluding 12 whole revolutions, increases, during one sidereal solar year, from 0 to 3888-231484714. That is the advance of a in the year. Table LXIV A above, col. 3, shews this advance per day, and Table LXV the advance per hour, etc. (iv) The value of a in mean reckoning corresponds to that of t, the tithi-index, in true reckoning. It shews what mean tithi was current at the moment in question. In general calculation by the Tables this moment is the moment of mean sunrise at Lanka, taken as 6 A.M. (v) In reckoning by 10,000ths of the circle the advance of a in one mean solar month is 307 352623726. (vi) Each mean solar month consists of 304 10h 31 21. The collective duration from the moment of mean Mesha-samkranti (the beginning of the mean solar year when the mean sun is at celestial long. 0deg) to each separate samkranti, or the moment when the mean sun enters each of the signs, is given in Table LXXVII. (vii) The length of each mean lunar month is 29d 12h 44m 2.79 or 294-530587946, during which the mean moon's distance from mean sun increases, in our circle reckoning, from 0 to 10,000. The length of one mean tithi, or one-thirtieth of the mean lunar synodic month, is 23h 37m 2809, or 0d-984352931; during which, in circle reckoning, the increase of a is 333.3. (viii) The sodhya, or time-difference between the moments of arrival at celestial long. 0deg of the true and mean suns, which moments are known respectively as the true and mean Meshasamkrantis, is 2d 3h 32m 30s, true Mesha-sankranti being the earlier. The time of occurrence of mean Mesha-samkranti in every year is given in Table LXXVI, cols. 13 to 17. (ix) The samvatsara name of the solar year is the same by both true and mean reckonings, except in the years A.D. 564-5, 905-6, 990-1, 1246-7 and 1331-2, A special footnote is appended to the main Table LXXVI in each case. (x) There can be no suppression of a lunar month when calculation is made by the mean system; for the length of a mean solar month is greater than that of a mean lunar month, so that two mean solar samkrantis cannot take place within the limits of one mean lunar month. (xi) Let it be noted that no intercalation of a lunar month can take place unless, at mean sunrise of the day on which mean Mesha-samkranti took place, the value of a is more than 6280-4892, or unless at the moment of mean Mesha-samkranti the value of a is more than 6619-1211; the latter valne being 10,000-3380-8789, the total increase of a from Mosha- to Mina-sankranti, and the former being 6619-1211-338 6319, the latter value being the increase of a in 24-hours. The 19-year intercalation cycle. 307 (See Indian Calendar, SS 50, p. 29.) By the mean system the cycle-sequence is found to work with almost perfect regularity. After four successive intercalations at intervals of 19 years each the intercalated lunar month gives way to the month preceding it. But there are 1 The equations of sun and moon are not taken into account in mean reckoning.
Page #42
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ABYA SIDDHANTA, MEAN SYSTEM. 19 two exceptions in the nine centuries, embraced im Table LXXVI. Between A.D. 751 and 827 there in a man of five intercalary moan Pausha montha, anda between A.D. 1242 and 1318 there is & run of five interoplany mean Advina month In eleven instances the names of the mean intercalary months given in Table LXXVI differ from those stated in the Indian Calendars These differences are due to the former calculations having been based on Professor Jacobi's eartiest Tables pablished 30 years ago, while the present ones agree with the results of caloulation made by his more potent elementary fixtures: Each difference is specially notied at foot of Table LXXVI. The nakshatra. 308. In the mean system the position at any moment of the mean moon in the ecliptio circle, i.o the mean moon's nakshatra; is found by adding her mean distance from the mean sun to the latter's longitude ; that is to say, by adding to the value of the mean sun's longitude) the value of a at the same moment as fonnd by calonlation for the mean tithi.. All work by the Tables being in the first instance for the mean positions of sun and moon at mean sunrise of any day, Table LXXX provides the sun's mean long., ., in 10,000ths of the circle, for each period of 24-hours measured from the moment of mean Mosha sankranti, while Table LXXXI states the same inorense for fractions of the day. To obtain the value of e for mean sunrise of any day it is necessary to note fired its valde after the interval of days between the day of Masha. samkranti and the given day (Table LXXX), and, since that value is measured from the moment of Megha-sadikrinti and not from mean sunrise, afterwards to deduet from the value so obtained the increase daring that fraction of the day (Table LXXXI), The result is the required s, or the mean sun's long. at mean sunrise of the given day, Then staan, the nakshatra inder required, or the mean moon's place in the echiptio cirolorat mean sunrise of that day: The Rula for work, then, is as follows. Find the value of a (=t), the mean tithi-index at mean sunrise of the given day (Estample 2 below). Note the serial number of the day as measured from Jan. 1. Deduct from this the serial number of the day of mean Moha-sankranti (Table LXXVI, col. 18, in brackets). This gives the number of intervening days. Turn to Table LXXX and note the value of against that interval of days. Deduct from this the mean ean's movement given in Table LXXXI during the hours and miuutes stated in Table LXXVI, col. 17. The result is the required value of at mean sunrise of the given day. Add , to a.. This = n, the required nakshatra-index. Table LXVIII above, or Table VIIT, Indian Calendar, gives the name of the nakshatra The Tables. 309. Table LXXVI corresponds to Table I. Indian Calendar in formation and is to be used in the same way. Here the value of a is the valne of t. It gives the tithi-index direct without further calonlation, Table LXXVII shows the duration and colleetive duration of mean solar months, and the increase in the moon's phase, a, during each such month. Table LXXVIII givee the value of a at the beginning of each Kaliyaga centary. Table LXXIX corresponds, with a necessary shift of position, to Table LXXIV above, the nse of which is fully explained in my former papers, $$ 279, 301. 1 To find the valae of a, ort, i.e. the exact moon's phare, in 10,000ths of the circle, at any moment of any dey, note its valde at mean sonrise of the Brit civil day of the lani-solar yop, mgiven in Table LXXVI (col. 28), and add its value for intervening dayshours, etc. (Tablas LIV, LXV. under heading a).
Page #43
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA (VOL. XVII. Tables LXXVIII and LXXIX, with Table LXXIII above (under heading a), which gives the value of a at the beginning of each year of the Kaliyuga century, enable us to find the value of a at mean sunrise of the civil day Chaitra enkla 1 at the beginning of each lani-solar year. Tables LXXVIII and LXXIII yield the value of a at mean sunrise of the day on which mean Mesha-sankranti occurred; and Table LXXIX enables, by addition, the a for the interval of days between that day and the day Chaitra kakla 1 to be ascertained. [The same can be found by subtracting from the sum of the values obtained from Tables LXXVIII and LXXIII (col. a) the value for those intervening days given in Table LXIV above (see Example 1).] The use of Tables LXXX and LXXXI is explained above ($ 308). They correspond, mutatis mutandia, with Tables XLVIII A, XLIX above used in calculation for the sun's true longitude. 310. The century-Table LXXVIII requires some further explanation. Its object is to determine the mean moon's phase, a, at mean sunrise of the opening civil day of each Kaliyuga century, i.e. the day on which mean Megha-samkranti occurred at some time later on that day. Reference to Table LXXVI shews that this opening day occurred at the beginnings of centuries 36 and 37 K.Y. on a Sunday, and in centuries 38 to 45 on a Saturday. From Table I, Indian Calendar, by adding the sodhya interval (above, $ 306, viii) to the date and time there given for the moment of true Mesha-sama krinti, we find that in centuries 46 to 48 it fell on a Friday. In the mean system, therefore, centuries 37 and 45 were defective centuries, while the rest were common. Table LXXVIII corresponds to Table LXXII above, which concerns true solar years, and by the true system, i.e. calculation by the movements of true sun, the only defective century w& bentury 42. This accounts for the difference between the two Tables. It has been shewn above ($ 299, i) that the actual value of a at mean sunrise of Sunday, 21 March A.D. 499, on which day, 6 hours later, occurred the moment of mean Mesha-sankranti (mean sun at 0deg) at the beginning of Kaliyuga century 36, was, in notation in 10,000ths of the circle, 7715-352496330. The values of a for later century-beginnipgs are found by addition to this of the century increases of a, common and detective ng required. EXAMPLES Haample 1. To find the European day, week-day, and phase of mean moon, .e. the mean tithi-indez a (which = t, the index) at mean sunrise of the first civil day of the luni-solar year; that is to say, of the day called "Chaitra Sukla 1" of the year in question, [This example is given in order to enable any student to verify the entries in Table LXXVI, cols. 19-23, For ordinary date work the entries themselves afford all information.] The mean new moon which marks the astronomical beginning of any mean lunar year is the new moon at the end of the lunar month Phalguna of the previous year. The moment of its occurrence is always earlier than the moment in the current year of mean Mesha-samkrinti, the beginning of the mean solar year. The civil day next following the moment of the initial mean new moon of the year is called "Chaitra sukla 1," that tithi being current at mean sunrise of that civil day. Our tabular calculations being for mean sunrise, the value of a in Table LXXVI, col. 23, must always be between 0 and 333-3, the last being the limit of the tithi. To find its value for any year we must first calculate the value of a at mean sunrise on the day of occurrence of mean Mesha-sankranti from Tables LXXVIII and LXXIII (above) under heading a. This done there are two processes by which the mean sunrise value of a on the day Chaitra sukla 1 can be obtained. One is to use Table LXIV, which, by deducting from the a of mean Mesha-samkranti-day mean sunrise (already found) the next lower value of a in the Table as given for the first 30 days, yields at once the interval of days between Chaitra sukla 1 and
Page #44
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA-SIDDHANTA, MEAN SYSTEM. 21 Mesha-sankranti, the value of a at mean sunrise of the former, and the required week-day. The second process is, using Table LXXIX, to find such earlier day as by adding its a to the a of Mesha-samkrinti, already found, will yield a result between 0 and 3333. The Table then shews the interval of days between the two sunrises, and the week-day corresponding to Chuitra Bukla 1. A. Take for instance the year K.Y. 3725 expired, A.D. 624-25. Mean Mesha-samkrinti ocourred in that year (Table LXXVI, cols. 13-17) on Wed, 21 Mar., -serial day 81, from Jan, 1. We take the value of a at mean sunrise at the beginning of the Kaliyuga century and at the beginning of the expired year from Tables LXXVIII and LXXIII respectively. The result gives the value of a at mean sunrise of Mesha-samkranti day in the given year, - w-d. a. . (Table LXXVIII). K.Y. cent. 37. . . . (1) 6583.1816 (Table LXXIII above). K.Y. year 25 (8) 2047.6413 At mean sunrise on Wed. 21 Mar., the day of occurrence of mean Mesha-samkranti . . . . (4) 8630-8229 Process 1. (Table LXIV above). Next lower value of a in the first 30 days of the Table, i.e. that for 25 days .-(4) - 8465.7968 At mean sunrise of the day Chaitra sukla 1 . . (0) 165-0261 This Chaitra sukla 1 civil day was (81 - 25=) Day 56, or (Table IX, Indian Calendar, or LXIX above) Sat. 25 Feb. A.D. 624. Process 2. At mean sunrise on Wed. 21 Mar., the day of mean Mesha-sankranti (as above). . . . (4) 8630-8229 (Table LXXIX). The only value of a which yields result between 0 and 333-3 . . . . . +(3) +1534.2032 At mean sunrise of the day Chaitra sukla 1 . . (0) 165 0261 Table LXXIX shews that the interval of days was 25, and the result is in all respects the same as the former. B. Calcnlation for the mean sunrise value of a on the day of mean Mosha-samkranti, the first step shewn in the above, by use of Tables LXXVIII and LXXIII sometimes results in the day found being not the actual day on which Mesha-samkranti took place but the day next to it. This is inevitable, seeing that only one Table has to stand for the odd years of all centuries. In such case the necessary adjustment must be made for one day's difference. The entries in Table LXXVI, cols. 13 to 17, are conclusive as to the actual day. Take the year A.D. 625-26, K.Y. 3726 expired. In that year mean Mesha-samkranti occurred on Thurs. 21 Mar., serial day 80. w-d. (Table LXXVIII). K.Y. century 37 . . . (1) 6589.1816 (Table LXXIII). K.Y. year 26 . . . . (5) 59869072 At mean sunrise of Friday, 22 Mar.. 2570-0888 Deduct value for one day (Table LXIV). . . (1) -338-6819 At m. sunrise of Thurs. 21 Mar., the day of mean Mosha-samkranti . . . . . (5) 2231.4569
Page #45
--------------------------------------------------------------------------
________________ 22 EPIGRAPHIA INDICA. [Vol. XVII, For the a of Chaitra sukla 1 and its day and week-day, we use either of the two processen. Process 1. -d. At m. sunrise of m. M. S.-day, Thurs. 21 Mar.. . (5) 2231.4569 (Table LXIV obore). Next lower valne of a in the first 30 days of the Table, viz. for 6 days' interval. -(6) - 2031.7912 At mean sunrise of Fri. 15 Mar., being the day Chaitra enkla 1 . . . . . . . . (6) 199-6657 Or, Process 2. At m. sunrise of m. Mesha-sark. day (as above). Add (Table LXXIX for 6 days earlier) . . . . 10- d (5) + (1) a . 2231-4569 +7968 2066 Result (same as above) . . . . . . (6) 199-6657 Example 2. To find the mean tithi-index a for any day in the year, or any moment of any day. Table LXXVI, cols. 19-23, states the civil day, Chaitra Sukla 1, for each year, its serial number from Jan. 1, its week-day, and its tithi-index a at mean sunrise, Calculate, from Table III Indian Calendar or Table LXIII above, the interval of whole days to mean sunrise on the given day, and, if necessary, the fraction of day subsequent to that sunrise. Add the increment of a for whole days from Table LXIV, and for fractions of the day from Table LXV, to the a given in Table LXXVI. Whole numbers may always be used for whole days, the decimals being only resorted to for close cases and when the calculation includes a fraction of a day. E.K. Required the tithi-index at mean sunrise on Ashidha knkla 4 in the year corresponding to A.D. 625-26; and at 8h 20m 15' after m. sunrise on that day, dow-da a. Table LXXVI. Chait. Suk. 1, mean sunrise (74) (6) 199:6657 Tables LXIII A. LXIV. Interval to Ash. fak. 4 and increase of a . . . . . (91) (0) 815-5005 At mean sunrise on .sh. suk. 4 day . . . (165) (6) 10161662 Day 165 was (Table IX, Indian Calendar, or Table LXIX above) 14 June A.D. 625 (6)=Friday. a=1015 shews (Table VIII or LXVIII) that sukla 4 was current at mean Runrise of that day. For the specific hour mentionedAt mean sunrise on that day . . 1015-1662 (Table LXV) . . . . . . . Sh 1128773 20 4.7032 16 0-0588 At 8l 20m 15' after mean sunrise . . . . = 1132-8055 so un alue on meie .... Erample 3. To find (the tithi-index, or plan of mean moon) at each of the solar sankrintie in the year (the moments of the maan sun's entrance into the several signs), and to determine whether an intercalation of a lunar month took place during the year.
Page #46
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA-SIDDHANTA, MEAN SYSTEM. Table LXXVI, ools. 18, 14, 17, shows the day and time of occurrence of mean Meshasankranti (mean sun at long. 0deg) in each year, and Example 1 shews how to find the value of a at mean sunrise of that day. To that value must be added from Table LXV the increment of a during the interval from mean sunrise to moment of samkranti. The advance of a during each mean solar month, i.e. from each mean sankranti to the next. (Table LXXVII, col. 4) is 307-3526. The work may be carried out by use of whole numbers, except when a case is very close. This occurs when a waning moon is very near 10,000, or when a waxing moon is very near 0. Required the above details for the years noted in Examples 1, 2, viz. A.D. 624-5 and 625-6. In A.D. 624-25 mean Megha-Ramkrinti took place 14h 2- 30s after mean sunrise. In A.D. 625-26 it took place 20h 15m 0 after mean sunrise (Table LXXVI, cols. 13-17). A.D. 624-25. Value of a at m. sunrise on mean Mosha-bar kranti-day, as already found (Example 1) . . . (Table LXV). Increase of a in 14h . . . . Ditto 2m . . . . . Ditto 30 . . . . . a. 8630-8229 197.5858 0-4703 0-1176 Exact value of a at moment of mean Mesha-Bankranti. . 8828-9461 A.D. 625-26. Value of a at m. sunrise of mean Mesha-sam kranti-day as found. . . . . . (Table LXV). Increase of a in 20h . . . . . Ditto 15m . . 2231.4569 282-1932 3-5274 Exact value of a at moment of mean Menha-samkrinti. . 2517.1775 For the several wamkrantis in each year we work bere roughly with whole numbers only, Adding successively the increase of a in 1 solar month. . A.D. 624-25 A.D. 625-26 At Mesha-samkr. . . a=8829 . . . . . 2517 807 307 At Vrishabbe-emainder. . 9136 . . . . . 2824 307 307 At Vithana-samkr. . . 9443 307 . . . . . 3131 307 At Karka-samkr. . . . . . . . 9750 307 . 8438 307 At Sith ha-samkr. , . . 57 .. . . . . 8745 etc. eto In A.D. 624-25 it is seen that the mean moon was waning at the Karka-samkranti and Waxing at the Simha-samkrinti, proving an intercalation of a lunar month, which month (soe Table LXXVII, col. 1) was Srivas Actually a at Sitha-sankranti was 58 36.
Page #47
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [Vol. XVII. In A.D. 625-26 the small value of a at the moment of Mesha-sankranti shews that there could have been no intercalation in that year (see above, $ 306, xi). Example 4. To find the mean moon's nakshatra, or her place in the ecliptic circle at any moment. (See 308 above.) We have to find the value of s, the sun's mean long., at the given moment and the value at the same moment of a, the index of the mean tithi. . + a=n, the index of the nakshatra. I assume that, as usual, the values wanted are those at mean sunrise on the given day; for later moments they can easily be found, from Table LXV for a, and from Table LXXXI for e. The example here given will shew the process of work. Required the nakshatra at mean sunrise on the day referred to in Example 2, viz. Ashadha Sukla 4 in K.Y. 3726, which was proved to be 14 June A.D. 625, and on which day at mean sunrise the value of a was found to be 1015.1662. The day, measured from Jan. 1, was serial number 165. In that year mean Mesha-samkranti took place (Table LXXVI) on Day 80 at 20h 15m after mean sunrise. The interval of whole days between 20h 15m after mean sunring on the day of Mosha-samkranti and 20h 15 after mean sunrise on the given day is (165-80=) 85. . . 2327.1179 (Table LXXX). Interval of 85 days. Less (Table LXXXT) for 201 . . for 15m . . 228149 0-2852 23-1001 . . -23-1001 At mean sunrise on the day Ashadba buk. 4, Add a, as found for that mean sunrise . .s=2304-0178 * 1015-1662 At mean sunrise on that day (=14 June) . . on=3319-1840 Table VIII Indian Calendar, or Table LXVIII above, shews that the moon was then in the nakshatra Aslesha by the equal-space system and by Garga, but in Magh& by the Brahma Siddhanta. The value of , 3319-1840, in 10,000ths of the circle, can be converted into degrees, if required, by Table XLV B, above. It = 119deg 29' 26". That was the mean moon's place. Example 5. The lagna. (See Indian Chronography, $ 193, p. 74, and Example 63, p. 127.) Required to ascertain at what hour on the day Ashadha suk. 4 K.Y. 3726, or 14 June A.D. 625, the sign Tuld became lagna. At mean sunrise the sun's mean long. 8 was (Example 4) 2304-0178, roughly (Tablo XLV above) 82deg 57'. The first point of Tula (Libra) (Indian Chronography, Table XXII) is 180deg. 180deg - 82deg 57' = 97deg '. 97deg x 4 = 888m, or 6h 28m. 3' X 4 = 12 The first point of Tulk, therefore, was lagna at 6h 28m 12' after mean sunrise on the day in question. It lasted for 2 honns, when Vrifchika (Scorpio) became lagna. A ta the system me Indian Calendar, $88, p. 21; Indian Chronograpky, 113sto.
Page #48
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. TABLE LXXVI. Mean System Table, First Arya Siddhanta. 25
Page #49
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. (Vol. XVII. TABLE MEAN SYSTEM TABLE, Numbers of columns conform (Cols. 1 to 4.) The years herein stated are the current years corresponding (Cole. 6 and 7.)-Sarivatsara-names of mean solar years in italics shew where CONCURRENT YEAR. JOVIAN SALVATSARA. Mean Intercalated (adhika) lunar month. K Mabilli solar year in Bengal. Kollam. A.D. Boathore system. Northern system. 6 i 7 86 3601 499-500 . 9 Margasira 3602 2003 8804 . 6 Sravana 3806 3606 3607 . 2 Vaibikha. 3608 10 Pausha . 3609 3610 9 Yuvan . 10 Dhitri . . 11 Isvara . . 12 Bahudbinys 13 Pramathin 14 Vikrams . . 18 Vpinha . 18 Chitrabbana . 17 Subhinn . . 18 Tirana . . 19 Pirthiva . . 20 Vyaya . . 21 Sarvajit . . 29 Sarvadharini * Vidhia , . * Vikita . 9 Khara . . 96 Nandana . 97 Vijay . . W00-01 501-02 502-03 603-04 *504-06 606-08 308-07 807-08 *808-02 609-10 610-11 811.12 #513-18 818-14 814-18 818-16 *816-17 817-18 816-19 3611 . 3612 7 Asvina 3613 3814 3815 3 Jyeshtha . 12 Phalguns. 3616 3617 3618 8619 . 1 8080 8 Karttiku
Page #50
--------------------------------------------------------------------------
________________ No. 6.] LXXVI. FIRST ARYA SIDDHANTA. to Table I, "Indian Calendar." to the A.D. years in col. 5; as in Table I, "Indian Calendar." differences exist from Surya Siddhanta nomenclature in true solar years. Day and month, A.D. 13 MEAN SOLAR YEAR. 21 Mar. (80). 20 Mar. (80). 20 Mar. (79). 21 Mar. (80). 21 Mar. (80). 20 Mar. (80). 20 Mar. (79). 21 Mar. (80). 21 Mar. (80). 20 Mar. (80). 20 Mar. (79). 21 Mar. (90). 21 Mar. (80). 20 Mar. (8)). 20 Mar. (79). 21 Mar. (80). 21 Mar. (80). 20 Mar. (80). 20 Mar. (79). 23 Mar. (80). * * . . * " THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. . * COMMENCEMENT OF THE Week-day. 14 1 Sun. 2 Mon. 3 Tues. 5 Thur. 6 Fri. 0 Sat. 1 Sun. 3 Tues. 4 Wed. 5 Thur. 6 Fri. 1 Sun. 2 Mon. 3 Tues. 4 Wed. 6 Fri. 0 Sat. 1 Sun. 2 Mon. 4 Wed. . * . Time of mean Meshasamkranti. 17 H. M. 8. 6 0 0 12 12 30 .18 25 0 MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Day and month, A.D. 5 19 27 Feb. (58) 17 Mar. (77) 6 Mar. (65) 23 Feb. (54) 0 37 30 6 50 0 14 Mar. (73) 13 2 30 3 Mar. (63) 19 15 0 I 27 30 7 40 0 13 52 30 20 0 2 17 30 25 Feb. (56) 8 30 0 16 Mar. (75) 14 42 30 4 Mar. (64) 20 55 0 21 Feb. (52) 3 7 30 12 Mar. (71) 9 20 0 2 Mar. (61) 15 32 30 20 Mar. (80) 21 45 09 Mar. (68) 3 57 30 26 Feb. (57) 20 Feb. (51) 11 Mar. (70) 28 Feb. (59) 18 Mar. (78) 7 Mar. (66) * ... * * 1 Arya Siddhanta, mean system. Week-day. 20 0 Sat. 6 Fri. 3 Tues. 0 Sat. 6 Fri. 4 Wed. 1 Sun. 0 Sat. 4 Wed. 3 Tues. 0 Sat. 5 Thur. 4 Wed.. 1 Sun. 5 Thur. 4 Wed. 2 Mon. 1 Sun. 5 Thur. 2 Mon. * * * . * * a (here, the index of the tithi). 23 265-4513 300-0909 175-7743 51-4577 86-0973 300-4125 176-0959 210-7356 86-4189 121-0586 9996-7419+ 211-0572 245-6968 121-3802 9997-0635+ 31-7031 246-0185 280-6581 156-3414 32-0248 27 Kali year. 3601 3602 3603 3604 3605 3606 3607 3608 3609 3610 3611 3612 3613 3614 3615 3616 3617 3618 3619 3920 As a mean tithi Chaitra Sukia 1 was suppressed. The civil day corresponding to it, i.e, the first day of the mean luni-solar year, was as given in cols. 19, 20. D 2
Page #51
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA, (VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Mean Intercalated (adhika) lunar month. Saka. Chaitradi Vikrama. Meshidi solar year in Bengal. Kollam. A.D. Southern system. Northern system. 8a 3821 877 . 519-20 520-21 3622 3623 5 Sravana . . . 3624 . . . 521-22 522-23 523-24 *524-25 525-26 3625 3626 1 Chaitra . 3627 . 3628 626-27 10 Pausha 3629 627-28 . . . . . . 3630 *528-29 3631 529-30 . 7 Aovins 3632 630-31 3633 29 Manmatha 30 Durmukha 31 Hemalamba 32 Vilamba . 33 Vikarin . 34 Sarvarin, 35 Plava . 36 Bubbakrit 37 Sobhana. 38 Krodhin 39 Visvivasu . 40 Parabbava 41 Plavabga . 42 Kilaka 43 Saumya . 44 Sidharana 45 Virodbakpit 46 Paridhavin 47 Pramadin 48 Ananda . 49 Rakshasa . 50 Angla , 61 Pingala . 52 Kalayukta 63 Siddharthin . 3634 3 Jyeshtba. 3635 531-32 *532-33 633-34 534-35 535-36 *536-37 . 3636 12 Phalguna 3637 3638 . . 3639 . . . . . . . . . . . . . 537-38 8 Karttiks . 3640 638-39 3641 539-40 . *540-41 5 Brivada . 3642 3643 3344 541-42 542-43 643-44 8645 . 1 Chaitrs
Page #52
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. LXXVI-Contd. 1 Arya siddhanta, mean system, COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICA CHAITRA SUKLA 1 ENDS). Kali year. Day and month, A.D. Time of Day and month, Week-day. mean Mesha Day A.D. samkranti. Week-day. 1a (here=t, the index of the tithi). 13 17 19 20 23 . . 66-6644 3621 280-9797 3622 . 156-6631 3629 191-3027 3624 66-9860 3626 . . . 281-3013 3626 315-9409 3627 191-6243 3628 . . . 226-2640 101-9473 3629 3630 . . . . 316-2626 3631 . 12-2703 3632 21 Mar. (80) . 20 Mar. (80) 20 Mar. (79) . 21 Mar. (80) 21 Mar. (80) . 20 Mar. (80) . 20 Mar. (79) 21 Mar. (80). 21 Mar. (80) 20 Mar. (80) . 21 Mar. (80) 21 Mar. (80). 21 Mar. (80) 20 Mar. (80) . 21 Mar. (80) 21 Mar. (80) . 21 Mar. (80). 20 Mar. (80) . 21 Mar. (80) 21 Mar. (80) 21 Mar. (80) 20 Mar. (80) 21 Mar. (80) . 21 Mar. (80). 21 Mar. (80). H. M. s. 5 Thur.. 10 10 0 17 Mar. (76) . 16 22 306 Mar. (66) 0 Sat. 22 35 0 23 Feb. (54) 2 Mon. 47 3014 Mar. (73) 3 Tues. . 11 03 Mar. (62) 4 Wed.. 17 12 30 21 Feb. (52) 5 Thur.. 23 25 0 11 Mar. (70) 0 Sat. 16 37 30 28 Feb. (59) 1 Sun. 11 500 19 Mar. (78) 2 Mon. . 18 2 30 7 Mar. (67) 4 Wed.. o Feb. (58) 27 30 16 Mar. (74) 12 400 8 Mar. (64) 0 Sat. 18 30 22 Feb. (53) 2 Mon. 5 0 12 Mar. (71) 3 Tues. . 7 17 301 Mar. (60) 4 Wed.. 13 30 020 Mar. (79) 5 Thur.. 19 42 309 Mar. (69) O Sat. 1 0 26 Feb. (57) 1 Sun. . 8 7 30 17 Mar. (76) 2 Mon. . 14 20 Mar. (65) 3 Tues. 20 32 30 24 Feb. (55) 5 Thur.. 2 45 014 Mar. (73) 6 Fri. . 8 67 30 3 Mar. (62) Bat. 16 10 01 20 Feb. (61) 5 Thur. Fri. 1 Sun. 6 Fri. . 3 Tues. . 2 Mon. 6 Fri. 4 Wed. 3 Tues. . 0 Sat. 6 Fri. 3 Tues. . 1 Sun. . 6 Fri. . 4 Wed.. 1 Sun. . O Sat. . 4 Wed.. 3 Tues. 1 Sun. . 5 Thur. . 4 Wed. 1 Sun. . 6 Fri. . 5 Thur.. 2 Mon.. 8 Fri. . 226-5856 3633 . 102-2690 3634 . 136-9086 3635 12.5920 3636 47-2316 3637 . . . . 261-5469 3638 . 137.2303 3639 171-8699 3640 47-5533 3641 . 261-8686 3643 . 296-5082 3643 3144 172-1916 . 47-8749 3648
Page #53
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [Vol. XVII TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Chaitradi Vikrama. Mean Intercalated (adhika) lunar month. Meshadi solar year in Bengal. Kollam. A.D. Southern system. Northern system. 3a 11 3646 *544-45 3647 10 Pausha . 3648 3649 545-46 546-47 547-48 *548-49 519-50 . 3650 6 Bhadrapada 3651 3652 . . . 550-51 551-52 *552-53 3653 3 Jyeshtha. 3654 . . 3655 553-54 11 Magbs . 3656 554-56 3657 555-56 *556-57 54 Raudra. . 55 Durmati . . 56 Dundubhi !. 57 Rudhirodgarin. 58 Raktaksha 59 Krodhana . 80 Kshaya . . 1 Prabhavy. . 2 Vibhavs. . 3 Sukla . . 4 Pramoda. 6 Prajapati . . 6 Angiras . 7 Srimukhs. 8 Bhavs . . 9 Yuvan . . 10 Dhatri . . 11 Isvara . . 12 Bahudhanys 13 Pramathint . 15 Vpisha . . 16 Chitrabhanu . 17 Subhanu.. . 18 Tanama . 19 Parthivs . . . . 3658 8 Karttiks 3659 557-58 3660 558-59 . . 3661 559-60 4 Ashadha . 3662 *560-61 3603 561-62 3664 562-63 563-84 3666 . . . . . 3666 10 Pausha *564-65 565-66 3667 3668 566-67 567-88 6 Bhadrapada. 8869 3670 626 . . *568-69 + By I Arya Biddhanta mean system 14 Vikrams was expunged, and A.D. 664-68 corresponded to 16 Vriab By the same authority true ayntom A.D. 664-68 corresponded to 14 Vikrama, and 16 Vpisha Was oz punged. A.D. 585-86 was 16 Chitrabhanu by both systems.
Page #54
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. LXXVI--Contd. 1 Arya siddhanta, mean system. COMMENCEMENT OF THE MEAN SOLAR YEAR. MBAN LUNI-SOLAR YEAR (MEAN SUNRISE CF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Kali ycar. Day and month, Time of Week-day. mean Mesha samkranti. Day and month, A.D. Week-day. A.D. a (here=1, the index of the tithi). 13 17 20 82-5145 298-8298 3646 3647 . 3648 331-4694 207-1528 3649 3650 82-8361 6 Thur. 3 Tues. 2 Mon. - 6 Fri. 3 Tues. . 2 Mon.. O Sat. . 4 Wod. 3 Tues. o Sat. . 6 Fri. 3651 117-4757 331-7910 3652 3653 207-4744 242-1140 3654 117-7974 3655 3656 . 152-4370 3 Tuer. 28-1204 3657 20 Mar. (80) . 21 Mar. (80) . 21 Mar. (80). 21 Mar. (80) 20 Mar. (80). 21 Mar. (80) 21 Mar. (80) 21 Mar. (80) . 20 Mar. (80) 21 Mar. (80) 21 Mar. (80) . 21 Mar. (80) . 20 Mar. (80) . 21 Mar. (80) . 21 Mar. (80) . 21 Mar. (80). 21 Mar. (81) . 21 Mar. (80). 21 Mar. (80) . 21 Mar. (80). 21 Mar. (81) . 21 Mar. (80) . 21 Mar. (80). 21 Mar. (80) . 21 Mar (81). H. M. s. . 1 Sun 21 22 30 10 Mar. (70) . 3 Tues. 3 35 0 28 Feb. (59) . 4 Wed. . 947 30 19 Mar. (78) 5 Thur.. 16 00 8 Mar. (67) . & Fri. . 22 12 30 25-Feb. (56) . 1 Sun. 0 15 Mar. (74) 2 Mon. . 10 37 30 5 Mar. (64) . 3 Tues. 16 600 22 Feb. (53) . 4 Wed 23 2 30 12 Mar. (72) 8 Fri. 6 16 0 1 Mar. (60) . 0 Sat. . 11 27 30 20 Mar. (79) . 1 Sun. 17 40 0 Mar. (88) . . 23 52 30 27 Feb. (58) . 4 Wed . 6 8 017 Mar. (76) . 6 Thur.. 12 17 30 6 Mar. (85) 6 Fri. 18 30 0 23 Feb. (54) . 1. Sun..io 30 13 Mar. (73) 2 Mon. . B 03 Mar. (62) . 3 Tues. . 13 7 30 20 Feb. (51) . . Wod... 19 20 0 11 Mar. (70) . 8 Prili 30 28 Feb. (59) . O Sat.. 746 018 Mar. (77) . 1 Sun. . 18 57 30 8 Mar. (67) . 2 Mon. .20 10 0 25 Feb. (18) Wed . , 22 30 15 Mar. (76) 242-4357 3658 377-0753 3659 162.7587 3660 28-1421 3661 3662 63-0817 277-3970 3663 1 Sun. O Sat. 4 Wed. . 1 Sun. O Sat. 5 Thur. . 2 Mon. . 1 Sun. . 4 Wed. 2 Mon. . 16 Fri. 8 Thur..] 153-0803 3864 187-7200 3666 Thur. 83-4034 3666 98-0430 3667 312-3582 3688 3660 188-0416 222-6813 3670
Page #55
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [Vol. XVII. TABLE CONCURRENT YEAR. JOVIAN BARVATSARA. Kali. Chaitradi Vikrama. Mean Intercalated (adhika) lunar month. Meshadi solar year in Bengal. Kollam. A.D. in Be Southern system. Northern system. 3671 669-70 570-71 . . . . 3672 3 Jyeshtha. 3673 571-72 3674 *572-73 . 11 Magha 3675 573-74 . 3676 574-75 3677 575-76 . . . . 3678 *576-77 . . . 3679 577-78 878-79 3680 4 Ashadha 1 3681 679-80 *580-81 8882 3883 581-82 20 Vyaya . 21 Sarvajit . 22 Sarvadharin 23 Virodhin . 24 Vikita . 25 Khara . 26 Nandana . 27 Vijaya . 28 Jaya . 29 Manmatha 30 Durmukha 81 Hemalamba 32 Vilamba. 33 Vikarin . 34 Sarvarin 35 Plava 36 Subhaktit 37 Sobhana . 38 Krodhin . 39 Visvavasa 40 Paribhava 41 Plavanga 42 Kilaka . 43 Baumya 44 Badhirapa 1 Chaitra 1 . . 3684 582-83 . 3685 583-84 9 Margasira 3886 *584-86 8687 586-86 3688 686-87 . . 6 Bhadrapada. 587-88 . . 3689 3690 SSE 3691 *588-89 689-90 590-91 . 2 Vaisakha. . . 3692 . E 591-92 11 Magha 8693 3694 3696 *692-93 . 693-94 . S
Page #56
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. LXXVI-Contd. 1 Arya Siddbanta, mean system. COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Kali year. Day and month, A.D. Time of Week-day. mean Mesha sankranti. Day and month, AD Week-day. Q (berert. the index of the tithi). 13 20 1 23 1 2 Mon. . 98-3646 3671 312-6799 3072 O Sat. 5 Thur. 8-6876 3673 3 Tues. 223-0029 3674 2 Mon. 257-6425 3675 133-3259 3676 3677 9-0092 43-6488 3678 3679 257-9641 133-6476 168-2871 3680 3681 14 17 19 H. M. S. 5 Thur.. . 6 Fri. . . 14 47 30 22 Feb. (53) 210012 Mar. (71). 2 Mon. . 3 12 30 1 Mar. (61) 3 Tues.. 9 25 0 20 Mar. (79) I 4 Wed. . 15 37 30 9 Mar. (68) 5 Thur.. 21 50 0 26 Feb. (57) . 0 Sat. 4 % 30 16 Mar. (76) 1 Sun. . 10 15 0 6 Mar. (65) . 9 Mon. 30 23 Feb. (54) 3 Tues. . 0 14 Mar. (73) . 5 Thur.. 4 52 302 Mar. (62) . 6 Fri. 5 020 Feb. (61) 0 Sat. . 17 17 30 11 Mar. (70) 1 Sun. 30 0 28 Feb. (59) I 3 Tues. . 5 42 30 18 Mar. (78) . 4 Wed. 07 Mar. (66) 5 Thur. . 18 7 30 25 Feb. (56) . Sat. 20 1 6 Mar. (75) . . Sun..16 32 30 4 Mar. (64) . 2 Mon. . 12 45 021 Feb. (62) . 3 Tues. . 18 67 3012 Mar. (71) 5 Thur. . 100 2 Mar. (61) . 6 Fri. . 7 22 30 19 Mar. (79) Sat. 13 35 0 Mar. (68) 43-9705 21 Mar. (80) 21 Mar. (80). 21 Mar. (80) Mar. (81). 21 Mar. (80) . 21 Mar, (80). 21 Mar. (80) 21 Mar. (81) . 21 Mar. (80) 21 Mar. (80) . 21 Mar. (80) 21 Mar. (81) . 21 Mar. (80) 21 Mar. (80) 21 Mar. (80) 21 Mar. (81). 21 Mar. (80). 21 Mar. (80). 22 Mar. (81). 21 Mar. (81) . 21 Mar. (80). 21 Mar. (80) . 22 Mar. (81). 21 Mar. (81) . 21 Mar. (80) . 3682 le 258-2857 3683 292.9254 3684 168-6087 3685 6 Fri. 3 Tues. 2 Mon. 0 Sat. 4 Wed.. 3 Tues. Sat. . 5 Thur., 4 Wed.. 1 Sun. . Sat. . 4 Wed., 2 Mon.. 1 Sun. . 5 Thur.. 2 Mon. 1 Sun. . 6 Fri. 4 Wed.. 2 Mon. . 203-2484 3686 78-9317 3687 293-2470 3688 327-8867 3689 203-5700 3690 79-2534 3691 113.8930 3692 328-2083 3693 24-2160 3694 238-5313 3695
Page #57
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [Vol. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Saks. Chaitradi Vikrama. Mean Intercalated (adhika) lunar month. Meshidi solar year in Bengal. A.D. Southern system. Northern system. 3696 594-96 7 Aivina . . 3897 595-96 3898 *596-97 597-98 . Asbadhe 3699 3700 598-99 3701 599-800 12 Phalguns. 3702 *600-01 3703 . . . . . 3704 601-02 602-03 603-04 *B04-06 9 Margadira. 3706 3708 606-08 8 Bhidrapada. 3707 3708 45 Virodhakrit . 46 Paridhavin . 47 Pramidin 48 Ananda . . 49 Rakshasa . 30 Anala . . 61 Pingala . . 62 Kalayukta . 88 Siddharthin . Raudrs . 66 Durmati . . 56 Dundubhi . 67 Budhirodgarin. . 58 Raktaksha 69 Krodhana 60 Kshay.. . 1 Prabhava . . 2 Vibhaya . . 3 Sukla Pramoda . . 5 Prajapati 6 Angirw . . Srimukhe . . 3 Bhira . . 9 Yuvan . . . . 608-07 B07-08 3700 3710 *B08-09 2 Vaisakhs 3711 609-10 3712 810-11 11 Magha. . . 3713 011-12 *812-18 . 7 Livina 613-141 614-18 9716 3717 618-18 3718 *616-19 4 3119 617-18 3720 618-10 12 Phalguna
Page #58
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. LXXVI-Contd. 1 Arya Siddhanta, mean system, COMMENCEMENT OF THE MAN SOLAB YEAR. MEAN LUNI-SOLAB YEAR (MEAN SUNRISE OF OIVIL DAY ON WEICH CHAITRA SUKLA 1 ENDS). Kali year. Day and month, A.D. Time of Week-day. mean MeshDay and month, nean Mbah Day and monta, A.D. Sankranti. Week-day. a (here=t, the index of the tithi). 13 17 23 3696 114-2147 148-8643 3697 24-5377 3698 238-8530 273-4026 3699 3700 149-1760 3701 183-8166 3702 3703 89-4990 273-8142 3704 308-4639 3706 184.1373 3708 69-8207 3707 21 Mar. (80) . 22 Mar. (81) . 21 Mar. (81) . 21 Mar. (80) . 21 Mar. (80). 22 Mar. (81). 21 Mar. (81). 21 Mar. (80) . 21 Mar. (80). 22 Mar. (81). 21 Mar. (81) . 21 Mar. (80). 21 Mar. (80) . 22 Mar. (81) . 21 Mar. (81). 21 Mar. (80). 21 Mar. (80) . 22 Mar. (81). 21 Mar. (81). 21 Mar. (80). 21 Mar. (80) . 22 Mar. (81) . 21 Mar. (81) 21 Mar. (80) . 32 Mar. (81). H. M. S. 1 Sun. 19 47 30 28 Feb. (57) . 3 Tues.. 0 17 Mar. (76) 4 Wed.. 30 6 Mar. (65) . 5 Thur... 0 23 Feb. (54) 6 Fri. . 20 30 14 Mar. (73) . 1 Sun. 2 03 Mar. (62) 2 Mon. . 9 30 21 Mar. (81) . 3 Tues.. 16 15 0 10 Mar. (60) 4 Wed. 30 281 Feb. (60) 8 Fri. . 0 19 Mar. (78) : O Sat. 1 | 7 Mar. (67) 1 Sun. 24 Feb. (58) . 2 Mon. . 22 30 16 Mar. (74) . 4 Wed. 06 Mar. (64) 5 Thur.. 22 Feb. (53) 6 Fri. . 16 012 Mar. (71) . O Sat. 23 30 1 Mar. (60) . 2 Mon.. 20 0 20 Mar. (79) .8 Tues. .11 32 30 8 Mar. (68) 4 Wed. 17 45 0 26 Feb. (57) . 6 Thur.. 23 57 30 17 Mar. (76) . O Sat. 06 Mar. (66) 1 Sun. 12 22 23 Feb. (64) 2 Mon. . 18 36 013 Mar. (72) . 4 Wed 0 47 30 3 Mar. (62) Fri. . 0 Thur.. 2 Mon.. 0 Sat. . 8 Fri. 3 Tues.. 2 Mon.. 6 Fri. . 4 Wed., . Tuom.. . Sat. . . Wed.. . Tues.. 1 San. 5 Thur. 4 Wed. 1 Sun. . O Sat. Wed. 2 Mon. . 1 Sun. 8 Thur. . 2 Mon.. 1 Sun. . Fri. 94-4603 3708 308-7756 3709 3710 184-4589 3711 219-0986 94.7819 129-4215 3718 3713 3714 5-1049 3716 3716 219-4201 254-0607 129-7432 3-4266 40-0861 254-3814 3717 3718 3719 3720 - E 2
Page #59
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Mean Intercalated (adhika) lunar month. Kali. Mesbadi solar year in Bengal. Kollam. A.D. Southern systerr. Northern system. 3721 1919 619-20 *820-21 821-22 . . . . 3722 3723 9 Margaira. 3724 622-23 623-24 3725 3726 . . . . *824-25 Sravana . 3727 625-26 3728 . . . . . , , . . 626-27 627-28 *628-29 3729 2 Vaisakha. 3730 3731 629-30 . . . 10 Pausha 3732 *** 3733 630-31 631-32 *832-33 10 Dhatci . 11 Isvars . 12 Bahudhanya 13 Pramathin 14 Vikrama. 16 Vpisha . 16 Chitrabhanu 17 Subhanu 18 Tarana , 19 Parthivs, 20 Vyaya . 21 Sarvajit . 22 Sarvadharin 28 Virodhin . 24 Vikrita 26 Khara . 28 Nandana . 27 Vijaya . 28 Jaya . 29 Manmatha 30 Durmukha 31 H&malamba 32 Vilamba . 33 Vikarin 34 Barvarin . 3734 . 7 Aivina 3735 633-34 3736 634-35 835-36 3 Jyeshtha. 3737 3738 . . . . I . . . *636-37 3739 12 Phalguna 3740 8741 637-38 838-39 839-40 *840-41 841-42 642-43 3742 9 Margakin. . . 3743 . . . . 3744 8745 643-44 . 6 Bravaga
Page #60
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. LXXVI-Contd. I Arya Siddhanta, mean system. COMMENCEMENT OF THE MEAN SOLAB YEAB. MEAN LUNI-BOLAR YEAR (MEAN SUNRISE OY CIVIL DAY ON WHICH CHAITRA SUKLA 1 Eds). Kali year. Day and month, A.D. Time of Day and month, Woek day. mean Meshay A.D. samkranti. Week-day. a (here=t, the index of the tithi). 13 17 19 20 123 289-0209 22 Mar. (81). 21 Mar. (81). 164-7044 (80) 40-3877 . 5 Thur. 2 Mon.. . 6 Fri. 5 Thur. 3 Tues. O Sat. 6 Fri. 3721 3722 3723 3724 3725 75-0274 289-3427 165-0261 3726 3727 199-6657 76-3491 3728 289-6643 3729 324-3039 3730 199-9873 3731 234.6269 H.M.S. 15 Thur.. 7 0 0 22 Mar. (81) 6 Fri. . 13 12 30 10 Mar. (70) O Sat. . 19 25 0 27 Feb. (58) . 2 Mon. 30 18 Mar. (77) . 3 Tues. . 7 8 Mar. (87) 4 Wed. 30 25 Feb. (56) 8 Thur. 0 15 Mar. (74) . O Sat. 2 27 30 4 Mar. (63) 1 Sun. . 8 40 0 22 Feb. (53) . 2 Mon. . 14 52 30 12 Mar. (72) . 3 Tues. . 21 6 0 1 Mar. (60) . 6 Thur.. 3 17 30 20 Mar. (79) . 6 Fri. . $ 300 9 Mar. (68) O Sat. O Sat. 15 42 30 18 27 Feb. (58) 1 Sun. .21 55 0 16 Mar. (75) . 3 Tues. . 4 7 306 Mar. (65) . 4 Wod.. 10 23 Feb. (54) . 8 Thur.. 16 32 30 13 Mar. (73) 16 Fri. . 22 46 0 2 Mar. (61) 1 Sun. 4 57 3021 Mar. (80) 2 Mon. 0 11 Mar. (70) 3 Tues. . 17 22 30 28 Feb. (59) .4 Wod. . 23 35 0 18 Mar. (77) 6 Fein . 547 30 7 Mar. (66) O Sat. 12 0 25 Feb. (56) 3732 3733 110-3103 324-6266 22 Mar. (81) . 22 Mar. (81) . 21 Mar. (81) 21 Mar. (80). 22 Mar. (81) . 22 Mar. (81) . 2i Mar. (81) . 21 Mar. (80) . 22 Mar. (81) . 22 Mar. (81) . 21 Mar. (81). 21 Mar. (80) 22 Mar. (81) . 22 Mar. (81) . 21 Mar. (81) . 31 Mar. (80). 22 Mar. (81). 22 Mar. (81). 21 Mar. (81). 21 Mar. (80). 22 Mar. (81). 22 Mar (81). 3734 3736 3738 3 Tues. 1 Sun. Sat. 4 Wod. . 3 Tues.. o Sat. Thur.. 3 Tues.. . 1 Sun. . . 6 Thur.. 4 Wed.. | 1 Sun.. . Sat. Thur. . 2 Mon. I Run 5 Thur.. . 3 Tues.. 20-6333 234.9486 110-6320 146-2716 3737 * 3738 20-9650 3739 3740 66-6946 269-9099 3741 145-5933 3742 180-2329 3743 86-9163 174 270-2316 3745
Page #61
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. (Vol. XVII. TABLE CONCURRENT YEAR. JOVIAN BARVATSARA. Moshadi solar year in Bengal. Meen Intercalated (adhika) lunar month. Southern system. Northern system. 1 3748 3747 8748 3749 *644-45 648-46 646-47 647-48 2 Vaibakhe & *848-49 10 Pausha 3750 3752 . . . . . . 3762 7 Asvina 3763 3754 8SS 3755 3756 649-50 680-61 661-62 *852-53 663-64 654-88 666-58 *656-57 667-68 658-59 659-80 3 Jyeshtbs 3767 1 2 3758 35 Plava . 38 Subhakfit 37 88bhans. . 38 Krodhin. . 39 Visvavast . 40 Parabhavat . 42 Kilaka . . 43 Saumya . . 44 Sadharana 46 Virddhakpit . 46 Paridhavin . 47 Pramadin 48 Ananda , 49 Rakshaga . . 50 Anala . . 61 Pingals. . 52 Kalayukta . 53 Siddharthip . 54 Raadrs . 66 Durmati . . 68 Dyndabhi . 57 Radhirodgarin . 68 Raktaksha 59 Krodhana 60 Kshays. . 12 Phalguna. 3759 , . 3760 3761 8 Karttika 3762 *660-61 3763 . 661-62 662-63 3784 6 Srivas : 3 3765 663-64 3768 *664-65 886-88 . . 3767 1 Chaitrs . 3768 666-67 3769 667-68 10 Paasha . on 3770 *668-69 . t By tho mean system 41 Plavanga was expunged, as sloo by the true system.
Page #62
--------------------------------------------------------------------------
________________ No. 6.) THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. LXXVI-Contd. 1 Arya Siddhanta,mean system. . COMMENCEMENT OF THE MIAN SOLAB YEAR. MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA I ENDS). Kali year. Day and month, A.D. Time of Week-day. mean Meshe samkranti. Day and month, A.D. Week-day. a (here=t, the index of the tithi). 13 14 17 19 20 123 304.8711 . 180-5545 56-2378 3746 3747 3748 3749 3760 90-8775 . . 305-1927 1.2005 215-5167 91.1991 125-8387 21 Mar. (81). 22 Mar. (81) . 22 Mar. (81). 22 Mar. (81) . 21 Mar. (81) . 22 Mar. (81). 22 Mar. (81). 22 Mar. (81) . 21 Mar. (81). 22 Mar. (81) .. 22 Mar. (81) . 22 Mar. (81) . 21 Mar. (81) . 22 Mar. (81) . 22 Mar. (81) . 22 Mar. (81) 21 Mar. (81). 22 Mar. (81) . 22 Mar. (81) . 22 Mar. (81). 21 Mar. (81). 22 Mar: (81). 22 Mar. (81). 22 Mar. (81). 21 Mar. (81) . . 2 Mon. . 6 Fri. . 3 Tues.. 2 Mon.. O Sat. . 5 Thur.. 3 Tues. O Sat. . 6 Fri. .3 Tues.. 1 Sun. O Sat. . 4 Wed. 3 Tues. . O Sat. 8 Thur.. 3751 3752 3753 3754 3755 3786 3757 . . . . . . . . . 1.5221 II. M. S. 1 Sun. . 18 12 30 15 Mar. (76) 3 Tues. To 25 0 4 Mar. (63) 4 Wed. 18 30 21 Feb. (52) 5 Thur.. 012 Mar. (71) Fri. . 1 Mar. (61) 1 Sun. 1 0 19 Mar. (78) 2 Mon. . 7 27 30 9 Mar. (68) 3 Tues. . 13 40 0 26 Feb. (57) 4 Wed.. 30 16 Mar. (76) 6 Fri. . 0 5 Mar. (64) O Sat. 17 30 23 Feb. (54) 1 Sun. . 14 300 14 Mar. (73) 2 Mon.. 20 12 30 2 Mar. (62) ed. 2 66 0 21 Mar. (80) 5 Thur.. 9 7 30 10 Mar. (69) 8 Fri. 28 Feb. (50) 0 Sat. 21 32 30 18 Mar. (78) 2 Mon. 0 7 Mar. (66) 3 Tues. . 967 3024 Feb. (56) 4 Wed.. 16 10 015 Mar. (74) 6 Thur.. 22 22 304 Mar. (64) 0 Sat. 4 36 0 21 Feb. (62) 1 Sun. 1 Sun. . 10 47 30 12 Mar. (71) 2 Mon.. 17 00 1 Mar. (60) 3 Tues. . 23 12 30 18 Mar. (78) 215-8374 250-4770 126-1604 3758 160-8000 3769 36-4834 3760 250-7987 3761 4 Wed. 3762 285-4383 161.1217 1 Sun. 3783 3764 . . . . 5 Thur 4 Wed. 2 Mon. 3704 36-8081 71-4447 285-7599 181-4433 3786 8 Fri 3767 196-0830 3768 5 Thur 2 Mon. 1 Sun. . . 3789 71-7663 106-4060 3770
Page #63
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [Vol. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Chaitradi Vikrama. Mean Intercalated (adhika) lunar month. Moshadi solar year Kollam. A.D. Southern system. Northern system. 3771 669-70 1 Prabhava 3772 670-71 . . 6 Bhadrapada 8773 671-72 . . 3774 *672-73 . 1 673-74 3 Jyesbtha . 1 3775 3776 3777 674 75 . . . 11 Magha 675-76 *676-77 . 3778 3779 677-78 3780 678-79 . . . 8 Karttiks . 3781 679-80 . 3782 *880-81 2 Vibhava . 3 Sukla . 4 Pramoda. 5 Prajapati. 6 Angiras . 7 Srimukha . 8 Bhava . 9 Yuvan . 10 Dhatri . 11 Isvara . 12 Bahudhanya 13 Pramathin 14 Vikrama . 15 Vrisha 16 Chitrabhanu 17 Subhanu . 18 Tarana . 19 Parthiva. 20 Vyaya . 21 Sarvajit . 22 Sarvadharin 3783 . 5 Sravana . . 3784 681-82 682-83 683-84 j 3785 3786 *884-85 3787 i 685-86 . . . . 1 Chaitra . . 10 Pausha 3788 h 3789 886-87 687-88 *888-89 3790 . . . . . . . 3791 689.90 6 Bhadrapada 3792 3793 690-91 691-92 *692-93 23 Virodhin. . . 3794 g 3 Jyeshtha. 24 Vikrita 25 Khara 3796 o 693-94 . . .
Page #64
--------------------------------------------------------------------------
________________ No. 6.) THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. LXXVI-Contd. 1 Arya Siddhanta, mean system, COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Kali year. Day and month, A.D. Time of Weck-dry. mean Misha samkranti. Day and month, A.D. Week-day. a (heret, tho index of the tithi). . 13 20 23 1 3771 3772 . 3773 3774 3775 12 3776 . 3777 3778 3779 . 22 Mar. (81) 22 Mar. (81) . 22 Mar. (81) . 22 Mar. (82) 22 Mar. (81) 22 Mar. (81). 22 Mar. (81) . 22 Mar. (82) 22 Mar. (81). 22 Mar. (81) . 22 Mar (81). 22 Mar. (82) 22 Mar. (81) 22 Mar. (81) 22 Mar. (81) 22 Mar. (82). 22 Mur. (81) 22 Mar (81) . 22 Mar. (81) 22 Mar. (82) . 22 Mar. (81) 22 Mar. (81). 22 Mar. (81). 22 Mar. (82) 22 Mar. (81) 17 19 M.S. 5 Thur.. 5 9 Mar. (68) 6 Fri. . 11 37 30 26 Feb. (57) 0 Sat. 17 50 0 17 Mar. (76) 2 Mon.. o 2 305 Mar. (65) 3 Tues..16 0 23 Feb. (54) 4 Wed. 27 30 13 Mar. (72) 5 Thur.. 18 40 0 3 Mar. (62) 0 Sat 052 3021 Mar. (81) 1 Sun. . 7 5 0 10 Mar. (69) 2 Mon. . 13 17 30 27 Feb. (58) 3 Tues. 19 30 18 Mar. (77) 5 Thur.. i 42 30 7 Mar. (67) 6 Fri. . .7 55 024 Fob. (55) 0 Sat 14 7 30 15 Mar. (74) 1 Sun. 20 20 0 4 Mar. (63) 3 Tues.. 2 32 30 22 Feb. (53) 4 Wed. . 8 450 12 Mar. (71) 5 Thur.. 14 57 301 Mar. (60) 6 Fri. 21 10 020 Mar. (76) 1 Sun. 8 Mar (68) 2 Mon. . 9 33 0 26 Feb. (57) 3 Tues. . 15 47 3016 Mar. (75) 4 Wed. 22 006 Mar. (65) 6 Fri. . 4 12 30 23 Feb. (54) O Sat. 10 25 0 13 Mar. (72) 320-7213 3 Tues.. 196-4016 2 Mon. . 231.0442 6 Fri. . 106-7276 4 Wed.. 321.0429 2 Mon... 17-0506 0 Sat. . 231-3658 6 Fri. 266-0054 3 Tues.. 141-6888 O Sat. . 17-3723 6 Fri. . 52-0118 4 Wed.. 266-3271 1 Sun. . 142.0105 O Sat. . 176-6501 4 Wed.. 52-3331 2 Mon. . 266-6487 1 Sun. . 301-2884 5 Thur. 176-9717 4 Wed. 211.6114 1 Sun. 87.2948 6 Fri. . 301.6100 0997-61777 2 Mon.. 211.9330 Fri. . 87-6164 5 Thur..! 122-2560 3780 3781 3782 3783 . 3784 3785 3786 3787 . 3798 3789 . 3790 3701 3792 3793 3794 3795 As a man tithi Chaitra Sukla 1 was expunged. The civil day corresponding to it, i.e., the first day of tho mcan luni-solar year, was as given in cols. 19, 20.
Page #65
--------------------------------------------------------------------------
________________ 42 Kali, Saka. co Chaitradi Vikrama. Meshadi solar year in Bengal. 3a 3796 617 752 101 3797 618 753 102 3798 619 754 103 3799 620 755 104 3800 621 756 105 106 3801 622 757 623 758 107 3802 3803 624 759 3804 108 625 760 109 3805 626 761 110 3806 627 762 111 3807 628 763 112 3808 629 764 113 3809 630 765 114 3810 631 766 118 3811 632 767 116 3812 768 117 3813 634 769 118 3814 035 770 119 3815 636 771 120 3816 637 772 121 3817 638 773 122 3818 639 774 123 3819 640 775 124 3830 641 776 125 EPIGRAPHIA INDICA. CONCURRENT YEAR. Kollam. A.D. 5 694-95 695-96 *696-97 697-98 698-99 699-700 *700-01 701-02 702-03 703-04 *704-05 705-06 706-07 707-08 *708-09 709-10 710-11 711-12 *712-13 713-14 714-15 715-16 716-17 717-18 718-19 JOVIAN SAMVATSARA. Southern system. 6 Northern system. 26 Nandana 27 Vijaya 28 Jaya 29 Manmatha 30 Durmukha 31 Hemalamba 32 Vilamba 33 Vikarin " 34 Sarvarin 35 Plava 36 Subhakrit 37 Sobhana " 38 Krodhin 39 Visvavasu 40 Parabhava 41 Plavanga. 42 Kilaka 43 Saumya 44 Sadharana 45 Virodhakrit 46 Paridhavin 47 Pramadin 48 Ananda 49 Rakshasa. 50 Anala 7 [VOL. XVII. TABLE Mean Intercalated (adhika) lunar month. 90 11 Magha 8 Karttika 4 Ashadha 1 Chaitra 9 Margasira. 6 Bhadrapada 2 Vaisakha 11 Magha By the "Indian Calendar" 7 Avina was intercalated but the case was a close one. 8 Karttikat
Page #66
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. LXXVI--Contd. * 1 Arya Siddhanta, mean system, COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Kali year. Day and month, A.D. Time of Week-day. mean Mesha samkranti. Day and month, A.D. Week-day. a (heret, the index of the tithi). 13 17 19 20 23 M. S. 3796 3797 3798 3799 3800 3801 3802 3803 . 18 3804 3805 3806 3807 22 Mar. (81) 22 Mar. (81) . 22 Mar. (82) . 22 Mar. (81). 22 Mar. (81) 22 Mar. (81) 22 Mar. (82) 22 Mar. (81) 22 Mar. (81) . 23 Mar. (82) 22 Mar. (82) (81) 22 Mar. (81) 23 Mar. (82) 22 Mar. (82). 22 Mar. (81) . 22 Mar. (81): 23 Mar. (82) . 22 Mar. (82) . 22 Mar. (81) 22 Mar. (81) . 23 Mar. (82) 22 Mar. (82) . 22 Mar. (81). 22 Mar. (81). 2 Mar. (61) . 2 Mon. . 22 0 21 Mar. (80) . 3010 Mar. (70) 5 Thur. 0 27 Feb. (58) 6 Fri. 30 18 Mar. (77) 0 Sat. . 23 0 7 Mar. (66) 2 Mon. 30 25 Feb. (56) 3 Tues. . 12 0 15 Mar. (74) 1 4 Wed. 37 30 4 Mar. (83) 6 Fri. 021 Feb. (62) O Sat. 842 3011 Mar. (71) 1 Sun. 12 55 0 1 Mar. (80) 2 Mon. . 19 30 20 Mar. (79) 4 Wed. . 1 2009 Mar. (68) . 5 Thur.. 7 32 30 26 Feb. (67) . 6 Fri 13 45 0 16 Mar. (75) . O Sat. 19 57 306 Mar. (65)] . 2 Mon. . 2 10 023 Feb. (54) . 3 Tues.. 8 22 30 13 Mar. (73) 4 Wed..14 02 Mar. (61) . 5 Thur.. 30 21 Mar. (80) 0 Sat. 10 Mar. (69) . 1 Sun. . 9 30 28 Feb. (59) 2 Mon.. 15 25 0 18 Mar. (77) 3 Tues. . 21 37 30 7 Mar. (66) 2 Mon. . 9997-83947 1 Sun. . 32-5790 6 Fri. 246-8943 : 3 Tues. 122-6777 2 Mon.. 157-2173 6 Fri. 32.9006 4 Wed. 247-2159 . 3 Tues. 281-8555 . O Sat. 157-5389 . 4 Wed. . 33-2223 3 Tues. 67-8619 . 1 Sun. 282-1771 O Sat. 316-8168 . 4 Wed. 192-5002 1 Sun. . 68-1835 Sat. 102-8231 .5 Thur.. 317.1384 . 2 Mon.. 192-8218 . 1 Sun. 227-4614 6 Thur..! 103-1447 . 4 Wed.. 137.7843 13-4678 6 Fri. . 227.7831 Thur.. 262.4226 2 Mon. . 138-1080 3808 3809 3810 3811 3812 3813 3814 3816 3816 1. Sun. . 3817 3818 3819 3820 As a mean tithi Chaitra Sukla 1 was suppressed. The civil day corresponding to it, i.e., the first day of the mean luni-solar year, was as given in cols. 19, 20. F 2
Page #67
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [Vol. XVIL. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Mean Kali. Intercalated (adhika) lunar month. Saka. Chaitradi Vikrama. Moshadi solar year in Bengal. Kollam. A.D. Southern system. Northern system. 1 2 80 . . 4 Ashadha 3821 3822 3823 719-20 *720-21 51 Pingala . 52 Kalayukta 53 Siddharthin 721-22 . . 3824 722-23 1 Chaitra . . 3825 . . . 723-24 3826 *724-25 9 Margasira 3827 725-26 : 3828 726-27 3829 727-28 6 Bhadrapada 3830 *728-29 . . . i . 729-30 3831 3832 730-31 731-32 . 2 Vaisakha 3833 3834 *732-33 . 11 Magha 54 Raudra . 55 Durmati . 56 Dundubhi 57 Rudhirodgarin 58 Raktaksha 59 Krodhana 60 Kshaya . 1 Prabhava. 2 Vibhava . 3 Sukla 4 Pramoda. 5 Prajapati . 6 Arngirast. 8 Bhava . 9 Yuvan 10 Dhatpi 11 Tavara 12 Bakudhanya 13 Pramatbin 14 Vikrams 15 Vrisha 16 Chitrabhann . . 3835 733-34 734-35 3836 . 7 Asvina . 3837 3838 735-36 *736-37 737-38 . 3839 3840 8841 4 Ashadba . 738-39 739-40 . . . . 3842 *740-41 12 Phalgune. 3843 741-42 . . 3844 742-43 743-44 3845 . 9 Margasira By the mean ayatom, as well as by the true system, 7 Srimukha was expunged.
Page #68
--------------------------------------------------------------------------
________________ No. 6.] LXXVI-Contd. Day and month, A.D. 13 MEAN SOLAR YEAR. 23 Mar. (82). 22 Mar. (82). 22 Mar. (81). 22 Mar. (81). 23 Mar. (82). 22 Mar. (82). 22 Mar. (81). 22 Mar. (81). 23 Mar. (82). 22 Mar. (82). 22 Mar. (81). 23 Mar. (82). 23 Mar. (82). 22 Mar. (82). 22 Mar. (81). 23 Mar. (82). 23 Mar. (82). 22 Mar. (82). 22 Mar. (81). 23 Mar. (82). 23 Mar. (82). 22 Mar. (82) 22 Mar. (81). 23 Mar. (82). 23 Mar. (82). . " . THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. * COMMENCEMENT OF THE 14 Time of Week-day. mean Mesha Day and month, A.D. samkranti. 5 Thur. 6 Fri. 0 Sat. 1 Sun. 3 Tues. 4 Wed.. 5 Thur. 6 Fri. 1 Sun. 2 Mon. 3 Tues. 5 Thur. 6 Fri. 0 Sat. 1 Sun. 3 Tues. 4 Wed. 5 Thur. 6 Fri. 1 Sun. 2 Mon. 3 Tues. 4 Wed. 6 Fri. 0 Sat. * . " . . * * . . * * H. M. S. " 3 50 10 17 16 15 2 2 30 22 27 30 4 40 0 10 52 30 17 23 17 30 5 30 11 42 30 17 55 0 0 7 30 6 20 0 12 32 30 18 45 0 0 57 30 7 10 0 13 22 30 0 1 47 30 +-8 - 80 5 19 35 88888 0 0 14 12 30 20 25 0 2 37 30 8 50 0 MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SURLA I ENDS). 19 24 Feb. (55) 14 Mar. (74) 4 Mar. (63) 21 Feb. (52) 12 Mar. (71) 29 Feb. (60) 19 Mar. (78) 9 Mar. (68) 26 Feb. (57) 16 Mar. (76) 5 Mar. (64) 23 Feb. (54) 14 Mar. (73) 2 Mar. (62) 21 Mar. (80) 10 Mar. (69) 28 Feb. (59) 17 Mar. (77) 7 Mar. (66) 24 Feb. (55) 15 Mar. (74) 3 Mar. (63) 22 Mar. (81) 12 Mar. (71) 1 Mar. (60) ... . " * . . . . . 1 Arya Siddhanta, mean system. Weck-day. 20 6 Fri. 5 Thur. 3 Tues. 0 Sat. 6 Fri. 3 Tues. 2 Mon. 0 Sat. 4 Wed. 3 Tues. 0 Sat. 5 Thur. 4 Wed. 1 Sun. 0 Sat. 4 Wed. 2 Mon. 0 Sat. 5 Thur. 2 Mon. 1 Sun. 5 Thur. 4 Wed. 2 Mon. 6 Fri. . " * * . * . a (here=t, the index of the tithi). 23 13-7894 48.4290 262-7443 138-4276 173-0673 48-7506 83-3903 297-7055 173-3890 208-0286 83-7119 298-0272 332-6669 208-3502 242-9898 118-6732 232-9885 28-9962 243-3115 118-9949 153-6345 29-3179 63-9575 278-2728 153-9561 45 Kali year. 1 3821 3822 3823 3824 3825 3826 3827 3828 3829 3830 3831 3832 3833 3834 3835 3836 3837 3838 3839 3840 3841 3842 3843 3844 3845
Page #69
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [Vol. XVI TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Mean Intercalated (adhika) lunar month. Saka. Chaitradi Vikrama. Meshadi solar year in Bengal. Kollam. A.D. Southern system. Northern system. 3846 667 802 151 *744-45 . . 3847 745-46 3848 746-47 5 Sravana . 3849 747-48 . . 3850 *748-49 3851 749-50 2 Vaisakha. 3852 . . . . . . . . 750-51 751-52 *752-53 . . 3853 10 Pausha 3854 3856 753-54 . . 3856 754-55 7 Aevina 3857 755-56 3858 *756-57 17 Subhanu . 18 Tarana 19 Parthiva. 20 Vyaya . 21 Sarvajit . 22 Sarvadharin 23 Virodhin . 24 Viktita . 26 Khara . 26 Nandana . 27 Vijaya . 28 Jaya . 29 Manmatha 30 Durmukha 31 Hemalamba 32 Vilamba . 33 Vikarin . 34 Sarvarini 35 Plava 36 Bubbakrit 37 Sobhana. 38 Krodhin. 39 Visvavasu. 40 Parabhava 41 Plavanga . 3859 757-58 4 Ashadha. . . . . . . . . . . 3860 758-59 3861 759-60 12 Phalguna. 3862 *760-61 3863 761-62 3864 9 Margasira. 762-63 763-64 3865 3866 *784-65 . . . . . . 3867 765-66 6 Sravana. 3868 766-67 3869 787-68 . . . . 3870 *768-69 2 Vaisakha.
Page #70
--------------------------------------------------------------------------
________________ No. 6.] LXXVI-Contd. Day and month, A.D. 13 MEAN SOLAR YEAR. 22 Mar. (82). 22 Mar. (81). 23 Mar. (82). 23 Mar. (82). 22 Mar. (82). 22 Mar. (81). 23 Mar. (82). 23 Mar. (82). 22 Mar. (82). 22 Mar. (81). 23 Mar. (82). 23 Mar. (82). 22 Mar. (82). 22 Mar. (81). 23 Mar. (82). 23 Mar. (82). 22 Mar. (82). 23 Mar. (82). 23 Mar. (82). 23 Mar. (82). 22 Mar. (82). 23 Mar. (82). 23 Mar (82). 23 Mar. (82). 22 Mar. (82). . . . THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. * COMMENCEMENT OF THE Week-day. 14 1 Sun. 2 Mon. 4 Wed. 5 Thur. 6 Fri. 0 Sat. 2 Mon. 3 Tues. 4 Wed. 5 Thur. 0 Sat. 1 Sun. 2 Mon. 3 Tues. 5 Thur. 6 Fri. 0 Sat. 2 Mon. 3 Tues. 4 Wed. 5 Thur. 0 Sat. 1 Sun. 2 Mon. * 3 Tues. . * . . . " . . * * . . . . Time of mean Meshasamkranti. H. M. S. 15 2 30 21 15 0 3 27 30 9 40 0 95 17 15 52 30 22 5 0 4 17 30 10 30 0 16 42 30 22 55 0 13 5 7 30 11 20 0 17 32 30 23 45 0 5 57 30 12 10 0 18 22 30 0 35 0 6 47 30 0 0 19 12 30 1 25 0 7 57 30 13 50 0 20 MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Day and month, A.D. 19 19 Mar. (79) 8 Mar. (67) 26 Feb. (57) 17 Mar. (76) 5 Mar. (65) 22 Feb. (53) 13 Mar. (72) 3 Mar. (62) 20 Mar. (80) 10 Mar. (69) 27 Feb. (58) 18 Mar. (77) 6 Mar. (66) 24 Feb. (55) 15 Mar. (74) 4 Mar. (63) 22 Mar. (82) 11 Mar. (70) 1 Mar. (60) 20 Mar. (79) 8 Mar. (68) 25 Feb. (56) 16 Mar. (75) 6 Mar. (65) 2 30 23 Feb. (54) . * . . . " 1 Arya Siddhanta, mean system. Week-day. 20 5 Thur. 2 Mon. 0 Sat. 6 Fri. 3 Tues. 0 Sat. 6 Fri. 4 Wed. 2 Mon. 0 Sat. 4 Wed. 3 Tues. 0 Sat. 5 Thur. 4 Wed. 1 Sun. 0 Sat. 4 Wed. 2 Mon. 1 Sun. 5 Thur. 2 Mon. Sun 6 Fri 3 Tues. + a (here==t, the index of the tithi). 23 188-5957 64-2790 278-5944 313-2341 188-9173 64-6007 99-2404 313-5556 9-5633 223-8786 99-5620 134-2016 9.8850 224-2003 258-8399 134-5233 169.1628 44-8463 259-1616 293-8012 169-4846 45-1680 79-8076 294-1228 169-8062 Kali year. 3846 3847 3848 3849 3850 3851 3852 3853 3854 47 3855 3856 3857 3858 3850 3860 3861 3862 3863 3864 3865 3866 3867 3868 3869 3870
Page #71
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [Vol. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Mean Intorcalated (adhika) lunar month. Kollam. A.D. Chaitradi Vikrams. Meshadi solar year in Bengal. Southern system. Northern system. 2 769-70 . 3871 3872 770-71 . 10 Pausla . 42 Kilaka . 43 Saumya. 44 Sidharana 45 Virodhakrit 771-72 *772-73 773-74 774-75 46 Paridhavin 7 Asvina . 3876 47 Pramadin 3877 775-76 . . 3878 *776-77 3 Jyeshtha. 3879 777-78 778-79 3880 12 Pla Iguna. 3881 779.80 . . . . *780-81 3882 3883 781-82 8 Kurttika 3884 782-83 3885 . . 48 Ananda . . 49 Rakshasa . . 50 Anala . . 51 Pingala . . 52 Kalayukta . 53 Siddharthin . 54 Raudra . . 55 Durmati . . 56 Dundubhi . 57 Rudhirodgarin . 58 Raktaksha 59 Krodhana , 60 Kshaya. . 1 Prabhava . . 2 Vibhava . . 3 Sukla . . 4 Pranioda. . 5 Prajapati . . 6 Angiras. . 5 Sravana 3886 3887 3888 . 783-84 *784-85 785-86 786-87 3889 787-88 . 1 Chaitra 3890 3891 *788-89 789-90 10 Pausha . 3892 790-91 791-92 3893 3894 3895 . . . . 199 +792-93 7 Asvinat 200 793-94 By the Indian Calendar" 6 Bhadrapada was intercalated.
Page #72
--------------------------------------------------------------------------
________________ No. 6.] LXXVI-Contd. Day and month, A.D. 13 MEAN SOLAR YEAR. 23 Mar. (82). 23 Mar. (82). 23 Mar. (82). 22 Mar. (82). 23 Mar. (82). 23 Mar. (82). 23 Mar. (82). 22 Mar. (82). 23 Mar. (82). 23 Mar. (82). 23 Mar. (82). 22 Mar. (82). 23 Mar. (82). 23 Mar. (82). 23 Mar. (82). 22 Mar. (82). 23 Max (82). 23 Mar. (82). 23 Mar. (82). 23 Mar. (83). 23 Mar. (82). 23 Mar. (82). 23 Mar. (82). 23 Mar. (83). 23 Mar. (82). . THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. . COMMENCEMENT OF THE Week-day. 14 5 Thur. 6 Fri. 0 Sat. 1 Sun. 3 Tues. 4 Wed. 5 Thur. 6 Fri. 1 Sun. 2 Mon. 3 Tues. 4 Wed. 6 Fri. 0 Sat. 1 Sun. 2 Mon. 4 Wed. 5 Thur. Fri. 1 Sun. 2 Mon. 3 Tues. 4 Wed. 6 Fri. 0 Sat. * . * . * * . * * Time of mean Mesha Day and month, A.D. samkranti. 17 H. M. S. 2 15 0 8 27 30 14 40 0 2 2 2 2 2 2 2 13 Mar. (72) 2 Mar. (61) 21 Mar. (80) 20 52 30 10 Mar. (70) 3 5 0 27 Feb. (58) 9 17 30 18 Mar. (77) 7 Mar. (66) 25 Feb. (56) 14 Mar. (73) 7 30 4 Mar. (63) 16 20 23 Mar. (82) 11 Mar. (71) 28 Feb. (59) 19 Mar. (78) 9 Mar. (68) 26 Feb. (57) 16 Mar. (75) 5 Mar. (64) 15 30 0 21 42 30 A 3 55 10 22 32 30 4 45 0 10 57 30 17 10 89% 23 22 30 5 35 0 11 47 30 18 0 0 0 1 0 12 30 6 25 0 12 37 30 18 50 0 7 15 MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). 23 Feb. (54) 13 Mar. (73) 2 Mar. (61) 21 Mar. (80) 10 Mar. (69) 2 30 28 Fsb. (59) 0 17 Mar. (76) 19 . . . * * . * . . 1 Arya Siddhanta, mean system. Week-day. 20 2 Mon. 6 Fri. 5 Thur. 3 Tues. 0 Sat. 6 Fri. 3 Tues. 1 Sun. 6 Fri. 4 Wed. 3 Tues. 0 Sat. 4 Wed. 3 Tues. 1 Sun. 5 Thuy 4 Wed. 1 Sun. 6 Fri. 5 Thur. 2 Mon. 1 Sun. 5 Thur. 3 Tues. 1 Sun. . . . . . a (here-t, the index of the tithi). 23 204-4459 80-1292 114-7688 329-0841 204-7675 239-4071 115-0904 329-4057 25-4134 239-7288 274-3682 150:0517 25-7351 60-3747 274-6900 150-3734 185-0130 60-6963 276-0116 309-6513 185-3346 219-9743 95-6576 309-9730 5-9807 49 Kali year. 3871 3872 3873 3874 3875 3876 3877 3878 3879 3880 3881 3889 3883 3884 3885 3886 3887 3888 3889 3890 3891 3892 3893 3894 3895
Page #73
--------------------------------------------------------------------------
________________ 50 Kali. Saka. IN co Chaitradi Vikrama. Meshadi solar year n Bengal. 741 3a 3896 717 852 201 3897 718 853 202 3898 719 854 203 3899 720 855 204 3900 721 856 205 3901 722 857 206 3902 723 858 207 3903 724 859 208 3904 725 860 209 3905 728 861 210 3906 727 862 211 3907 728 863 212 8908 729 864 213 3909 730 865 214 3910 731 888 215 3011 732 887 216 3912 733 868 217 3913 734 869 218 3914 735 870 219 3915 736 871 220 3916 737 872 221 3917 738 873 222 3918 739 874 223 3919 740 875 224 3930 876 225 CONCURRENT YEAR. Kollam. EPIGRAPHIA INDICA. 4 A.D. 5 794-95 795-96 *796-97 797-98 798-99 799-800 *800-01 801-02 802-03 803-04 *804-05 805-06 806-07 807-08 *808-09 809-10 810-11 811-12 *812-13 813-14 814-15 815-16 *816-17 817-18 818-19 JOVIAN SAMVATSABA. Southern system. 6 Northern system. 7 Srimukha. 8 Bhava 9 Yuvan 10 Dhatri 11 Isvara 12 Bahudhanya 13 Pramathin 14 Vikrama 15 Vrisha 16 Chitrabhanu 17 Subhanu 18 Tarana 19 Parthiva 20 Vyaya 21 Sarvajit 22 Sarvadharin 23 Virodhin 24 Vikrita 25 Khara 28 Nandana 27 Vijaya 28 Jaya 29 Manmathe 30 Durmukhs 31 Hemalamba + 7 * [VOL. XVII TABLE Mean Intercalated (adhika) lunar month. 8a 3 Jyeshtha 12 Phalguna 8 Karttika 5 Sravana 1 Chaitra 10 Pausha 6 Bhadrapada. 3 Jyeshtha 11 Magha
Page #74
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. LXXVI-Contd. 1 Arya Siddhanta, mean system. COMMENCEMENT OF THE MBAN SOLAR YRAR. MEAN LUNI-SOLAR. YMAR (MRAN SUNRISE OY CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Kali you. Day and month. A.D. Time of Day and month, Week-day. mean Mesha Day and month, " A.D. samkranti. Week-day, a (here=l, the index of the tithi). 13 17 19 20 220-2959 3896 95-9793 3897 130-6189 3898 6-3023 3899 40-9419 3900 3901 256-2572 130-9406 3902 166-5802 3903 41.2636 3904, 39403 265-5789 290-2185 3906 3907 23 Mar. (82) . 23 Mar. (82) . 23 Mar. (83) 23 Mar. (82) . 23 Mar. (82) . 23 Mar. (82) . 23 Mar. (83) . 23 Mar. (82) 23 Mar. (82) . 23 Mar. (82) . 23 Mar. (83) 23 Mar. (82) . 23 Mar. (82) 23 Mar. (82) . 23 Mar. (83) . 23 Mar. (82 23 Mar. (82) 23 Mar. (82) 23 Mar. (83) 23 Mar. (82) . 23 Mac (82) 23 Mar. (82) 23 Mar. (83). 23 Mar. (82) . 23 Mar. (82) . H. M. s. . 1 Sun. 13 27 30 7 Mar. (86) . 2 Mon. . 1940 0 24 Feb. (56) 4 Wed. I 62 30 14 Mar. (74) . 5 Thur.. 8 5 0 3 Mar. (62) . 8 Fri. . 14 30 22 Mar. (81) . 0 Sat. . 20 12 Mar. (71) . 2 Mon. . 29 Feb. (60) 3 Tues.. 8 19 Mar. (78) . 4 Wed.. 16 7 308 Mar. (67) . 5 Thur.. 21 20 0 26 Feb. (57) O Sat. 3 32 30 16 Mar. (76) . 1 Sun. 45 0 5 Mar (84) . 2 Mon. . 15 22 Feb. (53) . 3 Tues.. 10 013 Mar. (72) . 5 Thur.. 4 22 30 2 Mar. (62) 6 Fri. . 10 35 021 Mar. (80) O Sat. 16 30 10 Mar. (69) 1 Sun. 23 0 0 27 Feb. (58) 3 Tues. . 5 12 30 17 Mar. (77) . 4 Wed.. 11 25 0 7 Mar. (66) . 6 Thur.. 17 37 3024 Feb. (55) 0 15 Mar. (74) 1 Sun. . 6 2 30 3 Mar. (63) 2 Mon.. 12 16 0 22 Mar. (84) . 3 Tues.. 18 27 30 11 Mar (10) o Fri. . 3 Tues. . 2 Mon.. Fri. 5 Thur.. 3 Tues. . To Sat. 6 Fri. 3 Tues. 1 Sun. 0 Sat. 4 Wod. 1 Sun. 0 Sat. 5 Thur. 4 Wed. 1 Sun. .Thur. 4 Wed. . 2 Mon. . 6 Pri. 5 Thur. 2 Mon. . 1 Sun. 5 Thur. 165-9018 41-5852 57 30 3908 76-2248 290-5401 325-1798 200-8631 76-8486 3909 3910 3911 3913 3913 3014 3916 3916 3911 3918 111.1862 326-5013 201-1847 236-8244 111.5078 146-1473 3919 21-8307 3990 Q 2
Page #75
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [Vol. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Mean Intercalated (adhika) lunar month. Kali Saks Chaitradi Vikrama. Kollam. A.D. Southern system. Northern system. 3021 819-20 8 Karttika 3922 *820-21 . . 3923 821-22 s 3924 822-23 4 Ashadha. 32 Vilambat. 34 Sarvarin . 35 Plava 38 subhaksit . 37 Sobhana. 38 Krodhin. 39 Visvavasu 40 Parabhava . . 3925 823-24 *824-25 3926 3927 1 Chaitra 825-26 826-27 3928 3929 41 Plavanga 10 Pausba reat 827-28 *828-29 42 Kilaka . . . 3930 8931 829-30 . . 43 Saumya . 44 Sadharana 46 Virddhakrit . . 3932 830-31 831-32 6 Bhadrapada. 3933 3934 *832-33 46 Paridhavin 3935 833-34 3 Jyeshtha . g . . 9.10 3936 3937 3938 10-11 11 Magha . 11-12 834-35 -835-36 *836-37 837-38 838-30 . 8939 12-13 3940 47 Pramidin . 48 Ananda. 49 Rakshasa . . 50 Anals . . 61 Pingala . . 62 Kalayukta . 53 Siddharthin . 8 Raudrs . . 66 Durmati . . 56 Dundubhi 67 Rudhirddgarin. 13-14 14-16 8 Kirttika 9041 839-40 *840-41 16-18 16-17 17-18 . . 4 Ashludha 3942 3943 3944 3948 a 841-42 842-43 843-44 18-19 . By both nine and true systems 33 Vikarin was expanged.
Page #76
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. LXXVI-Contd. 1 Arya Siddhanta, mean system. COMMENCEMENT OF THE MEAN SOLAB YEAR. MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Kali year. Day and Month, A.D. Time of Week-day. mean Mesha samkranti. Day and month, A. D. Week-day. a (here=1, the index of the tithi). 13 14 19 23 236.1460 3921 3922 2 Mon. 270-7856 6 Fri. 146-4690 3923 3924 1 Sun. 22-1524 3 Tues. 2 Mon. 56-7920 3925 . . O Sat. 271.1073 3926 146.7906 3927 . 1814303 3928 57.1137 3929 . . 91-7533 3930 306-0686 3931 . 181.7519 24 Mar. (83) 23 Mar. (83) . 23 Mar. (82) . 23 Mar. (82) . 24 Mar. (83) 23 Mar. (83) 23 Mar. (82). 23 Mar. (82) 24 Mar. (83) 23 Mar. (83). 23 Mar (82) 23 Mar. (82) 24 Mar. (83). 23 Mar. (83). 23 Mar. (82) 23 Mar. (82) . 24 Mar. (83) 23 Mar. (83) 23 Mar. (82) . 23 Mar. (82) . 24 Mar. (83). 23 Mar. (83) . 23 Mar. (82) . 23 Mar. (82) 24 Mar (83) 4 Wed. 3.Tues. O Sat. . 6 Fri. . 4 Wed. 1 Sun. O Sat. 4 Wed.. 2 Mon. O Sat. 3932 6 Thur. . 6 Fri. . O Sat . 3 Tues. 4 Wed. . 5 Thur. . 6 Fri. 1 Sun. 2 Mon. 3 Tues. . 4 Wed. 1 . O Sat. . 1 Sun. . 1 2 Mon. Wed. 5 Thur . 6 Fri. . O Sat . 2 Mon . 3 Taes. . 4 Wed. 5 Thus. . O Sat. H. M. S. 040 0 1 Mar. (60) 6 52 30 19 Mar. (79) 13 6 0 8 Mar. (67) 19 17 30 25 Feb. (56) 16 Mar. (75) 7 12 30 Mar. (65) 13 55 0 22 Feb. (53) 20 7 80 13 Mar. (72) 2 Mar. (61) 8 32 30 20 Mar. (80) 14 450 10 Mar. (69) 20 30 27 Feb. (58) 0 18 Mar. (77) 22 30 6 Mar. (66) 15 35 0 24 Feb. (55) 21 47 30 14 Mar. (73) 0 4 Mar. (63) 12 30 22 Mar. (82) 0 11 Mar. (70) 22 30 28 Feb. (59) 0 19 Mar. (78) 30 8 Mar. (68) 17 15 0 25 Feb. (56) 23 17 30 16 Mar. (75) 06 Max. (64) 216-3916 3933 92.0749 3934 306-3902 3935 . 2.3979 3936 . 216-7132 3937 5 Thur. 4 Wed. . . 251-3528 3938 1 Sun. 127.0362 3939 . 2.7176 3940 5 Thur. 4 Wed. . . 37-3592 3941 . 251-6745 3942 2 Mon. 6 Fri. 3948 . . . 127-3579 161-9975 5 Thur. 3944 2 Mon. 37-6809 3945
Page #77
--------------------------------------------------------------------------
________________ 34 Kali. Saka. 1 2 3961 Vikrama. co Chaitradi 3 solar year 905 in Bengal. Meshadi 767 902 251 768 903 252 769 904 253 906 Za 3946 3947 3948 3949 770 3950 771 255 23-24 772 3951 907 256 3952 773 908 257 25-26 3953 774 909 258 3954 775 910 259 3955 776 911 260 3956 777 912 35-36 261 3957 778 913 262 3958 779 914 263 3959 780 915 264 3960 781 916 205 782 917 3962 783 918 267 3963 784 919 268 3064 785 920 269 3965 786 921 270 3966 787 922 271 39-40 3967 788 923 272 40-41 3968 789 924 273 3909 790 925 274 42-43 3970 791 926 275 43-44 36-37 37-38 38-39 41-42 CONCURRENT YEAR. Kollam. 266 19-20 20-21 21-22 254 22-23 EPIGRAPHIA INDICA. 24-25 34-35 A.D. 5 846-47 847-48 -*848-49 849-50 850-51 26-27 851-52 27-28 #852-53 28-29 853-54 29-30 854-55 30-31 855-56 31-32 *856-57 32-33 857-58 33-34 858-59 859-60 #860-61 *844-45 845-46 861-62 862-63 863-64 *864-65 865-66 866-67 867-68 *868-69 JOVIAN SAMVATSABA. Southern system. Northern system. 58 Raktaksha 59 Krodhana. 60 Kahaya 1 Prabhava. 2 Vibhava 3 Sukla 4 Pramoda 5 Prajapati. 6 Angiras 7 Srimukha 8 Bhava 9 Yuvan 10 Dhatri 11 Ievara 12 Bahudhanya 13 Pramathin. 14 Vikrame 15 Vrisha 16 Chitrabhanu 17 Subhanu 18 Tarana 19 Parthive 20 Vyaya 21 Sarvajit 22 Sarvadharin 7 + By the "Indian Calendar" 5 Sravana was intercalated. * [VOL. XVII. TABLE Mean Intercalated (adhika) lunar month. 8a 1 Chaitra 9 Margaeira 6 Bhadrapada. 2 Vaisakha 11 Magha 7 Aevin 4 Ashadha 12 Phalguna 9 Margadira 6 Bhadrapada.
Page #78
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. LXXVI-Oontd. 1 Arya Siddhanta, mean system. COMMENCEMENT OF THE MEAN SOLAR YRAR. MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDB). Kali year. Day and month, A.D. Time of Week-day. mean Mesha. Day samkranti. DOBA, A.D. Week-day. (here=1, the index of the tithi). 14 17 19 20 23 Sat. Fri. 281-9960 288-6357 Mar. (81) 102-3191 3046 3947 3948 3949 3960 190-9588 72-8421 286-9573 3961 321-6970 3962 3203 197.2803 72-9637 107.6033 2 Mon.. 6 Fri. 4 Wed.. 3 Tues.. Bat. . . 4 Wed.. 3 Tues. . 1 Sun. . 8 Pri. . 4 Wed.. 1 Sun. . 3804 3958 321-9188 3958 23 Mar. (83) . 23 Max. (82) . 24 Mar. (83) . 24 Mar. (83) . 23 Mar. (83) 23 Mar. (82) . 24 Mar. (83) 24 Mar. (83) 23 Mar. (83) . 23 Mar. (82) . 24 Mar. (83) 24 Mar. (83) . 23 Mar. (83) . 23 Mar. (82) 24 Mar. (83) . 24 Mar. (83) . 23 Mar. (83) . 23 Mar. (82) . 24 Mar. (83). 24 Mar. (83). 23 Mar. (83) 23 Mar (82). 24 Mar. (83) 24 Mar. (83) . 23 Mar. (83) 3967 H.M.S. . 1 Sun. . 1 62 23 Feb. (84) . 2 Mon. . 18 13 Mar. (72) . 4 Wed.. o . 6 Thur.. 8 0 21 Mar. (80) 30 9 Mar. (69) . 0 Sat. 18 0 27 Feb. (18) . 2 Mon. . i 7 30 18 Mar. (77) 3 Tues. . 1 7 20 0 7 Mar. (68) 4 Wed.. 18 30 24 Feb. (56) . 8 Thur.. 19 0 14 Mar. (73) O Sat. 304 Mar. (63) . 1 Sun. . 8 22 Mar. (81) . 2 Mon. . 14 22 3011 Mar. (71) 3 Tues. . 20 25 0 28 Feb. (59) . 5 Thur.. 2 47 30 19 Mar. (78) . 8 Fri 9008 Mar. (87) . 0 Sat. 16 30 26 Feb. (57) . 28 0 16 Mar. (76) . 3 Tues. 3 37 30 5 Mar. (64) 4 Wed.. 9 60 024 Mar. (83) 8 Thur.. 16 2 3012 Mar. (72) 6 Fri. . 12 2 Mar. (61) 1 Sun. 4 27 30 | 21 Mar. (80) . 2 Mon.. 10 40 0 10 Mar. (80) . 3 Tuos. . 16 52 30 27 Feb. (88) 17-9263 232-2416 3988 3969 107-9250 3980 142-5646 18-2480 232-5683 287-2020 112-8863 177-5269 4 Wod. . 2 Mon. . 1 8 . . Thur.. . Wed. 1 Sun. 6 Pr. Thur. Mon. Pr. 3981 3982 3968 3004 3968 3900 68-2003 267-6246 3907 303-1642 3908 177-8470 8000 62-6800 8970
Page #79
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SARVATSARA. Mean Intercalated (adhika) lunar month. Kali Chaitradi Vikrama. Kollam. A.D. Moshadi solar year in Bengal. 1&1 Mod Southern system. Northern system. 1 . 80 8971 44-45 869-70 8972 45-46 870-71 . . 3973 46-47 871-72 . 2 Vaibakha. 2974 47-48 *872-73 3976 873-74 aya . 11 Maghs . 3976 874-76 . . 3977 48-49 49-50 50-51 51-52 52-63 8978 875-76 *876-77 877-78 . 7 Asving 3979 3980 878-79 53-54 54-55 . . . . 3981 879-80 4 Abbadha. 3982 56-56 *880-81 8983 56-87 881-82 23 Virddhin 24 Vikrita . 25 Khara . 26 Nandana. 27 Vijays 28 Jays . 29 Manmatha 30 Durmukha 31 Hemalamba 32 Vilamba . 33 Vikarin . 34 Sarvarin. 36 Plava 38 Subhakrit 37 Sobhana. 38 Krodhin. 39 Visvavasu. 40 Parabbava 41 Playanga. 42 Kilaks . 43 Seumye . 44 Sidbaras 46 Virddhakrit 46 Paridhivin 47 Pramadin : 12 Pholguna. 8984 57-58 882-83 3985 3986 883-84 *884-86 885-86 . 58-59 59-60 60-61 61-62 9 Margskirs. 8987 3988 3989 62-63 5 Sravana . 886-87 887-88 *888-89 889-90 63-64 3900 1991 64-65 . . 3992 800-91 2 Vaibakhe 3993 65-66 66-67 67-68 88-89 3994 891-92 *892-93 893-94 . . 10 Pausbs 3995 S
Page #80
--------------------------------------------------------------------------
________________ No. 6.) THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. LXXVI-contd. 1 Arya Siddhanta, mean system. COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA I ENDS). Kali year.) Day and month, A.D. Time of Week-day. mean Meaba samkranti. Day and month, A.D. Week-day. a (heret, the index of the tithi). 13 17 19 20 123 3971 3972 88-1705 302-4858 178-1692 212-8088 . 3973 3974 . . . . . . . . 88-4922 3975 123-1318 3976 9998-81517 3977 . . . 213-1304 3978 247-7700 3979 3980 123-4535 9999-13687 5 Thur.. 3 Tues. O Sat. 6 Fri. 3 Tues. 2 Mon. 6 Fri. 4 Wed. 3 Tues. Sat. 4 Wed. 3 Tues. 1 Sun. 0 Sat. 4 Wod. 1 Sun. O Sat. 5 Thur. 2 Mon. 3981 23 Mar. (82) 24 Mar. (83) . 24 Mar. (83) . 23 Mar. (83) . 23 Mar. (82) . 24 Mar. (83) . 24 Mar. (83) . 23 Mar. (83) . 24 Mar. (83) 24 Mar. (83) 24 Mar. (83) . 23 Mar. (83) . 24 Mar. (83) . 24 Mar. (83) 24 Mar. (83) . 23 Mar. (83) 24 Mar. (83) 24 Mar. (83) . 24 Mar. (83) 23 Mar. (83) . 24 Mar. (83). 24 Mar. (83) . 24 Mar. (83) . 23 Mar. (83) . 24 Mar. (83) . . . . . 3982 H. M. S. 4 Wed.. 23 5 0 17 Mar. (76) 6 Fri. 5 17 30 7 Mar. (66) 0 Sat. 11 300 24 Feb. (55) 1 Sun. 17 42 3014 Mar. (74) 2 Mon.. 23 55 0 3 Mar. (62) 4 Wed.. 6 7 30 22 Mar. (81) 5 Thur.. 12 0 11 Mar. (70) 6 Fri. 18 29 Feb. (60) 1 Sun. 45 0 19 Mar. (78) 2 Mon. . 6 308 Mar. (67) 3 Tues. 13 025 Feb. (56) 4 Wed.. 3015 Mar. (75) 6 Fri. . 05 Mar. (64) O Sat. 1 3024 Mar. (83) 1 Sun. 14 013 Mar. (72) 2 Mon. . 301 Mar. (61) 4 Wed. 2 25 020 Mar (79) 5 Thur. . 8 37 3010 Mar. (69) 6 Fri. . 14 50 0 27 Feb. (58) 0 Sat. 212 30 17 Mar. (77) 2 Mon.. 3 15 0 6 Mar. (65) 3 Tues.. 9 27 30 24 Feb. (55) 4 Wed.. 15 40 0 15 Mar. (74) 5 Thur.. 21 52 30 | 3 Mar. (63) O Sat. . 4 5 0 22 Mar. (81) 33-7764 248-6917 3983 282-7313 3984 . 3985 158-4147 34-0980 3986 68-7377 3987 . . 283-0530 3888 158-7364 3989 1 Sun. 193-3760 3990 . 3991 . . . . 69-0594 283-3746 3992 5 Thur. 3 Tues. 2 Mon. 6 Fri. 5 Thur:. 318-0143 3993 193-6976 3994 . 228-3372 3995 + As a mean tithi Chaitra bukla 1 was suppressed. the mean luni-soler year, was as given in cols. 19, 20. The civil day corresponding to it, 1.c., the first day of
Page #81
--------------------------------------------------------------------------
________________ 58 EPIGRAPHIA INDICA. [VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kollam. Mean Intercalated (adhika) lunar month. A.D. Ksu. Saka. Meshadi solar year in Bengal. Chaitradi Vikramas. Southern system. Northern system. 3996 69-70 3997 70-71 7 Abvins . 3998 71-72 3999 72-73 4000 73-74 3 Jyeshtha. 4001 74-75 4002 75-76 12 Phalguna 4003 4004 76-77 77-78 78-79 79-80 4005 9 Margasira. 4006 80-8L 4007 4008 81-82 894-95 48 Ananda . . 895-98 49 Rakshaas . . *896-97 50 Anala . . . 897-98 61 Pingals . . 898-99 62 Kalayukta 899.900 63 Siddharthin . * 900-01 54 Raudra . . 901-02 55 Durmati . . . 902-03 56 Dundubhi 903-04 67 Rudhirddgarin. *904-05 68 Raktakshat 905-06 59 Krodhana . 60 Kshaya 906-0760 Kshayat . 1 Prabhava 907-08 1 Prabhava 2 Vibhava *908-09 2 Vibhava 3 sukla 909-10 3 Sukla 4 Pramods 910-11 4 Pramods 6 Prajapati 911-12 6 Prajapati 8 Angiras *912-13 6 Angiras 7 Srimukha 913-14 7 Srimukha 1 8 Bhava 914-15 8 Bhava 9 Yuvan 915-16 9 Yuvan. . 10 Dhatci *916-17 | 10 Dhatri. 11 Isvara. 917-18 11 Isvara. 12 Bahudbanya. 018-19 12 Bahudhanya . 13 Pramathin . 6 Sravana . 4009 82-83 4010 83-84 4011 84-85 | 2 Vaisakha . 4012 4013 10 Pausha . 4014 4015 85-86 86-87 87-88 88-89 89-90 90-91 91-92 02-93 4016 7 Asvins 4017 4018 4019 3 Jycshtha. 4020 29593 193.04 By the mean system 59 Krodhann was expunged; by the true system 60 Kshaya was the expunged sain. atsars and the year A.D. 905-6 was called "Krodhana." t By southern rookoning there was no suppression after this year $ By the "Indian Calendar" 8 Karttiks vw intercalated.
Page #82
--------------------------------------------------------------------------
________________ No. 6.] LXXVI-contd.. Day and month, A.D. 13 MEAN SOLAR YEAR. 24 Mar. (83). 24 Mar. (83) 23 Mar. (83). 24 Mar. (83). 24 Mar. (83) 24 Mar. (83). 23 Mar. (83) 24 Mar. (83). 24 Mar.. (83). 24 Mar. (83) 24 Mar. (84). 24 Mar. (83). 24 Mar. (83). 24 Mar. (83). 24 Mar. (84) 24 Mar. (83). 24 Mar. (83) 24 Mar. (83). 24 Mar. (84) 24 Mar. (83). 24 Mar. (83) 24 Mar. (83). 24 Mar. (84) 24 Mar. (83). 24 Mar. (83). . . . THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. . * Week-day. 14 1 Sun. 2 Mon. 3 Tues. 5 Thur. 6 Fri. 0 Sat. 1 Sun 3 Tues. 4 Wed. 5 Thur. 0 Sat. 1 Sun. 2 Mon. 3 Tues. 5 Thur. 6 Fri. COMMENCEMENT OF THE 0 Sat. 1 Sun. 3 Tues. 4 Wed. 5 Thur. 6 Fri. 1 Sun. 2 Mon. 3 Tues. * " " . . * Time of mean Meshasamkranti. H. 10 17 30 16 30 22 42 30 4 55 17 2. M. S. 19 6 35 12 47 2 d : % 0 0 7 30 11 17 20 0 16 Mar. (75) 23 32 30 4 Mar. (64) 0 23 Mar. (82) 5 45 11 57 30 13 Mar. (72) 18 10 0 2 Mar. (61) 0 22 30 20 Mar. (80) 0 9 Mar. (68) 30 27 Feb. (58) 18 Mar. (77) 0 0 1 12 30 6 Mar. (66) 7 25 0 23 Feb. (54) 13 37 30 14 Mar. (73) 19 50 0 4 Mar. (63) 2 30 21 Mar. (81) 11 Mar. (70) 8 15 0 14 27 30 28 Feb. (59) 20 40 0 19 Mar. (78) 2 52 30 7 Mar. (67) 9 5 0 25 Feb. (56) 15 17 30 16 Mar. (75) 8 MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Day and month, A. D. 19 11 Mar. (70) 1 Mar. (60) 18 Mar. (78) 8 Mar. (67) 25 Feb. (56) . 1 Arya Siddhanta, mean system. Week-day. 20 2 Mon. 0 Sat. 5 Thur. 3 Tues. 0 Sat. 6 Fri. 3 Tues. 2 Mon. 0 Sat. 4 Wed. 3 Tues. 0 Sat. 5 Thur. 4 Wed. 1 Sun. 5 Thur. 4 Wed. 2 Mon. 0 Sat. 5 Thur. 2 Mon. 1 Sun. 5 Thur. 3 Tues. 2 Mon. . " a (here=t, the index of the tithi). 23 104.0206 318-3359 14.3436 228-6589 104-3423 138-9819 14.6653 49-3049 263-6202 139-3034 173-9431 49-6264 263-9418 298-5814 174-2647 49-9481 84-5878 298-9030 9994-9109+ 209-2259 84-9093 119.5490 9995-2324+ 209-5476 244.1872 Kali year. 3996 3997 3998 3999 4000 4001 4002 4003 4004 4005 4006 4007 4008 4009 4010 4011 4012 4013 4014 4015 4016 4017 59 4018 4019 4020 + As a mean tithi Chaitra Sukla 1 was suppressed. The civil day corresponding to it, i.e, the first dry of the luni-solar year was as given in cols. 19, 20. H 2
Page #83
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [VOL. XVI. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Mean Intercalated (adhika) lunar month. Saka Chaitridi Vikrama. Moshadi solar year Kollam. A.D. Southern system. Northern system. 4021 4022 94-95 95-96 96-97 4023 4024 4025 4026 4027 4028 333 4029 4030 97-98 98-99 99-00 100-01 101-02 102-03 103-04 104-05 105-06 106-07 107-08 108-09 109-10 4031 4032 4033 919-20 13 Pramathin . 14 Vikrama 12 Phalguna. *920-21 14 Vikrama : 15 Vpishs. 921-22 15 Vrisha. 16 Chitrabhanu . 922-23 16 Chitrabhanu. 17 Subbanu 8 Kirttika 923-24 17 Subhanu 18 Tarana . . *924-25 18 Tarana . . 19 Parthiva . 925-26 19 Parthiva . 20 Vyaya . 5 Sravana 926-27 20 Vyaya . . 21 Sarvajit. . 927-28 21 Sarvajit .22 Sarvadharin. +928-29 22 Sarvadharin. 23 Virodhin 1 Chaitra 929-30 23 Virodhin 24 Vikrita. 930-31 24 Vikrita . . 25 Khara. 10 Pausha . 931-32 25 Khara . . 26 Nandana *932-33 26 Nandana 27 Vijaya . . 933-34 27 Vijaya . . 28 Jaya . I 6 Bhadrapada 934-35 28 Jaya . . 29 Manmatha. 935-36 29 Manmaths .30 Durmukha *936-37 30 Durmukha . 31 Hemalambs. 3 Jyeshtbs. 937-38 31 Hemalambs. 32 Vilamba .. 938-39 32 Vilamba . ! 33 Vikarin 11 Magha 939-40 33 Vikarin 34 Barvarin *940-41 34 Sarvarin 35 Plava. . 941-42 35 Plava . . 36 Subhakrit 8 Karttiks 942-43 38 Subhaksit 37 Sobhana 943-44 37 Sobhans . 38 Krodhin 4034 4035 4036 4037 110-11 4038 111-12 4039 112-13 113-14 4040 4041 114-16 4042 115-16 4043 4044 116-17 117-18 118-19 4045 360
Page #84
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. LXXVI-contd. 1 Arya Siddhanta, mean system. COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-SOLAR YEAR (NEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA I ENDS). Kali yeur. Day and month, A.D. Time of Week-day. mean Mesha Day and month, A.D. samkranti. a (here=t, Woek-day. the of the tithi). 13 17 19 2023 119-8706 4021 164-5102 4022 30-1936 4023 244-6089 4024 . 6 Fr. Thur. 2 Mon. Sat. . 6 Fri. 3 Tues. Sat. 8 Fri. .4 Wed. 279-1485 4025 164.8319 4026 30-5163 4027 65-1549 4028 279-4701 4029 155-1535 4030 189-7932 4031 65-4765 4032 24 Mar. (83) . 24 Mar. (84) . 24 Mar. (83) 24 Mar. (83) 24 Mar. (83) 24 Mar. (84) 24 Mar. (83) 24 Mar. (83) 24 Mar. (83) 24 Mar. (84) 24 Mar. (83).. 24 Mar. (83) 25 Mar. (84) 24 Mar. (84) . 24 Mar. (83) . 24 Mar. (83) . 25 Mar. (84) 24 Mar. (84) 24 Mar. (83) 24 Mar. (83) 25 Mar. (84) 24 Mar. (84) 24 Mar. (83) 24 Mar. (83). 25 Mar. (84). H.M.S. 4 Wed.. 21 30 0 6 Mar. (64) . 6 Fri. . 3 42 30 | 23 Mar. (83) O Sat. . 9 55 0 12 Mar. (71) 1 Sun. 18 7 30 2 Mar. (61) 2 Mon. 20 0 21 Mar. (80) . 4 Wed. 32 30 9 Mar. (69) 6 Thur.. 10 026 Feb. (57) 6 Fri. 16 57 30 17 Mar. (76) 10 0 7 Mar. (66) 22 30 24 Feb. (55) 3 Tues. . 11 35 0 14 Mar. (73) . 4 Wed. . 1747 30 3 Mar. (62) 6 Fri. lo 22 Mar. (81) O Sat. 12 3011 Mar. (71) . 1 Sun. 12 25 0 28 Feb. (59) 2 Mon.. 18 37 30 19 Mar. (78) 4 Wed: 060 08 Mar. (67) 5 Thur.. 7 2 30 26 Feb. (57) 6 Fri. 6 Fri. . 13 15 0 15 Mar. (74) O Sat. 19 27 30 5 Mar. (64) 2 Mon. . i 40 0 24 Mar. (83) . 3 Tues.. 7 3012 Mar. (72) 4 Wed 14 5 0 1 Mar. (60) . 5 Thur. 20 17 80 20 Mar. (79) Jo Sat 2 300 100-1162 4033 314-4314 4034 4035 190-1148 224-7544 4036 190-4378 4037 O Sat. 4 Wed. . 3 Tues. 1 Sun. 5 Thur. 4 Wod. .1 Sun. Fri. 4 Wed. . 2 Mon. 1 Sun. 5 Thur. 2 Mon. 1 Sun. 314-7531 10-7808 4038 4039 4040 226-0661 259.7156 4041 . 135-3991 4042 11-0825 45-7222 4043 4044 4045 260-0474
Page #85
--------------------------------------------------------------------------
________________ 62 Kali. Saka. 1 01 4056 2 3 867 3a 4046 119-20 4047 351 868 1003 352 120-21 353 121-22 122-23 4048 869 1004 4049 870 1005 354 4050 4051 4052 871 1006 355 123-24 872 1007 356 124-25 873 1008 357 125-26 4053 874 1009 358 126-27 4054 875 1010 359 127-28 4055 128-29 876 1011 300 301 129-30 302 130-31 131-32 877 1012 4057 878 1013 4058 879 1014 303 4059 880 1015 364 132-33 4060 881 1016 305 133-34 4061 882 1017 366 134-35 4062 1018 883 367 135-36 4063 884 1019 368 136-37 4064 885 1020 369 137-38 4065 886 1021 370 138-39 4066 371 887 1022 139-40 4067 888 1023 372 140-41 4068 889 1024 373 141-42 890 1025 374 142-43 991 1026 143-44 4069 4070 1002 CONCURRENT YEAR. Kollam. 375 EPIGRAPHIA INDICA. A.D. 5 JOVIAN SAMVATSARA. 944-45 38 Krodhin 945-46 39 Visvavanu 946-47 40 Parabhava 954-55 Southern system. 947-48 41 Plavanga *948-49 42 Kilaka. 949-50 43 Saumya. 950-51 44 Sadharana 951-52 45 Virodhakrit *952-53 46 Paridhavin 953-54 47 Pramadin 48 Ananda 49 Rakshasa *956-57 50 Anala 957-58 51 Pingala 958-59 52 Kalayukta 959-60 53 Siddharthin *960-61 54 Raudra 961-62 955-56 . Northern system. * 7 55 Durmati 56 Dundubhi 962-63 963-64 57 Rudhirodgarin *964-65 58 Raktaksha 965-66 59 Krodhana 966-67 60 Kshaya 967-68 1 Prabhava *968-69 2 Vibhava + By the "Indian Calendar" the intercalated mcnth was 4 Ashadha. 39 Visvavasu 40 Parabhava 41 Plavanga 42 Kilaka. 43 Saumya. 44 Sadharana 45 Virodhakrit 46 Paridhavin 47 Pramadin 48 Ananda 49 Rakshasa 50 Anala 51 Pingala 52 Kalayukta 53 Siddharthin 54 Raudra 55 Durmati 56 Dundubhi 57 Rudhirodgarin 58 Raktaksha 59 Krodhana 60 Kshaya 1 Prabhava 2 Vibhava 3 Sukla * [VOL. XVII. TABLE Mean Intercalated (adhika) lunar month. 8a 5 Sravanat 1 Chaitra 10 Pausha 6 Bhadrapada ... 3 Jyeshtha ... 11 Magha 8 Karttika 4 Ashadha ... 1 Chaitra 9 Margaira
Page #86
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. LXXVI--contd. 1 Arya Siddhanta, mean system. COMMENCEMENT OF THE MEAN SOLAR YRAR. MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA I ENDS). Kali year. Day and month, A.D. Time of Week-day. menn Mesha Day and month, samkranti A.D. Week-day. a (here=1 the index of the tithi). 23 135-7207 4046 4047 170-3603 46-0436 4048 4049 260-3590 294-9986 4050 170-6819 205-3216 4051 4052 4053 81.0049 295-3203 4054 329-9599 4055 205-6432 4056 13 17 19 H. M. S. 24 Mar. (84) .' .1 Sun. . 8 42 30 27 Feb. (58) 24 Mar (83). 2 Mon. . 14 55 0 17 Mar. (76) 24 Mar. (83) . . 3 Tues.. 21 7 306 Mar. (65) 25 Mar. (84) 6 Thur.. 3 20 0 24 Feb. (56) 24 Mar. (84) 6 Fri. . 9 3014 Mar. (74) 24 Mar. (83) O Sat. 15 45 03 Mar. (62) 24 Mar. (83) . . 1 Sun. 22 Mar. (81) 25 Mar. (84) . . 3 Tues. . 4 10 0 11 Mar. (70) 24 Mar. (84) . . 4 Wed.. 10 22 30 29 Feb. (60) 24 Mar. (83) . . 5 Thur.. 19 Mar. (78) 24 Mar. (83) . . 6 Fri. 308 Mar. (67) 25 Mar. (84) . . 1 Sun. . 0 26 Feb. (56) 24 Mar. (84) 2 Mon.. 30 15 Mar. (75) 24 Mar. (83) . 3 Tues. 0 5 Mar. (64) 24 Mar. (83) . . 4 Wed.. 30 23 Mar. (82) 25 Mar. (84) 6 Fri 18 013 Mar. (72) 24 Mar. (84) : . 12 2 301 Mar. (61) 24 Mar. (83) 1 Sun. 18 15 0 20 Mar. (79) 25 Mar. (84) 3 Tues.. 27 309 Mar. (68) 25 Mar. (84) 4 Wed..840 027 Feb. (58) 24 Mar. (84) . . 5 Thur.. 12 52 30 17 Mar. (77) 24 Mar. (83) 6 Fri 19 5 0 6 Mar. (65) 25 Mar. (84). 1 Sun. 1 17 30 23 Feb. (54) 25 Mar. (84) 2 Mon.. 7 30 0 14 Mar. (73) 24 Mar. (84) 3 Tuos. . 13 42 303 Mar. (63) 81-3266 4057 3 Tues.. 2 Mon.. . 6 Fri. . 4 Wed. 3 Tues. O Sat. 6 Fri. 3 Tues. 1 Sun. O Sat. . 4 Wed. 1 Sun. . O Sat. . 5 Thur.. 3 Tues. 1 Sun. . 5 Thur.. 4 Wed.. 1 Sun. . 6 Fri. . . 5 Thur.. 2 Mon. . 6 Fri. . 5 Thur. . 3 Tues.. 115.9662 4058 330-2815 4059 26-2892 4060 240-6045 4061 o Sat. . 116.2879 4062 150-9275 4063 26-6109 4064 240-9262 4065 275-5658 4066 151-2491 4067 26-9325 4068 61-5721 4069 275-8874 4070
Page #87
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [Vol. XVII. TABLE CONCURRENT YEAR. JOVIAN SAAVATBARA. Kali. Mean Intercalated (adbita) lunar ty onth. Saka. Chaitradi Vikrama. Moshadi solar year in Bengal. Kollam. A.D. Southern system. Northern system. 5 4071 4072 144-45 145-46 146-47 4073 6 Bhadrapada 4074 147-48 4076 1027 893 1028 1029 1030 1031 1032 1033 1034 1035 148-49 4076 2 Vaisakhs. 4077 969-70 3 Sukla. . 970-71 4 Pramoda 971-72 5 Prajapati *972-73 8 Angiras . 973-74 7 Srimukha 974-75 8 Bhav& . . 975-76 9 Yuvan. . *976-77 10 Dhatri. . 977-78 11 Isvara . . 978-79 12 Bahudhanya . 979-80 13 Pramathin *980-81 | 14 Vikrama . 981-82 15 Vpisha . . 982-83 16 Chitrabhanu . 4 Pramoda . 5 Prajapati . 6 Angiras 7 Srimukha . 8 Bbava. . 9 Yuven 10 Dhatri. 11 Isvara. 12 Bahudhanys. 13 Pramathin . 14 Vikrama 15 Vrisha. 18 Chitrabhanu . 17 Subhanu 149-50 150-61 151-52 162-53 153-54 4078 383 11 Magha . 4079 4080 1036 4081 1037 | 8 Karttikat. 4082 4083 4084 4 Asbadh . 4085 983-84 17 Subhanu 154-55 155-56 156-57 157-58 158-59 159-60 160-61 161-62 162-63 163-64 164-65 18 Tarana . 19 Parthivs . . 4086 4087 1043 1 Chaitra . 4088 .89 9 Margasira. 4090 *984-85 18 Tarana . . 985-86 19 Parthiva ; 986-87 20 Vyaya . . 987-88 21 Sarvajit . *988-89 22 Sarvadharin. 989-90 23 Virodhin 990-9124 Vikrita . . 991-92 25 Khara . . *992-93 993-9427 Vijaya . . 4091 20 Vyaya . 21 Sarvajit 22 Sarvadharin. 23 Virodhin 24 Vikrita 26 Nandana 1 27 Vijaya . . 28 Jaya'. . 29 Manmatha . 4092 6 Bhadrapada 4093 165-66 166-67 167-68 168-69 914 1049 915 1050 9161051 4094 4095 400 2 Vaisakhs By the "Indian Calendar " 7 Asvina was intercalated. ( 26 Khara was expunged in the north by the mean system, but 26 Nandana by the true system. By the true system the year A.D. 990-91 was, in the north, called "Kbara."
Page #88
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA BIDDHANTA MEAN SYSTEM. LXXVI-Contd. 1 Arya Siddhanta, mean system. COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-SOLAR YEAR (MEAK SUNRISE OF CIVIL DAY ON WHICH CHAITRA BUKLA 1 ENDS). Kali year. Day and month, A.D. Day and month, Day and month, Time of Woek.day. mean Mesha samkranti. Week-day. a (here=t, the index of the tithi). 13 17 19 20 23 . 310-5271 186.2104 61-8939 2 Mon. . 6 Fri. 3 Tues. 2 Mon. . 0 Sat. .4 Wed. 3 Tues. 4071 4072 4073 4074 4075 96-5335 310-8487 . 186-5321 4076 221.1716 4077 4078 8 Fri. 0 Sat. 96-8550 6 Fri. 131-4946 4079 7-1781 4080 221-4933 4081 256-1329 4082 24 Mar. (83) . 28 Mar. (84) 25 Mar. (84) 24 Mar. (84) 24 Mar. (83) 25 Mar. (84). 26 Mar (84) 24 Mar. (84). 24 Mar. (83). 25 Mar. (84) 26 Mar. (84) 24 Mar. (84) 24 Mar. (83) 25 Mar. (84) 26 Mar. (84) 24 Mar. (84) . 24 Mar. (83). 25 Mar. (84) 25 Mar. (84) . 24 Mar. (84) 25 Mar. (84) 25 Mar. (84) 25 Mar. (84) 24 Mar. (84) 26 Mar. (84) . H. M. S. 4 Wed.. 19 66 0 22 Mar. (81) 16 Fri. . 2 7 30 11 Mar. (70) 0 Sat. . 8 0 28 Feb. (50) Sun. 14 32 30 18 Mar. (78) Mon. . 20 45 0 8 Mar. 187) 4 Wed. 30 25 Feb. (56) 5 Thur.. 0 16 Mar. (75) 15 22 304 Mar. (64) O Sat. 21 36 0 23 Mar. (82) 2 Mou. 3012 Mar. (71) 3 Tues. . 10 002 Mar. (61) 4 Wed. . 16 12 30 20 Mar. (80) 5 Thur.: 22 25 0 9 Mar. (68) O Sat. 37 30 26 Feb. (57) 1 Sun. 0 17 Mar. (76) 2 Mon. 6 Mar. (66) 3 Tues. 0 23 Feb. (54) 6 Thur. 27 3014 Mar. (73) 6 Fri. . 11 3 Mar. (62) 0 Sat. 17 21 Mer. (81) 2 Mon. o 6 011 Mar. (70) 3 Tues. . 6 17 30 28 Feb. (59) 4 Wed.. 12 30 0 19 Mar. (78) 8 Thur.. 18 12 307 Mar. (67) o Sat. 65 0 25 Feb. (66) 4083 131-8163 7-4998 4084 41.1393 4085 . 256-4546 4086 132-1379 4087 3 Tues. . 1 Sun. O Sat. . 4 Wed. 1 Sun. . O Sat. 5 Thur. 2 Mon. 1 Sun. . 5 Thur. Wed. 2 Mon. . 8 Fri. 5 Thur. . 2 Mon. . Sat. 166.7776 4088 4089 .. . 42-4610 77-1006 4090 201-4188 4091 167-0992 4092 201.7389 4093 77-4222 4094 . 291-7375 4095
Page #89
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [VOL. XII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Chaitridi Vikrama Mishadi solar year in Bengal. Mean Intercalated (adhika) lunar month. Kollam. 1 A.D. Southern system. Northern system. 7 8a 4006 1062 4097 4098 | 169-70 170-71 171-72 172-73 173-74 174-78 4099 4100 ina 4101 4103 175-76 4103 4104 176-77 177-78 178-79 4100 4106 4107 4108 994-95 28 Jaya , 30 Durmukha . 995.96 29 Manmatha 31 Homelamba. 11 Migha *996-97 Durmukhs 32 Vilambe 997-98 31 Hemalamba . 33 Vikarin 998-99 82 Vilamba 34 Sarvarin 999-00033 Vikirin 36 Plavs .. . *1000-01 - Sarvarin 36 Subhakpit . 1001-02 86 Plats . . 37 Sabhara Anbidha . 1002-03 38 Subhakrit 38 Krodhin . 1003-04 37 Sobhana 39 Vidvarasu . 12 Phalguna Krodhin 40 Paribhava . 1006-06 39 Vlivit . 41 Plavanga . 1008-07 40 Paribhava 42 Kilaka. 9 Margeirs. 1007.08 41 Platangs 43 Saumy . *1008-094 Kraka. 44 Sidharama 1009-10 | 13 Sauny .45 Virodhakrit . 6 8rivaca 1010-11 Sadbirana 46 Paridhivin 1011-12 45 Virddhakrit. 47 Pramidia . *1012-13 48 Paridhavin . 48 Ananda 2 Vaisakha. 1013-14 47 Pramidin . 49 Rakahasa 1014-15 48 Anands 50 Anale. 10 Pausha 1015-1049 Rakshasa . 61 Pingala *1016-17 50 Anals. . 62 Kalayukta . 1017-18 61 Pangala . 83 Siddharthin. 7 Aivins 1018-19 52 Kalayukta . Raudrs . (109 1088 4113 180-81 181.82 182-83 183-84 184-86 186-86 186-87 187-88 188-89 189-90 180-91 191-92 192-93 193-94 1069 1070 4116 1071 4116 4117 $13 1074 1076 4119 1076
Page #90
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA NEAN SYSTEM. LXXVI--Contd. 1 Arya Siddhants, mean system. COMMENCEMENT OF THE MEAN SOLAR THAL. MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA I ENDS). Kali yeur. Day and month, A.D. Time of Woek-day. mean Meab tamkranti. Day and month. A.D. Week day. a (hete=1, the index of the tithi). 13 19 4096 4097 4040 4099 4100 4101 4103 4109 4104 25 Mar. (84) 25 Mar. (84). 24 Mar. (84) 26 Mar. (84) 25 Mar. (84) 25 Mar. (84) 24 Mar. (94) Mar. (84) 25 Mar. (84). 25 Mar. (84) 24 Mar. (84) 25 Mar. (84) . 25 Mar. (84) 25 Mar. (84) 24 Mar. (84) 25 Mar. (84) 25 Mar. (84) 26 Mar. (84) 24 Mar. (84) 25 Mar. (84). 25 Mar. (84) . 25 Mar. (84) 24 Mar. (84) 25 Mar. (84). 25 Mar. (84) . 14 17 2013 H. M. S. 1 Sun. 7 7 30 16 Mar (75) Fri. . 326-8771 2 Mon. 2 Mon.. 13 200 5 Mar (64) . Tre.. 208-0606 3 Tue. 32 30 33 M. (88) . Mon 236-7001 46 012 Mar. ( 112-3835 30 Mar. (61; 4 Wod.. 338-6988 20 Mar. (70) . Mon. 227065 1 Sun. 30 Mar. (6) Sat. 237-0218 3 Tues. . 2 36 0 28 Feb. (67) 4 Wed. 1127052 4 Wod. . 8 47 20 17 Mar. (76 . Tuo 147-3448 5 Thur. 15 0 6 Mar. (05) 23-0272 B Fri. 30 24 Mar. (84) 87-6667 1 San. 014 Mar. (73) 271-9831 2 Mon. . 937 50 3 Mar. (82) I San. 147-6665 3 Twe. . 15 60 22 Mar. (81) Bath 182-3061 4 Wed. . 22 2 30 10 Mar. 70) . Wod. 87-9604 6 Fri. 14 15 08 Feb. (59) . Mon. . 272-3047 . 20 27 3 19 Mar. (78) . 1 Son 306-9444 . 18 40 0 8 Mar. (67) Thur.. 109-8277 2 Mon. . 22 62 30 25 Peb. (66) . Mon.. 68-3111 4 Wed Hose Mar. (741. Sun 07-9607 5 Thur. 17 306 Mar. (B) Tri 307-2669 6 TH. 0 3 Mar. (82 . Wod.. 3-2737 0 Sat. 23 42 30 12 Mar. 72) . 2 Mon.. 217-5890 2 Mon. .685 0 Mar, (80) . 6 Tr. . 93-9723 3 Tues. . 12 1 30 29 Mar. (79) . Thur.. 187-9119 4106 4106 4107 4109 4105 4116 0 Sat. 4115 I Sun. 4113 4114 . . . 4115 4116 4117 . 4118 4110
Page #91
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. (VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kli Mean Intertalated (adhika) lunar month. 8 Chaitradi Vikrama. Mosbadi salar year in Bongal. Kollm. A.D. Southern system. Northern system. I 421 4122 4123 ... 4124 1077 1078 1079 1080 1081 1082 1083 4125 4126 4127 1084 4128 4120 1085 4130 4131 4132 1086 1087 1088 1089 1090 1091 4133 4134 426194-95 196-98 196-97 197-98 198-99 199-00 200-01 201-02 202-03 203-04 204-06 205-08 206-07 207-08 208-09 209-10 210-11 211-12 212-13 213-14 214-16 216-16 216-17 449 217-18 450218-19 1019-20 63 Siddharthin. 05 Durmati 1020-21 54 Raudra 66 Dundubhi Ashadha . 1021-22 88 Durmati 07 Rudhirddgarin 1022-23 88 Dundubhi 58 Raktakaha 12 Phalguns. 1023-24 07 Rudhirodgkrin 59 Krodhana . *1024-26 58 Raktaksha . 80 Kahaya 1025-26 69 Krodhana 1 Prabhava . 9 Margasins. 1026-27 60 Kshays 2 Vibhavs . 1027-28 1 Prabhava 3 Sukla, il *1028-29 12 Vibhava 4 Pramoda 8 Srivada 1029-30 3 Sakla. 18 Prajapati . 1030-314 Pramoda 6 Angiras 1031-32 6 Prajapati 7 Srimukha . 2 Vaisakha. *1032-33 | 6 Angiras 8 Bhave. . 1033-347 Srimukha 9 Yuvan. . 10 Pausha 1034-36 8 Bhava . . 10 Dhitri. 1036-36 9 Yavan. . 11 Isvars . . 1036-37 10 Dhatri . . 12 Bahudhanya . 7 Aivina 1037-38 11 Ilvars . . 13 Pramathin . 1038-39 12 Bahadhanya . 14 Vikrama 1039-40 13 Pramathin . 18 Vrisba. 3 Jyeshtha. *1040-41 14 Vikrams | 16 Chitrabbanu. 1041-42 16 Vpisha ... 17 Subhana 1042-43 16 Chitrabhanu . 18 Tarana . 1043-44 17 Subhana 19 Parthiva 4186 4136 4137 1093 1094 4138 4189 1096 1096 4140 4141 4142 4143 1098 1099 . 12 Phalguns 4144 1100 4145 1101 * By the "Indian Calendar" 3 Jyoshtha ww intercalated.
Page #92
--------------------------------------------------------------------------
________________ No. 6.] LXXVI-Contd. Day and month, A.D. 13 MEAN SOLAR YEAR. 25 Mar. (84). 25 Mar. (85). 25 Mar. (84). 25 Mar. (84). 25 Mar. (84). 25 Mar. (85). 25 Mar. (84). 25 Mar. (84). 25 Mar. (84). 25 Mar. (85). 25 Mar. (84). 25 Mar. (84). 25 Mar. (84). 25 Mar. (85). 25 Mar. (84). 25 Mar. (84). 25 Mar. (84). 25 Mar. (85). 25 Mar. (84). 25 Mar. (84). 25 Mar. (84). 25 Mar. (85). 25 Mar. (84). 25 Mar. (84). 25 Mar. (84). * * 4 Wed. 6 Fri. 0 Sat. 1 Sun. 2 Mon. 4 Wed. 5 Thur. 6 Fri.. 0 Sat. * 2 Mon. . . * . * . . THE FIRST ARYA SIDDHANTA MEAN SYSTEM. . . 14 Time of Week-day. mean Mesha Day and month, Week-day. A.D. samkranti. 3 Tues. 4 Wed. 5 Thur. 0 Sat. 1 Sun. 2 Mon.. 3 Tues. 5 Thur. 6 Fri. 0 Sat. 1 Sun. * 3 Tues. 4 Wed. 5 Thur. 6 Fri. COMMENCEMENT OF THE * . * . . . . " . . . 17 H. M. 8. 18 20 0 0 32 30 6 45 0 12 57 30 19 10 0 1 22 30 7 35 0 13 47 30 20 0 0 2 12 30 0 8 25 14 37 30 MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUELA 1 ENDS). 19 9 Mar. (68) 27 Feb. (58) 17 Mar. (76) 6 Mar. (65) 25 Mar. (84) 13 Mar. (73) 3 Mar. (62) 22 Mar. (81) 11 Mar. (70) 28 Feb. (59) 18 Mar. (77) 8 Mar. (67) 20 50 0 25 Feb. (56) 3. 2 30 15 Mar. (75) 9 15 0 4 Mar. (63) 15 27 30 23 Mar. (82) 21 40 0 13 Mar. (72) 3 52 30 1 Mar. (61) 10 5 0 f6 17 30 20 Mar. (79) 9 Mar. (68) 27 Feb. (58) 22 30 0 4 42 30 16 Mar. (76) 10 55 0 6 Mar. (65) 17 7 30 25 Mar. (84) 23 20 914 Mar. (73) * . * * 1 Arya Siddhanta, mean system. . 20 2 Mon. 0 Sat. 6 Fri. 3 Tues. 2 Mon. 6 Fri. 4 Wed. 3 Tues. 0 Sat. 4 Wed. 3 Tues. 1 Sun. 5 Thur. 4 Wed. 1 Sun. 0 Sat. 5 Thur. 2 Mon. 1 Sun. 5 Thur. 3 Tues. 1 Sun. 6 Fri. 5 Thur. 2 Mon. . * . * * a (here=1, the index of the tithi). 23 Kali year. 3.5953 217-8106 252-5502 128-2336 162-8732 38-5566 4128 252-8719 4127 287-5115 4128 163-1948 4129 38-8782 4130 4131 73-5179 287-8331 4132 163-5165. 4133 198-1561 4134 73-8395 4135 108-4791 4136 322-7944 4137 198-4778 4138 233-1174 4139 108.8008 4140 323-1161 4141 19-1238 4142 233-4391 4143 268-0787 4144 143-7621 4145 4121 4122 69 4123 4124 4125
Page #93
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. (Vol XVII TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Chaitradi Vikrama. Chaitridi Vikrama. Mean Intercalated (adhika) lunar month. Meshadi solar yoar in Bengal. Kollam. A.D. Southern system. Northern system w 5 4146 4147 4148 1103 4149 4150 4151 107 4152 1106 1100 4153 4154 4155 = 4156 4157 = 4158 219-20 1044-45 18 Tarene . . 20 Vyaya . I 8 Kistula 220-21 1045-48 19 Parthirs . 21 Sarvajit . 221-22 1046-47 20 Vysya . 22 Sarvadharin. 222-23 1047-48 21 Sarvajit 23 Virodhin 5 Srava 223-24 *1048-4022 Sarvadharin. 24 Viktita. . 224-25 1049-50 23. Virodhin 25 Khara . 225-26 1050-61 24 Vikrita. 26 Nandam . I Chaitra 226-27 25 Khara . 27 Vijaya . . 26 Nandans 28 Jaya , 10 Pansba 228-29 1053-64 27 Vijaya . . 29 Manmaths . 1054-56 28 Jaya . . 30 Durmukha 230-32 1055-56 29 Manmaths . 31 Henalambs. 7 Aivinat . 23.1-32 *1058-57 30 Darmukha .32 Vilambo . 232-33 1037-58 31 Hemalamba . 33 Vikasin 233-34 1058-50 33 Vilamba 34 Sarvagin . 3 Jyoshpha . 234-35 1059-60 33 Vikarin 36 Plava. . 235-38 1060-61 34 Sarvarin 36 Subhakerit 12 Phalgune. 236-37 1061-82 35 Plavs 37 8obban . 237-38 1062-63 28 Subhakrit 38 Krodhin 238-39 | 1063-6437 Sobhana | 39 Visvara 8 Kaettika 239-40 1064-86 38 Krodhin 40 Parabhava 240-41 1065-68 39 Vibravasu 41 Plavanga . 241-42 1066.67 40 Parabbava . 42 Kilaks . . 5 Sravana 242-43 1067-68 u Plavanga 43 Saumya . 243-44 1068-69 2 Kilala . . 44 Sadharana. 4159 = 4160 1116 4161 4162 1118 1119 4163 4164 4165 4166 1122 4167 4168 4189 1126 4170 1126 By the Indian Calendar" 6 Bhadrapada was the interoslated month.
Page #94
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA MEAN SYSTEM. LXXVI-Contd. 1 Arya Siddhanta, mean system. COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA I ENDS). Kali year. Day and month, A.D. Time of Week-day. mean Mesha samkranti. Day and month, Day A.D. Weekday. (hereet, the index of the tithi). 13 20 . 4148 4147 4148 4149 4100 4101 4182 . 4103 4104 25 Mar. (85) . 25 Mar. (84) 25 Mar. (84) 26 Mar. (85) 25 Mar. (85) 25 Mar. (84) 25 Mar. (84) 26 Mar. (85) . 25 Mar. (85) 25 Mar. (84) 26 Mar. (84) 28 Mar. (85) . 25 Mar. (85) . 26 Mar. (84) 25 Mar. (84) 26 Mar. (85) 26 Mar. (85) 25 Mar (84) 25 Mar (84) 26 Me. (85) Mar. (85) 25 Mar. (84). 25 Mar. (84) 26 Mar. (86). 25 Mar. 36). . 19 1 28 H. M. 8. 1 Sun. 5 32 802 Mar. (62) Fri. . 19-4464 2 Mon. . 11 45 0 21 Mar. (80) . 6 Thur. 84.0850 8 Tue 3011 Mar. (70) 3 Tues. 268-4003 5 Thur. 028 Feb. (50) . Sat. 144.0838 6 Fri. . 6 22 30 18 Mar. (78) 178-7233 O Sat. . 12 35 0 7 War. (68) 3 Tues. 54-4067 1 Sun. . 18 30 25 Feb. (58) . Sun. 268-7219 3 Tue. 0 16 War. (75) O Sat. 303-3616 4 Wed.. 7 12 30 4 Mar. (64) 4 Wod. 179-0449 26 0 22 War. (82) 3 Toes. 213-8845 19 37 3012 Mar. (71) . . Sat. 89-3670 1 Sun, 02 Mar. (61). 6 Thur. 303-6832 2 Mon. 30 19 War. (79) 3 Tues, 9999-69093 3 Tuen. 18 0 9 Mar. (68) 1 San. 214-0062 4 Wed 27 2028 Feb. (57) . Thur. 89-6896 6 Fri. 40 0 17 tar. (76) 4 Wod. 124-3292 0 Bat. 30 Mar. (65) 1 San. *00120 1 Sot . 15 8 0 24 Mar. (83) 0 Sat. 34-6622 2 Mon. 21 17 30 19 Mar. (73) . Thor. 248-9675 Wed. 30 0 3 Mar. (62) . Mon. 124-6508 . 942 80 21 Mar. (81) 1 San. 150-2905 6 M. 0 10 Mar. (697 .Thar. 34-0739 30 28 Feb. (60) . 3 Toer. 249-2899 2 Mon.. 4 20 0 19 Mar. (78) 2 Mon.. 289-9288 3 The.. 10 32 20 7 Mar. (67) . Pri. .! 159-6122 . . 4155 4166 4187 4158 4109 4160 . . . 4161 . . 4102 4108 4164 4105 4100 16 68 4187 4168 4160 4170 As a mean tithi Chaitra Bakla I was sa panged. The civil day corteponding to it, 1.c., the first day of the luni-solar your WM M given in oola. 10. 20.
Page #95
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [Vol. XVII. TABLE CONCURRENT YEAR. JOVIAN BARVATSARA. Kali. Chaitradi Vikrama. Mean Intercalated (adhika) lunar month. Meshadi solar year in Bengal. Kollam. A.D. Southern system. Northern system. 4171 4172 1127 1128 1129 1130 4173 4174 479 4176 1131 4176 1132 481 1133 999 1134 4177 4178 4179 4180 1000 1135 1001 1136 4181 1002 1137 4182 4183 476 244-46 1069-70 43 Saumya 45 Virodhakrit . 1 Chaitra 477 246-48 1070-71 44 Sadharana 46 Paridhavin . 478 246-47 1071-72 46 Virodhaksit . 47 Pramadin 10 Pausha 247-48 *1072-73 46 Paridhavin . 48 Ananda 480 248-49 1073-7447 Pramadin 49 Rakabasa . 249-50 1074-75 48 Ananda 6 Bhadrapada 482250-51 1075-76 49 Rakshasa sr Pingalat . 483 281-52 *1076-77 50 Anala 53 Siddharthin. 484 252-53 1077-78 51 Pingala 54 Raudra. I 3 Jyishths. 253-54 52 Kalayukta 55 Durmati 486 254-55 1079-80 53 Siddharthin. 56 Dundubhi 11 Magha . 487 255-58 *1080-81 54 Raudra 57 Rudbirodgarin 286-57 1081-82 55 Durmati 58 Raktaksha 257-58 1082-83 56 Dundubhi 59. Krodhana . 8 Karttika . 288-69 1083-84 57 Rudhirodgarin 60 Kshaya 259-601084-86 38 Raktaksha 1 Prabhavs 260-61 1086-88 59 Krodhans 2 Vibhava 4 Ashadba . 261-62 1086-87 60 Kshaya 3 Sukla . 262-63 1087-88 1 Prabhava 4 Pramoda 263-64 *1088-89 2 Vibhava . 5 Prajapati 1 Chaitra 264-65 1089-90 3 Sukla . . 6 Angiras 265-66 1090-91 4 Pramoda 7. Srimukba 1 9 Margasira. 268-67 1091-92 5 Prajapati 8. Bbava. . 267-68 *1092-93 6 Angiras 1 9 Yuvan. . 288-89 1093-94 7 Srimukha 10 Dhatci . . 6 Bhadrapada 4184 4186 1141 4186 4187 1003 1138 1004 1139 1005 1140 1006 1007 1142 1008 1143 1009 1144 10101145 1011 1146 10121147 1013 1014 1149 1015 1160 1016 4188 4189 4190 4191 Anziras . 4192 1148 4193 4194 4198 1 52 Kalayukta was suppressed in the north.
Page #96
--------------------------------------------------------------------------
________________ No. 6.] LXXVI-Contd. Day and month, AD. 13 MEAN SOLAR YEAR. 25 Mar. (84). 25 Mar. (84). 26 Mar. (85) 25 Mar. (85). 25 Mar. (84). 25 Mar. (84). 26 Mar. (85). 25 Mar. (85). 25 Mar. (84). 26 Mar. (85). 26 Mar. (85). 25 Mar. (85). 25 Mar. (84). 26 Mar. (85). 26 Mar. (85). 25 Mar. (85). 25 Mar. (84). 26 Mar. (85). 26 Mar. (85). 25 Mar. (85). 25 Mar. (84). 26 Mar. (85). 26 Mar. (85). 25 Mar. (85). 25 Mar. (84). . . * * " . * * * . . . . THE FIRST ARYA SIDDHANTA MEAN SYSTEM. . COMMENCEMENT OF THE Week-day. 14 4 Wed. 5 Thur. 0 Sat. 1 Sun. 2 Mon. 3 Tues. 5 Thur.. 6 Fri. 0 Sat. 2 Mon. 3 Tues. 4 Wed. 5 Thur. 0 Sat. 1 Sun. 2 Mon. 3 Tues. 5 Thur. 6 Fri. 0 Sat. 1 Sun. 3 Tues. 4 Wed. 5 Thur. 6 Fri. ............. " " . * * . Time of mean Mesha Day and month, samkranti. A.D. 17 H. M. S. 16 45 22 57 30 5 10 24 Feb. (55) 15 Mar. (74) 5 Mar. (64) 23 Mar. (83) 17 35 12 Mar. (71) 23 47 30 1 Mar. (60) 6 0 0 20 Mar. (79) 12 12 30 9 Mar. (69) - 2 - 2 - 2-2-2-2-2 11 22 30 18 25 0 26 Feb. (57) . 10 MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). 0 37 30 17 Mar. (76) 6 50 6 Mar. (65) 13 2 30 24 Mar. (84) 19 15 13 Mar. (72) 3 Mar. (62) 0 22 Mar. (81) 10 Mar. (70) 27 Feb. (58) 18 Mar. (77) 8 Mar. (67) 25 Feb. (56) 15 Mar. (74) 4 Mar. (63) 0 23 Mar. (82) 12 Mar. (72) 1 Mar. (60) 1 27 30 7 40 13 52 30 20 5 0 2 17 30 8 30 14 42 30 20 55 0 3 7 30 9 20 15 32 30 21 45 0 19 0 * * * . . . * . . 1 Arya Siddhanta, mean system. Week-day. 20 3 Tues. 2 Mon. 0 Sat. 6 Fri. 3 Tues. 0 Sat. 6 Fri. 4 Wed. 1 Sun. 0 Sat. 4 Wed. 3 Tues. 0 Sat. 5 Thur. 4 Wed. 1 Sun. 5 Thur. 4 Wed. 2 Mon. 6 Fri. 5 Thur. 2 Mon. 1 Sun. 6 Fri. 3 Tues. . * * . * . . * . a (here-t, the index of the tithi). 13 23 Kali year. 35-2955 4171 69-9351 4172 284-2504 4173 318-8901 4174 194-5734 4175 70-2568 4176 104-8964 4177 319-2116 4178 194-8950 4179 229-5347 4180 105-2180 4181 139-8576 4182 15-5410 4183 229-8563 4184 .264-4959 .4185 140-1793 4186 15-8627 4187 50-5023 4188 264-8176 4189 140-5009 4190 175-1405 4191 50-8239 4192 85-4636 4198 299-7788 4194 175-4622 4195
Page #97
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. (VOL. XVII TABLE CONCURRENT YEAR. JOVIAN SARVATSABA. Kali. Chaitradi Vikrams. Mean Intercalated (adhika) lunar month. Meahadi solar year in Bengal. 4.D. Southern system. Northern system. 8a 4196 4197 1017 1018 1019 4198 4190 1020 1021 4200 4201 1162 1163 1154 1168 1156 1167 1168 1169 1160 1022 1023 1024 4808 4204 1025 4206 1026 1161 4206 1027 1182 1207 1163 1028 1029 4208 1164 269-70 1094-96 8 Bhara. 11 Isvars . . 270-71 1096-96 9 Yuvan. 12 Bahudhanya . 271-72 *1096-97 10 Dhatci . . 13 Pramathin . 3 Jyoshthat. 272-73 1097-98 11 Tavara . 14 Vikrama 273-74 1008-90 12 Bahadhanya . 15 Vpisha 11 Magha 274-75 1099-00 13 Pramathin 16 Chitrabbanu . 275-76 *1100-01 14 Vikrama 17 Subhanu 276-77 1101-02 15 Vrisha . . 18 Tarana . . 8 Karttika 277.78 1102-03 16 Chitrabhanu . 19 Parthiva . 278-79 1103-04 17 Bubhanu 20 Vyaya . 279-80 *1104-05 18 Tarana . 21 Sarvajit . Ashadba . 280-81 1106-06 19 Partbiva . 22 Sarvadharin 281-82 1106-07 20 Vyaya . . 23 Virddhin 282-83 1107-08 21 Sarvajit . 24 Vikrita . 1 1 Chaitra . 283-841108-09 22 Sarvadharin. 25 Khari. . 284-85 1109-10 23 Virodhin . 26 Nandans . 9 Margasira. 285-86 1110-11 24 Vikrita . . 27 Vijaya . . 286-87 1111-12 25 Khara . 28 Jaya . . 287-88 *1112-13 26 Nandana 29 Manmatha. 6 Bhadrapada 288-89 1113-14 27 Vijaya . . 30 Durmukha. 289-90 1114-15 28 Jaya . . 31 Hemelamba 200-91 1115-18 29 Manmatha . 32 Vilamba 2 Vaibakhs. 291-92 *1116-17 30 Durmukha . 33 Vikarin 292-93 1117-18 31 H&malamba . 34 Sarvern 11 Magha 293-94 1118-19 32 Vilamba . 36 Playa . . 1209 1030 1166 4210 1211 1166 1167 1168 4212 1213 1169 1031 1032 1033 1034 1035 1036 1037 1038 1170 4215 1171 1216 4217 1218 1039 4219 1040 1041 By the Indian Calendar" ? Vaibikha was intercalated.
Page #98
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA MEAN SYSTEM. LXXVI-Contd. 1 Arya Siddhanta, mean system. COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-SOLAB YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUELA 1 ENDS). Kali year. Day and month, A.D. Time of Week-day. mean Mesha samkranti. Day and month, A.D. Weekday. a (here=t, the index of the tithi). 13 17 19 20 23 210-1018 4196 . 10 10 ole 85-7852 4197 1 Sun. 2 Mon. 3 Tues. 4 Wed. 300-1005 4198 4199 9996-10827 210-4235 6 Fri. 4200 0 Sat. 2 Mon. . 6 Fri. 4 Wed.. 2 Mon.. Sat. 6 Fri. 3 Tues. . O Sat. 6 Fri. 4 Wed. 1 Sun. 245-0630 4201 120-7464 9996-42987 31.0694 245-3847 26 Mar. (85) 28 Mar. (85) 26 Mar. (85) 26 Mar. (84) 28 Mar. (85) Mar. (85) 25 Mar. (85) 26 Mar. (84) 26 Mar. (85) 26 Mar. (85) 26 Mer. (85) 26 Mar. (85) 28 Mar. (85) 26 Mar. (85) . 25 Mar. (85) 26 Mar. (85) 28 Mar. (85) 26 Mar. (85) 25 Mar. (85) 26 Mar. (85) 28 Mar. (85). 26 Mar. (85) 26 Mar. (85) . 26 Mar. (85) 28 Mar. (85) 1 Sun. 2 Mon. 4 Wed. 5 Thur.. 6 Fri. . 1 Sun. 2 Mon. . 3 Tues. . 4 Wed.. o Sat H.M.S. 3 57 30 | 20 Mar. (79) 0 9 Mar. (68) 30 27 Feb. (58) 0 16 Mar. (75) 308 Mar. (65) 21 0 23 Mar. (84) 30 13 Mar. (73) 26 0 2 Mar. (61) 30 21 Mar. (80) 11 0 11 Mar. (70) 18 30 28 Feb. (59) 0 18 Mar. (77) 6 27 30 7 Mar. (66) 12 40 0 25 Feb. (56) 18 52 30 15 Mar. (75) 04 Mar. (63) 17 30 23 Mar. (82) 012 Mar. (71) 19 42 30 1 Mar. (61) 1 65 0 20 Mar. (79) 8 7 30 9 Mar. (68) 026 Feb. (67) 20 32 30 16 Mar. (76) 2 45 0 6 Mar. (66) 8 67 80 24 Mar. (83) 121-0681 155-7077 31-3911 4202 4203 4204 4205 4206 4207 4208 4209 4210 4211 4212 1213 . 4 Wed. 2 Mon. . | 1 Sun. 2 Mo 245-7063 280-3460 5 Thur. 156-0293 6 Fri. osat. . 190-6690 1214 . . . 66-3524 280-6678 315-3072 190-9905 4215 4 Wed. 1 Sun. . 6 Fri. Thur. 2 Mon. . 6 Fri. 5 Thur.. 3 Taca. 1 Sun. 1 Sun. 2 Mon. . 4 Wed. . 8 Thur.. 8 Fri. 0 Sat. 2 Mon. . 3 Tuos.. 4216 66-6740 . 101-3136 4217 4218 4219 1290 316-6288 11-6365 As a mean tithi Chaitra Sukla 1 ww expunged. The civil day corregionding to the lani-solar your was given in cola. 19, 20. her, the first day of K 2
Page #99
--------------------------------------------------------------------------
________________ 76 Kali. Saka. 2 co Chaitradi Vikrama. 3 Meshadi solar year in Bengal. 3a CONCURRENT YEAR. Kollam. EPIGRAPHIA INDICA. 4 A.D. 10 JOVIAN SAMVATSARA. Southern system. 6 1119-20 33 Vikarin *1120-21 34 Sarvarin 1121-22 35 Plava 1122-23 4221 1042 1177 526 294-95 4222 1043 1178. 527 295-96 4223 1044 1179 528 296-97 4224 1045 1180 529 297-98 36 Subhakrit 4225 1046 1181 530 298-99 1123-24 37 Sobhana 4226 1047 1182 531 299-00 1124-25 38 Krodhin 4227 1048 1183 532 300-01 1125-26 39 Visvavasu 4228 1049 1184 533 301-02 1126-27 40 Parabhava 4229 1050 1185 534 302-03 1127-28 41 Plavanga 4230 1051 1186 *1128-29 42 Kilaka 4231 1052 1187 4232 1053 1188 4233 1054 1189 535 303-04 536 304-05 1129-30 43 Saumya 537 305-06 1130-31 44 Sadharana 309-10 310-11 311-12 538 306-07 1131-32 45 Virodhakrit 4234 1055 1190 530 307-08 1132-33 46 Paridhavin 4235 1056 1191 540 308-09 1133-34 47 Pramadin 4236 1057 1192 541 1134-35 48 Ananda 4237 1058 1193 542 1135-36 49 Rakshasa 4238 1059 1194 543 1136-37 50 Anala 4239 1060 1195 544 312-13 1137-38 51 Pingala 4240 1061 1196 545 313-14 1138-39 52 Kalayukta 4241 1062 1197 546 314-15 1139-40 53 Siddharthiz 4242 1003 1198 547 315-16 1140-41 54 Raudra 4243 1064 1199 548 316-17 1141-42 55 Durmati 4244 1065 1200 549 317-18 1142-43 56 Dundubhi 4245 1066 1201 550 318-19 . * * Northern system. * 7 36 Subhakrit 37 Sobhana 38 Krodhin 39 Visvavasu 40 Parabhava 41 Plavanga 42 Kilaka. 43 Saumya 44 Sadharana 45 Virodhakrit 46 Paridhavin 47 Pramadin 48 Ananda 49 Rakshasa 50 Anala . 51 Pingala 52 Kalayukta 53 Siddharthin . 54 Raudra 55 Durmati 56 Dundubhi 57 Rudhirodgarin 58 Raktaksha 59 Krodhana 1143-44 57 Rudhirodgarin 60 Kahaya [VOL. XVII. TABLE Mean Intercalated (adhika) lunar month. 8a 7 Aevina 4 Ashadha 12 Phalguna 9 Margasira. ... 6 Bhadrapada 2 Vaisakha 11 Magha 7 Asvina 4 Ashadha
Page #100
--------------------------------------------------------------------------
________________ No. 6.) THE FIRST ARYA SIDDHANTA MEAN SYSTEM. LXXVI-Contd. 1 Arya Siddhanta, mean system. COMMENCEMENT OF THE MEAN SOLAR YEAR. MBAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Kali year Time of Day and month, A.D. Week-day. Day and month, we woma, Week-day. A.D. a (here=t, the index of the tithi). samkranti. 13 17 19 20 23 4221 4222 4223 4224 4225 . . af. (78) . 4226 Mar. (85) 25 Mar. (85) 26 Mar. (85) 26 Mar. (85) 26 Mar. (85) . 25 Mar. (85) . 26 Mar. (85) 26 Mar. (85) . 26 Mar. (85) . 25 Mar. (85). 26 Mar. (85) . 28 Mar. (85) 28 Mar. (85) 4227 4228 4229 4230 . . 4231 4232 M. s. 4 Wed.. 15 10 14 Mar. (73) 6 Fri. . 225.9518 5 Thur.. 21 22 30 2 Mar. (62) 3 Tues. 101-6352 O Sat. . 0 21 Mar. (80) . 2 Mon. 1362748 1 Sun. 3010 Mar. (69) 6 Fri. 11-9582 2 Mon. 16 0 28 Feb. (59) 4 Wed. 226-2735 3 Tues. 12 30 18 Mar. (78) 3 Tues. 260-9131 5 Thur.. 4 26 0 7 Mar. (66) Sat. . 136-5965 6 Fri. . 10 37 30 26 Mar. (85) 6 Fri. 171.2360 O Sat. 16 500 15 Mar. (74) 3 Tues. 46-9195 1 Sun. . 23 2 30 4 Mar. (64) . 1 Sun. 261.2348 3 Tues. 15 0 23 Mar. (82) Sat. . 295-8744 4 Wed. . 11 27 3012 Mar. (71) 4 Wed.. 171-5578 5 Thur. . 17 0 1 Mar. (60) 1 Sun. 47.2411 6 Fri. 30 19 Mar. (79) . O Sat. 1 81.8807 1 Sun. 609 Mar. (68) 5 Thur.. 296-1960 2 Mon. . 12 17 30 26 Feb. (57) 2 Mon. . 171-8794 3 Tues. 18 30 0 17 Mar. (78) 1 Sun. 206-5190 5 Thur. 42 30 5 Mar. (65) 5 Thur.. 82.2024 8 Fri. 55 0 21 Mar. (83) 4 Wed.. 116-8420 O Sat. 13 30 14 Mar. (73) 2 Mon. 331.1573 1 Sun. 19 0 3 Mar. (62) . 6 Fri. . 206-8407 3 Tues. 50 21 Mar. (81) .. 5 Thur.. 241.4803 4 Wod.. 7 45 010 Mar. (69) 2 Mon 117-1637 6 Thur.. 13 30 28 Feb. (69) O Sat 331-4790 6 Fri. 20 10 0 18 Mar. (77) 27-4867 4233 25 Mar (85) af. (85) . . .23 4234 4235 .18 4238 4237 26 Mar. (85) 26 Mar. (85) 26 Mar. (85) 28 Mar. (86) 26 Mar. (85) 26 Mar. (85) 26 Mar. (85) 26 Mar. (86) 26 Mar. (85). 26 Mar. (85). 26 Mar. (85) 4238 4239 4240 4241 4242 4243 4244 6245 6 Thur..
Page #101
--------------------------------------------------------------------------
________________ 78 Kali. Saka. Chaitradi Vikrama. Meshadi solar year 3a CONCURRENT YEAR. Kollam. EPIGRAPHIA INDICA. 4 A.D. 5 JOVIAN SAMVATSARA. 1147-48 Southern system. *1144-45 58 Raktaksha 1145-46 59 Krodhana 1146-47 60 Kshaya 1 Prabhava 1148-49 1149-50 1150-51 1151-52 6 " . . Northern system. . 7 323-24 2 Vibhava 324-25 3 Sukla 325-26 4 Pramoda 5 Prajapati *1152-53 6 Angiras 558 326-27 559 327-28 -560 328-29 561 329-30 1153-54 7 Srimukha 8 Bhava. 4246 1067 1202 551 319-20 4947 1068 1203 552 320-21 4948 1069 1204 553 321-22 4249 1070 1205 554 322-23 4950 1071 1206 $55 4251 1072 1207 556 4252 1073 1208 557 4253 1074 1209 4354 1075 1210 4255 1076 1211 4256 1077 1212 1154-55 4257 1078 1213 562 330-31 1155-56 4256 1079 1214 563 331-32 1156-57 10 Dhatri. 4259 1080 1215 564 332-33 4260 1081 1216 565 333-34 4281 1082 1217 566 334-35 4262 1083 1218 567 335-36 4263 1084 1219 568 336-37 4264 1085 1220 569 337-38 4265 1086 1221 570 338-39 1087 1222 571 339-40 1164-65 18 Tarana 1165-66 19 Parthiva 9 Yuvan. 12 Bahudhanya. 10 Pausha 13 Pramathin 1157-58 11 Iavara. 14 Vikrama 1158-59 12 Bahudhanya. 15 Vrisha. 1159-60 13 Pramathin 1160-61 14 Vikrama 1161-62 15 Vrisha 1162-63 16 Chitrabhanu 19 Parthiva 20 Vyaya. 1163-64 17 Subbanu 21 Sarvajit 22 Sarvadharin 4266 4267 1088 1223 572 340-41 4268 1089 1224 573 341-42 4209 1090 1995 574 342-43 4370 1001 1226 575 343-44 1168-09 22 Sarvadharin. 26 Nandana 23 Virodhin 24 Vikrita. 1166-67 20 Vyaya. 1167-68 21 Sarvajit 25 Khara 18 Tarapa was suppressed in the north. ! Prabhava 2 Vibhava 3 Sukla 4 Pramoda 5 Prajapati 6 Angiras 7-Srimukha 8 Bhava. 9 Yuvan. 10 Dhatri 11 Ievara 16 Chitrabhanu. 17 Subbanu [VOL. XVII ... TABLE Mean Intercalated (adhika) lunar month. Fa 12 Phalguns 9 Margasira. 5 Sravana 2 Vaisakha 7 Asvina 3 Jyeshtha 12 Phalguna 8 Karttika .
Page #102
--------------------------------------------------------------------------
________________ No. 6.) THE FIRST ARYA SIDDHANTA MEAN SYSTEM. 79 LXXVI-Contd. 1 Arya Siddhinta, mens system. COMMENCEMENT OF THE MBAN SOLAR YEAR. MEAN LUNI-HOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUELA 1 ENDS). Kali year. Day and month, A.D. Time of Week-day. mean Mesha tamkranti. Day and month. A.D. Week day. (here=t, the index of the tithi). 13 17 1 19 2009 23 4246 241-8019 276-4415 4247 152-1249 4248 3 Tues. . 2 Mon.. B Fri. 3 Tues. . 2 Mon. . O Sat. 27-8084 424P 62-4479 (260 4251 4262 276-7631 152-4486 187-0861 62-7696 1288 277-0848 4256 4266 311-7245 187-4078 4267 26 Mar. (86) 28 Mar. (85) . 26 Mar. (85) 26 Mar. (85) 26 Mar. (86) Mar. (85) 26 Mar. (85) . 26 Mar. (85) 26 Mar. (86) . 26 Mar. (85) . Mar. (85). 26 Mar. (85) 26 Mar. (86). 26 Mar. (85) 26 Mar. (85) . 26 Mar. (85) . 26 Mar. (86) 26 Mar. (85). 26 Mar. (85) . 27 Mar. (86) . 26 Mar. (86) . 26 Mar. (85). 26 Mar. (85) . 27 Mar. (86) . 26 Mar. (86) . H.M.S. 1 Sun. . 2 22 30 7 Mar. (87) . 2 Mon. . 8 35 0 20 Mar. (85) 3 Tues. 15 Mar. (74) . 4 Wed. O 0 4 Mar. (63) 6 Fri. 30 22 Mar. (82) 0 Sat. 925 012 Mar. (71) . 1 Sun. . 15 37 30 1 Mar. (60) | 2 Mon. 21 60 0 20 Mar. (79) . 4 Wed. 2 30 8 Mar. (68) 5 Thur. . 10 15 0 28 Feb. (57) 6 Fri. 16 27 3017 Mar. (76) O Sat. . 22 40 0 8 Mar. (65) . 2 Mon.. 52 30 24 Mar. (84) . 3 Tues. . 11 5 0 13 Mar. (72) . 4 Wed. . 17 17 30 3 Mar. (62) . 5 Thur.. 021 Mar. (80) O Sat. 30 10 Mar. (70) . 1 Sun. 0 27 Feb. (58) 2 Mon. 18 7 30 18 Mar. (77) . 4 Wod. . 2007 Mar. (66) . 5 Thur.. 6 32 30 25 Mar. (85) r2 46 0 15 Mar. (74) . O Sat. 18 57 30 4 Mar. (63) . 2 Mon. 1 10 0 23 Mar. (82) . 3 Then.. 7 22 30 11 Mar. (71) 222-0474 4268 98-1308 4209 312-0461 4200 8-0538 1261 .3 Tues.. O Sat. . . 6 Thar.. 4 Wed. . 1 Sun. Sat. 4 Wed.. 2 Mon.. 0 Sat. . 6 Thur.. . 2 Mon.. 1 Sun. 6 Thur.. . 4 Wed.. . 2 Mon.. 8 Fri. . 6 Thur.. . 2 Mon.. 222-3691 1282 4283 98-4525 132-6822 4284 8-3755 4286 4286 43-0151 8 Fri. 257-3504 4287 133-0138 4208 1289 167-8434 43-3368 1970
Page #103
--------------------------------------------------------------------------
________________ 80 Kali. Saka. 2 Chaitradi Vikrama. Meshadi solar year in Bengal. 3 3a CONCURRENT YEAR Kollam. EPIGRAPHIA INDICA. 4 A.D. 5 JOVIAN SAMVATSARA. Southern system. 6 . * Northern system. . 7 27 Vijaya. 28 Jaya 29 Manmatha 30 Durmukha 31 Hemalamba 32 Vilamba 4271 1092 1227 576 344-45 1169-70 23 Virodhin 4272 1093 1228 577 345-46 1170-71 24 Vikrita. 4273 1094 1229 578 346-47 1171-72 25 Khara. 4274 1095 1230 579 347-48 1172-73 26 Nandana 4275 1096 1231 580 348-49 1173-74 27 Vijaya. 4276 1097 1232 581 349-50 1174-75 28 Jaya 4277 1098 1233 582 350-51 1175-76 29 Manmatha 33 Vikarin 4278 1099 1234 583 351-52 *1176-77 30 Durmukha. 34 Sarvarin 4279 1100 1235 584 352-53 1177-78 31 Hemalamba. 35 Plava. 1101 1236 585 353-54 1178-79 32 Vilamba 36 Subhakrit 4281 1102 1237 586 354-55 37 Sobhana 4282 1103 1238 587 355-56 4283 1104 1239 588 356-57 1105 1240 589 4280 1179-80 33 Vikarin *1180-81 34 Sarvarin 38 Krodhin 1181-82 35 Plava. 39 Visvavasu 40 Parabhava 12 Phalguns 4284 357-58 4285 1106 1241 590 358-59 1182-83 36 Subhakrit 1183-84 37 Sobhana 4286 1107 1242 591 359-601184-85 38 Krodhin 4287 1108 1243 4288 4289 4290 592 360-61 1109 1244 593 361-62 1110 1245 594 362-63 1111 1246 595 363-64 4201 1112 1247 596 364-65 4292 1113 1248 597 365-66 4293 1114 1249 598 366-67 4294 1115 1250 599 367-68 4295 1116 1251 600 368-69 * 41 Plavanga 42 Kilaka. 43 Saumya 1185-86 39 Visvavasu 1186-87 40 Parabhava 44 Sadharana 1187-88 41 Plavanga 45 Virodhakrit 1188-89 42 Kilaka. 46 Paridhavin 1189-90 43 Saumya 47 Pramadin 1190-91 44 Sadharana 48 Ananda 1191-92 45 Virodhakrit 40 Rakshasa 1192-93 46 Paridhavin. 50 Anala. 1193-94 47 Pramadin 51 Pingala * [VOL. XVII. * TABLE Mean Intercalated (adhika) lunar month. 8a 5 Sravana *** 2 Vaisakha 10 Pausha 7 Asvina 3 Jyeshtha 8 Karttika ... 5 Sravana 1 Chaitra ... 10 Pausha *
Page #104
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. LXXVI-Contd. 1 Arya Siddhanta, mean system. COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA I ENDS). Kali year. Day and month, A.D. Time of Week-day. mean Misha Day and month, A.D. samkranti Week day. a (here=t, the index of the tithi). 17 19 20 23 257-6521 4271 292-2917 4272 167-9751 4273 43-6684 4274 78-2981 4275 4276 292-6133 327-2528 202.9372 4277 4278 4279 78-6196 113-2593 4280 4281 26 Mar. (85) . 26 Mar. (85) 27 Mar. (86) . 26 Mar. (86) . 26 Mar. (85) . 26 Mar. (85) 27 Mar. (86) . 26 Mar. (86) 26 Mar. (85). 26 Mar. (85) . 27 Mar. (86) 26 Mar. (86) 26 Mar. (85). 26 Mar. (85) 27 Mar. (88) . 26 Mar. (86) 26 Mar. (85) . 26 Mar. (85). 27 Mar. (86) 26 Mar. (86). 26 Mar. (85) . 28 Mar. (85) 27 Mar. (86) . 26 Mar. (86) 26 Mar. (85). H.M.S. 4 Wed 13 36 0 1 Mar. (60) 5 Thur.. 19 47 30 20 Mar. (79) . Sat. . 200 9 Mar. (68) . 1 Sun. 8 12 30 28 Feb. (57) 2 Mon. . 26 0 16 Mar. (75) 3 Tues.. 37 306 Mar. (65) 1 5 Thur.. 25 Mar. (84) 6 Fri. . 2 30 13 Mar. (73) Jo Sat. 16 16 0 2 Mar. (61) . 1 Sun. 21 21 Mar. (80) 3 Tues.. 3 40 0 11 Mar. (70) | 4 Wed.. 9 52 30 28 Feb. (59) . 5 Thur.. 6 018 Mar. (77) 6 Fri. . 22 17 30 7. Mar. (68) . 1 Sun. . 430 026 Mar. (85) 2 Mon. . 10 42 30 14 Mar. (14) 3 Tues. . 18 55 04 Mar. (63) 4 Wod.. 30 23 Mar. (82) 12 Mar. (71) . O Sat. . 30 20 Feb. (60) . 1 Sun. . 0 19 Mar. (78) 2 Mon. 9 Mar. (68) . 4. Wed.. 26 Feb. (57) . 5 Thur.. 3016 Mar. (76) 6 Fri. . 35 0 5 Mar. (64) . Sat. . 8 Fri. . 3 Tues. Sat. . 6 Fri. 4 Wed. . 3 Tues. Bat. . 4 Wed. 3 Tues. . . 1 Sun. 6 Thur. 4 Wed.. . 1 Sun. . O Sat. 4 Wed. 2 Mon. . 1 Sun. 6 Thur. 2 Mon. 1 Sun. .6 Fri. .3 Tues. 2 Mon. Fri. 327-5745 203-2579 237-8975 4282 4283 4284 4285 113-5809 148-2205 00). . 23-9039 4286 238-2192 4287 272-8588 4288 6 Fri. 148-5422 4283 24-2256 4290 58-8452 4291 4292 273-1805 148-8638 4293 183-5035 4294 4295 59-1868
Page #105
--------------------------------------------------------------------------
________________ 82 EPIGRAPHIA INDICA. (VOL. XVIL TABLE CONCURRENT YEAR. JOVIAN SALVATSARA. Kali. Moan Intercalated (adhika) lunar month. Saka Chaitradi Vikrama. Meshadi solar year Kollam. A.D. in Bengal. Southern system. Northern system. 7 w 1296 1117 6 Bhadrapada 3 Jyeshtha 11 Magha 1252 1.601 1253 1254 1255 1256 1257 1258 1259 608 1200 1261 1262 1263 1264 1265 614 4297 1118 4298 1119 4299 1120 4300 1121 4301 1122 4302 1123 4908 1124 4304 1125 4305 1126 4806 1127 1307 1128 43081 1129 4309 1130 4310 1131 1311 1132 4312 1133 4313 1134 1135 1136 4316 1137 4317 1138 4318 1139 4319 1140 & Karttika 613 369-70 370-71 371-72 972-73 373-74 374-76 375-76 376-77 377-78 378-79 379-80 380-81 381-82 382-83 383-84 384-85 885-86 886-87 387-88 388-89 389-90 320-91 391-92 392-93 393-94 1194-98 48 Ananda 1196-96 49 Rakshasa *1196-97 50 Anala 1197-98 61 Pingala 1198-99 52 Kalayukta 1199-00 63 Siddharthin. *1200-01 54 Randra 1201-02 55 Durmati 1202-03 56 Dundubhi 1203-04 57 Rudhirddgarin *1204-05 58 Raktaksha . 1206-06 69 Krodhana 1206-07 60 Kshaya 1207-08 1 Prabhava *1208-00 2 Vibhava . 1209-10 3 Sukla . . 1210-11 4 Pramoda 1211-12 6 Prajapati *1212-13 6 Angiras 1216-14 7 Srimukha . 1214-15 8 Bhiva. . 1216-16 9 Yuvan . . *1216-17 10 Dhatci . . 1217-18 11 Isvars . . 1218-19 | 12 Bahadhanya . 52 Kilayukta . 63 Siddharthin. 54 Randra . 66 Durmati . 56 Dandubbi . 67 Radhirddgarin 58 Raktakshs . 59 Krodhana 60 Kshaya . 1 Prabhava . 2 Vibhava : 3 Sukis. 4 Pramoda . 5 Prajapati 6 Angiras 7 Srimukha . 8 Bhava . . 9 Yuvan 10 Dhatri u Isvara. . 12 Bahudhanya . 13 Pramathin 14 Vikrams 10 Vrisha. 16 Chitrabhanu . 6 Sravaga . 1266 615 1267 616 1 Chaitra 1208 1269 1314 10 Pausha . 1270 1271 4316 1212 6 Bhadrapada 1275 4320 1276 3 Jycahtha .
Page #106
--------------------------------------------------------------------------
________________ No. 6.) THE FIRST ABYA SIDDHANTA, MEAN SYSTEM. LXXVI-Contd. 1 Arya Siddhanta, mean system. COMMENCEMENT OF THE MEAN SOLAR YEAR MEAN LUNI-SOLAR YEAR (XEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Kali year. Day and month, A.D. Time of Week-day. mean Mesha samkranti. Day and month, A.D. Week-day, . (here=t, the index of the tithi). 20 23 93-8284 5 Thur.. 3 Tues.. Bat. . 308-1417 . 183-8251 218-4647 4 Wed.. 6 Pri. 94.1481 4290 4207 4298 4290 4300 4301 4309 4903 4304 4306 308-4634 3 Tues.. 1 Sun. . 6 Fri. 4 Wed. 3 Tues.. Bat. . Wed.. 4-4711 218-7864 253-4359 129-1004 . 4-7927 4300 27 Mar. (86) . 27 Mar. (86). 26 Mar. (86). 26 Mar. (85) 27 Mar. (86) 27 Mar. (86) . (86) 26 Mar. (85) . 27 Mar. (86) . 27 Mar. (88) . 26 Mar. (86) . 28 Mar. (85) . 27 Mar. (86) . 27 Mar. (86) . 28 Mar. (88) . 28 Mar. (85) . 27 Mar. (86) 27 Mar. (88) . 28 Mar. (86) . 26 Mar. (85). 27 Mar. (86) 27 Mar. (86) . 26 Mar. (86) . 26 Mar. (85) 27 Mar. (86) . 17 H. M. s. . 1 Sun. 47 3024 Mar. (83) 2 Mon.. 7 0 14 Mar. (73) 3 Tues. . 13 12 30 2 Mar. (62) .. 19 26 21 Mar. (80) 6 Fri. 37 3) 10 Mar. (69) . 0 Sat. . 7 60 28 Feb. (59) 1 Sun. 14 2 30 17 Mar. (77) . 2 Mon. 2015. 0 7 Mar. (86) . 4 Wed. 2 27 30 28 Mar. (85) . 5 Thur. .. 8 40 0 18 Mar. (74) . 6 Fri. . 14 52 30 3 Mar. (63) . o sat. . 21 022 Mar. (81) . 2 Mon. 30 12 Mar. (71) . 3 Tues.. . 01. 1 Mar. (00) . 4 Wed. 15 19 Mar. (79) . 8 Thur. 21 08 Mar. (67) . 80 26 Feb. (67) . 1 Sun. 10 017 Mar. (76) . 2 Mon. . 16 30 6 Mar. (65) 3 Tues. . 22 24 Mar. (83) 8 Thur.. 8013 Mar. (72) . 6 Fri. 03 Mar. (62) . Bat. 17 30 21 Mar. (81) 010 Mar. (89) 3 Tues. . 47 30 27 Feb. 088) 39-4324 3 Tues. 1 Sun. . . 4807 4308 263-7477 1300 129-4311 164-0707 4310 4311 39-7540 o Sat. 1 204.0693 4819 4313 289 7089 164-3923 5 Thur.. . 4 Wad. 1 Bun. . 6 Fri. 5 Thur. 2 Men. 1 Sun. Thur. 3 Tues. 2 Mon. Fri. .Tues. 199-0319 74.7152 289-0306 323-6702 199-3535 76-0369 4314 4316 4316 4317 4318 4319 4320 2.1 L 2
Page #107
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [Vol. XVII. 11 TABLE CONCURRENT YEAR. JOVIAN SAKYATSARA. Mean Kali. Saka Chaitradi Vikrama. Mesbadi solar year in Bengal. Intercalated (adhika) lunar month. Kollam. A.D. Southern system. Northern system. 4321 4322 4323 628 1142 1143 1144 1145 1146 1147 1148 1149 1277 1278 1279 1280 1281 1282 4324 4325 4326 4327 1283 632 4328 4329 1150 4330 635 4331 1284 1285 1286 1287 1288 1289 1290 1151 1152 1153 1154 1155 4332 4333 626 394-95 1219-2013 Pramathin. 627 395-96 *1220-21 14 Vikrama 396-97 1221-22 15 Vrisha . . 297-98 1222-23 16 Chitrabhanu. 398-99 1223-24 17 Subhanu 399.00 *1224-25 18 Tarana . 400-01 1226-26 19 Parthiva 401-02 1226-27 20 Vyaya . . 402-03 1227-28 21 Sarvajit 403-04 *1228-29 22 Sarvadharin. 404-05 23 Virodhin 405-06 1230-31 24 Vikrita . . 406-07 1231-32 25 Khara . . 407-08 *1232-33 26 Nandana 640 408-09 1233-34 27 Vijaya . . 641 409-10 1234-35 28 Jaya . . 642 410-11 29 Manmatha 643 | 411.12 | *1236-37 30 Darmukha 412-13 1237-38 31 Hemalambs 413-14 1238-39 32 Vilamba . 646 414-15 1239-4033 Vikarin 415-16 *1240-41 34 Sarvarin 416-17 1241-42 35 Plays. . 417-18 1242-43 36 Subbakrit 1243-44 37 Sobhana 638 17 Subhanu 18 Tarapa. .11 Magha 10 Parthiva 20 Vyaya . . 21 Sarvajit 8 Karttika 22 Sarvadharin. 23 Virodhin 24 Viktits . . 4 Ashadha . 25 Khara . . 26 Nandana 27 Vijaya 1 Chaitra 28 Jays 1 29 Manmatha . 9 Margasira. 30 Durmukhs. 31 Hemalamba. 32 Vilamba 6 Bhadrapada 33 Vikarin 34 Sarvarin 35 Plavs 2 Vaibakba. 36 Subhaksit 37 Sobhana 11 Magba 38 Krodhin 39 Visvivasu . 40 Parabhava . 7 Asvina 41 Plavanga 4334 639 4335 i 1158 1291 4336 1157 4337 1158 1292 1293 1294 1295 4338 1159 4339 1160 644 4340 1161 1296 4341 1162 1297 4342 1163 1298 4343 1164 1299 4344 1165 1166 1300 1301 4345 418-19
Page #108
--------------------------------------------------------------------------
________________ No.6.] THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. LXXVI--Contd. 1 Arya Siddhanta, mean system. COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Kali year. Day and month, A.D. Week-day. Time of mean Meha. Day and month. onth, A.D. samkranti Week-day, (here=1 the index of the tithi). 19 23 109-6765 4321 323-9918 4322 19-9995 4323 234-3148 4324 109.9982 4325 144-6378 20-3212 27 Mar. (86) 26 Mar. (86). 27 Mar. (86). 27 Mar. (86) 27 Mar. (86) . 26 Mar. (86) 27 Mar. (86) . 27 Mar. (86) . 27 Mar. (86) . 26 Mar. (86) 27 Mar (86). 27 Mar. (86) . 27 Mar. (86) . 26 Mar. (86) 27 Mar. (86) 27 Mar. (86) . 27 Mar. (86) 234-6365 269-2761 4326 4327 4328 4329 4330 4331 144-9594 20-6428 14 17 20 H.M.S. 4 Wed. O 018 Mar. (77) 2 Mon.. 5 Thur.. 12 30 7 Mar. (67) O Sat. . . 0 Sat. 25 025 Mar. (84) 5 Thur. 1 Sun. 6 37 3015 Mar. (74) 3 Tucs.. . 2 Mon. . 12 50 0 4 Mar. (63) O Sat. . : 3 Tues.. 19 2 30 22 Mar. (82) . 6 Fri. . 5 Thur. 115 011 Mar. (70) 3 Tues. . . 6 Fri: . 7 27 30 1 Mar. (60) 1 Sun. . . O Sat. . 13 40 0 20 Mar. (79) O Sat. . 1 Sun. ..19 52 30 8 Mar. (68) 4 Wed. . 3 Tues. . 2 5 0 25 Feb. (56) 1 Sun. . 4 Wed.. 8 17 30 16 Mar. (75) . 0 Sat. . 5 Thur. . 14.30 0 8 Mar. (65) 5 Thur. . 6 Fri. 24 Mar. (84) 4 Wed. . . 1 Sun. . 13 Mar. (72) . 1 Sun. . 2 Mon. 7 30 2 Mar. (61) Thur.. 3 Tues. 021 Mar. (80) 4 Wed. 4 Wed. 32 3010 Mar. (70) 2 Mon.. 6 Fri. 27 Feb. (58) 6 FH. O Sat. 57 30 18 Mar. (77) 5 Taur.. 1 Sun. 07 Mar (66). 2 Mon. 2 Mon. 22 30 25 Mar (85) 1 Sun. 4 Wed. 35 0 14 Mar. (73) 5 Thur. 5 Thur.. 10 47 30 4 Mar. (63) . 3 Tuos. . 8 Fri. . 17 0 0 | 23 Mar. (82) . 2 Mon. 4332 4333 55-2824 269-5977 304-2373 179-9207 55-6041 4334 4335 4336 90-2437 4337 26 Mar. (86) 304-5590 4338 4339 180-2424 214.8820 4340 90-5654 4341 27 Mar. (86) 27 Mar. (86) 27 Mar. (86) Mar. (86) 27 Mar. (86) Mar. (86) 27 Mar. (86) . 125-2049 0-8884 4342 4343 4344 4345 215-2037 249-8433
Page #109
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [Vol. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kall, Mean Intercalated (adhika) lunar month. Saka. Chaitradi Vikrama. Meshadi solar year in Bengal. Kollam. A.D. Southern system. Northern system. 12 7 8a 4346 1167 1168 1802 1303 1304 4347 4348 4 Ashadha . 1189 4349 1306 4350 1306 Chaitrs 4351 4352 1170 1171 1172 1173 1174 1176 1176 9 Margasira. 1307 1308 1309 1310 4353 4364 1311 6 Bhadrapada 4358 4356 1177 1312 1313 1178 4357 4358 1179 419-20 *1244-46 38 Krodhin 42 Kilaks . . 420-21 1245-46 39 Visvavasu 43 Saumyat . 421-22 1246-47 40 Parabhavs . 46 Virodhakrit. 422-23 1247-48 41 Plavanga 46 Paridhavin . 423-24 1248-49 42 Kilaks 47 Pramadin i 424-25 1249-6043 Saumya. 48 Ananda 425-26 1260-61 44 Sadharana 49 Rakshasa 426-27 1251-52 45 Virddhakrit. 50 Anala. 427-28 *1252-63 46 Paridhavin . 51 Pingala 428-29 1263-64 47 Pramadin : 52 Kalayukta 429-30 1254-56 48 Ananda 53 Siddharthin 430-31 1256-66 49 Rakshasa . 54 Raudra 431-32 *1256-57 50 Anala. 56 Durmati 432-33 1257-58 01 Pingala 66 Dundubhi . 433-34 1258-89 62 Kalayukta 57 Rudhirodgarin 434-35 1259-60 63 Siddharthin. 58 Raktaksha i 435-36 *1260-61 54 Raudra 59 Krodhana . 436-37 1261-62 56 Durmati 60 Kshaya . 437-38 1262-63 56 Dundubhi . I Prabhava 438-39 1263-64 57 Rudhirodgarin 2 Vibhava . 439-40 *1264-66 58 Raktaksha . 3 Sukls. 440-41 1266-66 59 Krodhana . 4 Pramoda . 441-42 1266-6760 Kshaya 6 Prajapati 442-43 1267-68 1 Prabhava 8 Angiras *1268-69 2 Vibhava 7 Srimukha 2 Vaisakha. 4359 4360 11 Magha 4361 4862 1318 1180 1316 1181 1316 1182 1397 1183 1184 1319 1186 1320 1321 11871 1322 4863 7 Abvins 1186 4364 4366 4366 4367 4 Asbadba. 1188 1323 4368 12 Phalguna. 4369 1189 1190 1191 1324 1326 1326 4370 1 44, Bidharaga, was suppressed in the north by the mean system, but 45 Virodhak it by the true system. By the latter system the year A.D. 1246-47 was called in the north, "Sadharapa."
Page #110
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. LXXVI-Contd. 1 Arya Siddhanta, mean system. COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA I ENDE). Kali year. Day and month, A.D. Time of Week-day. mean Menha samkranti. Day and month, A.D. Week-day. a (here=t, the index of the tithi). 13 17 19 20 23 125-5266 4346 . . 2 Mon. . 4347 1-2100 35-8196 250-1649 4348 4349 125-8482 4350 . 160-4878 . . . . . . 4351 36-1712 4352 70-8109 4353 . . 285-1262 4354 160-8095 4356 195-4491 4356 . . 71.1325 26 Mar. (86) . 27 Mar. (86) . 27 Mar. (86) 27 Mar. (88) . 27 Mar. (87) . 27 Mar. (86) 27 Mar. (86) 27 Mar. (86) . 27 Mar. (87). 27 Mar. (86) 27 Mar. (86). 27 Mar. (86) 27 Mar. (87) . 27 Mar. (86) 27 Mar. (86) 27 Mar. (86) 27 Mar. (87) . 27 Mar. (86) 27 Mar. (86) 27 Mar. (86) : 27 Mar. (87). 27 Mar. (88) 27 Mar. (86) 27 Mar. (86) . 27 Mar. (87). 6 Fri. . 3 Tues.. 2 Mon. . 0 Sat. 4 Wed. 3 Tues. O Sat. 6 Fri. : 4 Wed. 1 Sun. . 0 Sat. 4 Wed. 2 Mon.. 1 Sun. . 6 Thur. 4 Wed.. 1 Sun. 6 Fri. 4 Wed. 2 Mon. . 6 Fri. 5. Thur. 4357 M. S. O Sat. 12 30 11 Mar. (71) 28 Feb. (59) 3 Tues. 11 37 30 19 Mar. (78) 4 Wed. 17 50 0 9 Mar. (68) 6 Fri. 2 30 26 Feb. (57) Sat. 15 0 16 Mar. (75) 1 Sun. . 12 27 305 Mar. (64) 2 Mon. 18 40 0 24 Mar. (83) 4 Wed. . O 62 30 13 Mar. (73) 5 Thur.. 7 5 0 2 Mar. (61) 6 Fri. . 13 17 30 21 Mar. (80) O Sat. 19 30 0 10 Mar. (69) 2 Mon.. 1 42 30 28 Feb. (59) 3 Tues...755 0 18 Mar. (77) 4 Wed. . 14 7 307 Mar. (66) 5 Thur.. 0 26 Mar. (85) 0 Sat. 3014 Mar. (74) 1 Sun. 4 Mar. (63) 2 Mon.. 30 22 Mar. (81) 3 Tues... 0 12 Mar. (71) 22 30 29 Feb. (60) 8 Fri. 19 Mar. 678) o Sat. 8 Mar. (67) 1 Sun. 0 27 Mar. (86) 3 Tues. 4 19 30 16 Mar. (78) . 4358 285-4478 320-0874 4359 195-7708 4360 . . . 230-4104 4361 4362 106-0938 320-4091 4363 16-4168 4384 4365 230-7321 5 Thur. 108-4155 141.0651 4366 4367 4369 2 Mon. 16-7384 1 Sun. 61.3780 4309 . . . 6 Fri. . 265-6934 4370
Page #111
--------------------------------------------------------------------------
________________ EPIGRAPHII INDICA. [Vol. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Mean Intercalated (adhika) lunar month. Saka. Chaitradi Vikrama. Meshadi solar year in Bengal. A.D. Southern system. Northern system. w 5 4371 1192 1327 676 677 +372 1193 1328 1194 1329 4373 4374 1195 1330 679 4375 1196 1331 1197 1332 4376 4377 1198 450-51 4378 1199 1333 1334 1335 4379 1200 4380 1201 1336 4381 1202 1337 4382 1203 1338 4383 1204 1339 414-45 1269-70 3 Sukla, 8 Bhava. 9 Margasira. 445-46 1270-714 Pramoda 9 Yuvan. . 446-47 1271-72 5 Prajapati . 10 Dhatri . . 447-48 *1272-73 6 Anyiras 11 Isvara 15 Sravana. 448-49 1273-74 7 Sriniukha 12 Bahudhanya . 449-50 1274-75 8 Bhava. | 13 Pramathin 1275-76 9 Yuvan. . 14 Vikrama 2 Vaisakha. 451-52 *1276-77 10 Dhatri . . 15 Vpisha . . 452-53 1277-78 11 Isvara . 16 Chitrabhanu. 10 Pausha . 453-54 1278-79 12 Babudhanya. 17 Subhanu 454-55 1279-80 13 Pramathin . 18 Taraps. 455-56 *1280-81 14 Vikrama . 19 Parthiva 7 Asvina 456-57 1281-82 15 Vrisha. 20 Vyaye . . 457-58 1282-83 16 Chitrabhanu . 21 Sarvajit 458-59 1283-84 17 Subhanu . 22 Sarvadharin. 4 Astridba . 459-60 *1284-8518 Tarana . 23 Virodkin 460-61 1285-86 19 Parthiva 24 Vikrita. i 461-62 1286-87 20 Vyaya . . 25 Khara . 462-63 1287-88 21 Sarvajit . 26 Nandana . 463-64. *1288-89 22 Sarvadharin. 27 Vijaya . . 9 Margasira. 464-65 1289-90 23 Virodhin 28 Jaya . . 465-66 1290-91 24 Vikrita . . 29 Manmatha . 466-67 1291-92 25 Khara . . 30 Durmukha 5 Srivana . 467.68 *1292-93 26 Nandana . 31 Hemalamba. 468-69 1293-94 27 Vijaya. 32 Vilamba 4384 1205 1340 680 4385 1206 1341 1342 690 691 4386 1207 4387 1208 1343 892 4388 1209 1344 693 694 4389 1210 1345 1346 4390 1211 4391 4392 1348 4393 4394 1214 1340 1215 1360 12161351 4395 700
Page #112
--------------------------------------------------------------------------
________________ No. 6.) THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. LXXVI-Cortd. 1 Arya Siddhanta, mean system, COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA I ENDS). Kali year. Day and month, A.D. Time of Week-day. mean Mesha samkranti. Day and month, A.D. Ia (here=t, Week-day. the index of the tithi). 13 17 19 20 23 141-3767 4371 176-0164 4372 51.6998 4373 266-0150 4374 300-6546 4375 176-3380 4376 52-0213 4377 86-6609 4378 300-9762 4379 9996-9840 4380 211-2992 4381 27 Mar. (86) . 27 Mar. (86) . 27 Mar. (86) . 27 Mar. (87). 27 Mar. (86) . 27 Mar. (86) . 27 Mar. (86). 27 Mar. (87) 27 Mar. (86) . 27 Mar. (86) . 28 Mar. (87). 27 Mar. (87) 27 Mar. (86) 27 Mar. (86) 28 Mar. (87) 27 Mar. (87) 27 Mar. (86) . 27 Mar. (86) 28 Mar. (87) 27 Mar. (87) 27 Mar. (86) . 27 Mar. (86) 28 Mar. (87). 86-9826 4382 H.M. . 4 Wed. . 10 25 0 5 Mar. (64) . 5 Thur.. 16 37 30 24 Mar. (83) 6 Fri. . 22 50 0 13 Mar. (72) . I Sun. 5 2 30 2 Mar. (62) . 2 Mon. 15 0 21 Mar. (80) . 3 Tues. . 17 27 3010 Mar. (69) 1 4 Wed. . 23 40 0 27 Feb. (58) 6 Fri. 17 Mar. (77) Sat. 507 Mar. (66) . 1 Sun. . 18 17 30 25 Mar. (84) I 3 Tues. . 030 0 15 Mar. (74) 4 Wed. . 6 42 303 Mar. (63) 5 Thur.. 12 55 0 22 Mar. (81) 0 Fri. 19 7 30 | 11 Mar. (70) 1 Sun. 0 1 Mar. (60) 2 Mon. 80 19 Mar. (79) . 3 Tues. 45 0 8 Mar. (67) . 4 Wod. . 19 67 30 27 Mar. (86) 6 Tri. . 2 10 0 16 Mar. (75) 8 22 30 5 Mar. (65) . 1 San... | 14 350 24 Mar. (83) 2 Mon. . 20 3013 Mar. (72) . 4 Wed. 2 Mar. (61) . 9 12 30 20 Mar. (80) 1 6 Fri. . 15 25 10 Mar. (69) . 3 Tues. . . Mon. . 6 Fri. . 4 Wed.. 3 Tues. O Sat. 4 Wed. 3 Tues. 1 Sun. 6 Fri. . 4 Wed. . 1 Sun. 0 Sat. 4 Wed. 2 Mon. 1 Sun. 5 Thur. 4 Wed. 1 Sun. 6 Fri. 5 Thur. 2 Mon. 6 Tri. 5 Thur.. 3 Tues. 121.6222 4383 9997-3056* 4384 211-6209 4385 246-2605 4386 13 121.9439 4387 156-5834 4388 32.2669 4389 246-5821 4390 281-2218 4391 156-9051 4392 32.5885 4303 67-2281 4394 4395 27 Mar. (86). 281-5434 * As a mean tithi Chaitra Sukla I was expungod. The civil day corresponding to it, i.e., the first day of the luni-solar year was as given in cols. 19, 20,
Page #113
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [Vol. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Mean Intercalated (adhika) lunar month. Saka. Chaitradi Vikrama. Moshadi solar year Kollam. A.D. Southern system. Northern system. 6. 4396 2 Vaibikha 4397 4398 10 Pausha 4399 1355 4400 1356 1217 1352 1218 1383 1219 1354 1220 1221 1222 1357 1223 1358 1224 1359 1225 1860 1228 1361 4 101 7 Abvina 4402 4403 4404 3 Jyeshtha. 4405 4 406 1927 1382 12 Phalguna. 4407 1228 1229 1303 1364 4408 469-70 470-71 471-72 472-73 473-74 474-75 475-76 708 476-77 477-78 710478-79 479-80 480-81 481-82 482-83 483-84 716 484-86 485-86 486-87 487-88 488-89 489-90 490-91 491-92 492-93 493-64 1294-95 28 Jaya . . 33 Vikarin 1295-96 29 Manmatha . 34 Sarvarin . *1296-97 30 Durmukha 35 Plate 1297-98 31 Hemalamba . 36 Sublakrit . 1298-99 32 Vilamha 37 Sobhana 1209.00 33 Vikarin 38 Krodhin *1300-01 34 Sarvarin 39 Visvavasu . 1301-02 35 Plava: 40 Parabhava 1302-03 38 Subhakrit 41 Plaranga 1308-04 37 Sobhana 42 Kilaka. *1304-06 38 Krodhin 43 Saumya 1305-06 39 Visvavasu . 44 Sidharana . 1306-07 40 Parabhava .45 Virodhaksit . 1307-08 41 Plavanga 46 Paridhavin . *1308-09 42 Kilaka. 47 Pramadin . 1309-10 43 Saumy. 48 Ananda 1310-11 44 Sudharana 49 Kakshasa 1311-12 45 Virddhakrit 50 Anala. *1312-18 48 Paridhavin . 51 Piegala 1313-14 47 Pramadin . 52 Kalayukta 1314-16 48 Anands . 53 Siddharthin. 1316-18 49 Rakshasa . 54 Raudra *1316-17 60 Anala, 55 Durati 1317-18 51 Pingala . 56 Dun lubhi 1316-19 62 Kalayukte . 57 Ruchirodgarin 4409 1230 1365 8 Karttiks 4410 1231. 1232 4412 1233 5 Sravana 4413 1366 1367 1368 1369 1370 1371 1372 1373 1234 1235 1236 4414 4415 1 Chaitra 4416 1237 1238 4417 10 Pausha 4418 1239 1374 4419 1240 1241 4420 1376 7 Aevina
Page #114
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. LXXVI-Contd. 1 Arya Siddhanta, mean system. COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OT CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Kali year. Day and month, A.D. Time of Week-day. mean Mesha samkranti. Day and month, A.D. Week_day. a (here=1. the index of the tithi). 13 123 . 157-2268 .1 . 4396 4397 191-8664 Sat. 8 Fri. 8 Tues. 2 Mon. O Sat. 07-5498 4388 102-1894 4399 316-5047 4400 . 4 Wed. 192.1881 4401 3 Tues. 226-8277 4402 0 Sat. 102-8111 4403 316-8264 4404 12-8341 4405 227-1494 4406 14 17 19 H. M. S. O Sat. . 21 37 40 27 Feb. (58) . 2 Mon. . 3 50 18 Mar. (77) 3 Tues. . 10 306 Mar. (88) 4 Wed. 16 15 0 25 Mar. (84) 5 Thur. . 22 27 3015 Mar. (74) O Sat. 04 Mar. (63) 1 Bun. 10 52 30 22 Mar. (82) 2 Mon. 0 11 Mar. (70) . 3 Tues. 23 17 301 Mar. (80) 6 Thur.. 5 300 19 Mar. (78) 6 Fri. . 1142.30 8 Mar. (88) O Bat. . 17 55 0 27 Mar. (86) . 2 Mon. to 7 80 16 Mar. (75) . 3 Tues. . 8 200 Mar. (64) 4 Wod. 12 32 30 23 War. (S3) 5 Thor.. 18 45 0 13 Mar. (72) . O Sat. 57 30 2 Mar. (61) 1 Sun. . 7 0 21 Mar. (80) 2 Mon. 30 9 Mar. (69) . 3 Tues.. 027 Fob. (68) . 5 Tbar.. i 30 18 Mar. (77) . 0 7 Mar. (68) . 0 Sat. 3025 Mar. (85) . 1 Sun. 14 War. (73) . . 2 37 904 Mar. (63) 261-7889 27 Mar. (86) 28 Mar. (87) . 27 Mar. (87) 27 Mar. (86) 27 Mar. (86) 28 Mar. (87) 27 Mar. (87) 27 Mar. (86). 27 Mar. (86) . Mar. (87) 27 Mar. (87). 27 Mar. (86). 28 Mar. (87) . 28 Mar. (87) 27 Mar. (87). Mar. (88) 28 Mar. (87). 28 Mar. (87) . 27 Mar. (87). 27 Mar.: (86) . 28 Mar. (87) . 28 Mar. (87). 27 Mar. (87) . 27 Mar. (86) . 28 Mar. (87). 4407 137-4728 4408 4409 13-1558 5 Thur.. . 3 Tues. 1 Sun. O Sat. 4. Wed. . 1 Sun. . O Sat. 5 Thur. 2 Mon. . 1 Sun. 5 Thur. 3 Tuos. 2 Mon. 47-7954 4410 262-1106 4411 . 137-7940 4412 4413 172-4337 48-1170 4414 262-4322 4415 4416 297-0719 172-7553 6 Fri. 6 Fri. 4417 207-3949 . 5 Thur.. . 2 Mon. O Sat. 4418 4419 83-0782 297-3935 3 Tues. . 4420 M2
Page #115
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. (VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Mean Kali. Intercalated (adhika) lunar month. Saka Chaitradi Vikrama. Moshadi solar year in Bengal. Kollam, A.D. Gouthern system, Northern system. | 2 4421 1242 728 494-95 495-96 4422 1377 1378 1379 1243 1244 727 4423 496-97 3 Jyeshtha 4424 1245 1380 729 497-98 4425 1246 1381 498-99 12 Phalguna. 4426 1247 499.00 4427 1248 731 732 733 500-01 4428 1249 501-02 8 Karttika 4429 1250 1382 1383 1384 1385 1386 1387 1388 1389 4430 502-03 503-04 504-05 4431 5 Sravans . 1251 1252 1253 1254 4432 505-06 4433 506-07 1319-20 53 Siddharthis. 58 Raktaksbe *1320.21 54 Raudrs 59 Krodhans . 1321-22 55 Durmati 80 Kshaya 1322-23 56 Dundubhi . 1 Prabhava 1323-24 57 Rudhirodgarin 2 Vibhava *1324-25 68 Raktakshs . 3 Sukla 59 Krodhana 4 Pramoda 1326-27 60 Kshays 5 Prajapati . 1327-28 1 Prabhava 6 Angiras *1328-29 2 Vibhava 7 Srimukha 1329-301 3 Sukla , 8 Bhava ... 1330-31 4 Pramdda 9 Yuvant . 1331-32 5 Prajapati 11 Ifvara. *1332-33 6 Angiras 12 Bakudhanya . 1333-347 Srimukha 13 Prandthin . 1334-35 8 Bhava . . 14 Vikrama . 1335-36 | 9 Yuvan. . 16 Vpisha. *1336-37 10 Dhatri : 18 Chitrabhanu. 1337-38 11 livars . .17 Subhanu 1338-39 12 Bahudhanya . 18 Tirana . . 1339-40 13 Pramathia 19 Parthiya *1340-41 14 Vikrama . 20 Vyaya . 1341-42 15 Vrisha 21 Sarvajit 1342-43 16 Chitrabhanu. 22 Sarvadharin. 1343-44 17 Subhana 23 Virodhin 4434 1256 1390 1 Chaitra 4435 1256 4436 1257 10 Pausha 4437 607-08 508-09 609-10 510-11 511-12 512-13 513-14 514-15 4438 4439 6 Bhadrapada 1258 1259 1260 1261 1262 1263 1264 1265 1266 4440 4441 1394 1395 1396 1397 1398 1399 1400 1401 744 745 746 747 4442 3 Jyeshtha . 4443 748 516-17 517-18 618-19 749 750 11 Magha 4445 + 10 Dbatri was suppressed in the north by the mean system, but 11 Ivars by the true system. A.D. 1331-32 was by the latter system called " 10 Dhatri" in the north. The year
Page #116
--------------------------------------------------------------------------
________________ No. 6.] LXXVI-Contd. Day and month, A.D. 13 MEAN SOLAR YEAR. 28 Mar. (87). 27 Mar. (87). 27 Mar. (86). 28 Mar. (87). 28 Mar. (87) 27 Mar. (87). 27 Mar. (86). 28 Mar. (87). 28 Mar. (87). 27 Mar. (87). 27 Mar. (86). 28 Mar. (87). 28 Mar. (87). 27 Mar. (87). 27 Mar. (86). 28 Mar. (87). 28 Mar. (87). 27 Mar. (87) 28 Mar. (87) - 28 Mar. (87). 28 Mar. (87). 27 Mar. (87). 28 Mar. (87). 28 Mar. (87). 28 Mar. (87) . . + . THE FIRST ARYA SIDDHANTA MEAN SYSTEM. * Week-day. 14 4 Wed. 5 Thur. 6 Fri. 1 Sun. 2 Mon. 3 Tues. 4 Wed. 6 Fri. 0 Sat. 1 Sun. 2 Mon. 4 Wed. 5 Thur. 6 Fri. 0 Sat. 2 Mon. 3 Tues. 4 Wed 6 Fri. 0 Sat. 1 Sun. COMMENCEMENT OF THE 2 Mon. 4 Wed. 5 Thur. 6 Fri. . . * Time of mean Meshasamkranti. 17 H. M. S. 8 50 0 15 21 2 30 tth l bhaau 10 3 27 30 0 9 40 0 15 52 30 22 5 0 4 17 30 10 30 0 16 42 30 22 55 0 5 7 30 1 25 0 MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Day and month, A.D. 19 23 Mar. (82) 11 Mar. (71) 28 Feb. (59) 11 20 0 17 32 30 23 45 0 21 Mar. (80) 10 Mar. (69) 27 Feb. (58) 17 Mar. (76) 7 Mar. (66) 25 Mar. (85) 5 57 30 12 10 0 18 22 30 14 Mar. (74) 0 35 0 3 Mar. (62) 6 47 30 22 Mar. (81) 13 0 0 19 12 30 0 7 37 30 13 50 19 Mar. (78) 9 Mar. (68) 26 Mar. (86) 16 Mar. (75) 5 Mar. (64) 24 Mar. (83) 12 Mar. (72) 2 Mar. (61) 12 Mar. (71) 29 Feb. (60) 19 Mar. (78) 8 Mar. (67) 27 Mar. (86) . . . . " 1. Arya Siddhanta, mean system. Week-day. 20 6 Fri. 3 Tues. 0 Sat, 6 Fri. 4 Wed. 2 Mon. 0 Sat. 4 Wed. 3 Tues. 0 Sat. 5 Thur. 4 Wed. 1 Sun. 5 Thur. 4 Wed. 2 Mon. 1 Sun. 5 Thur. 2 Mon. 1 Sun. 6 Fri. 3 Tues. 2 Mon. 6 Fri. 5 Thur. . a (here=t, the index of the tithi). 23 332-0331 207-7165 83-3999 118-0395 332-3547 28-3624 242-6778 118-3612 153-0008 28-7841 242-9995 277-6391 153-3224 29-0058 63-6455 277-9607 312.6003 188-2837 63-9689 98-6067 312-9231 188-6054 223.2350 98-9284 133-5679 Kali year. 1 4421 4422 4423 4424 4425 4426 4427 4428 4429 4430 4431 4432 4433 4434 4435 4436 4437 4438 4439 4440 4441 4442 4443 93 4444 4445
Page #117
--------------------------------------------------------------------------
________________ 94 Kali. Saka. 1 2 Chaitradi Vikrama. Meshadi solar year n Bengal. 3a CONCURRENT YEAR. 752 Kollam. A.D. 751 519-20 520-21 753 521-22 522-23 EPIGRAPHIA INDICA. 523-24 756 524-25 757- 525-26 758 526-27 759 527-28 5 4446 1267 1402 1344-45 18 Tarana. 4447 1345-46 19 Parthiva 1268 1403 4448 1269 1404 4449 1270 1405 754 1346-47 20 Vyaya. 1347-48 21 Sarvajit *1348-49 22 Sarvadharin 755 23 Virodhin 4450 1271 1406 4451 1272 1407 4452 1273 1408 4453 1274 1409 4454 1275 1410 4455 1276 1411 1349-50 1350-51 24 Vikrita. 1351-52 25 Khara *1352-53 26 Nandana 1353-54 760 528-29 27 Vijaya 4456 1277 1412 761 529-30 1354-55 28 Jaya 4457 1278 1413 762 530-31 1355-56 29 Manmatha 4458 1279 1414 763 531-32 *1356-57 30 Durmukha 4459 1280 1415 764 532-33 1357-58 31 Hemalamba 4460 1281 1416 765 533-34 1358-59 32 Vilamba 4461 1282 1417 766 534-35 1359-60 33 Vikarin 4462 1283 1418 767 535-36 1360-61 34 Sarvarin 4463 1284 1419 768 536-37 1361-62 35 Plava 4464 1285 1420 769 537-38 1362-63 36 Subhakrit 4465 1286 1421 770 538-39 1363-64 37 Sobbana 4466 1287 1422 771 539-40 *1364-65 38 Krodhin 4467 1288 1423 772 540-41 1365-66 39 Visvavasu 4468 1289 1424 773 541-42 1366-67 40 Parabhava 4469. 1290 1425 774 542-43 1367-68 41 Plavanga 4470 1291 1426 775 543-44 1368-69 42 Kilaka. JOVIAN SAMVATSARA. Southern system. 6 . . . . . Northern system. 7 24 Vikrita. 25 Khara 26 Nandana 27 Vijaya. 28 Jaya 29 Manmatha 30 Durmukha 31 Hemalamba. 32 Vilamba 33 Vikarin 34 Sarvarin 35 Plava. 36 Subhakrit 37 $5bhana 38 Krodhin 39 Visvavasu 40 Parabhava 41 Plavanga 42 Kilaka 43 Saumya 44 Sadharana 45 Virodhakrit 46 Paridhavin 47 Pramadin 48 Ananda * * [VOL. XVII. TABLE Mean Intercalated (adhika) lunar month. 8a 8 Karttika 4 Ashadha 1 Chaitra 9 Margasira. 6 Bhadrapada 3 Jyeshtha 11 Magha 8 Karttika 4 Ashadha
Page #118
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. LXXVI-Contd. 1 Arya Siddhanta, mean system. COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-SOLAR YEAB (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS) Kall year. Day and month, A.D. Time of Weck-day. mean Mesba. samkranti, Day and month, A.D. Week-day. a (here=t, the index of the tithi). 13 19 20 23 M. 2 S. 30 9-2513 4446 . 223-5666 4447 258-2062 4448 133.8897 4449 . 9-5730 4450 44-2126 4451 258-5279 4452 134-2112 4453 168-8509 4454 41-5342 4455 79-1738 4456 293-4891 27 Mar. (87). 28 Mar. (87). 28 Mar (87) 28 Mar. (87). 27 Mar (87). 28 Mar. (87) 28 Mar. (87). 28 Mar. (87) . 27 Mar. (87). 28 Mar. (87) . 28 Mar. (87) 28 Mar. (87) 27 Mar. (87) 28 Mar. (87) 28 Mar. (87) 28 Mar. (87) 27 Mar. (87) 28 Mar. (87). 28 Mar. (87). 28 Mar. (87). 28 Mar. (88) 28 Mar. (87) . 28 Mar. (87). 28 Mar. (87). 28 Mar. (88). O Sat. . 20 15 Mar. (75) 2 Mon. . 2 15 0 5 Mar. (64) 3 Tues.. 8 27 3024 Mar. (83) | 4 Wed. 14 40 0 13 Mar. (72) . 5 Thur.. 20 52 301 Mar. (61) . Sat. . 3 5 0 20 Mar. (79) 1 Sun. . 9 17 30 10 Mar. (69) . 2 Mon. 15 30 0 27 Feb. (58) 1 3 Tues. . 2142 30 17 Mar. (77) 5 Thur.. 3 55 06 Mar. (65) 6 Fri. 10 7 30 25 Mar. (84) 0 Sat. 16 20 0 15 Mar. (74) 1 Sun. 22 32 30 3 Mar. (63) 3 Tues. 22 Mar. (81) 4 Wed. 57 30 11 Mar. (70) 5 Thur. 10 0 1 Mar. (60) . 6 Fri. . 23 22 30 19 Mar. (79) 8 Mar. (67) 2 Mon.. 11 47 30 27 Mar. (86) 3 Tues. . 18 0 0 16 Mar. (75) 0 12 30 5 Mar. (65) . 6 Fri. 23 Mar. (82) O Sat. 12 37 30 13 Mar. (72) . 1 Sun. 18 50 02 Mar. (61) 3 Tues. 1 2 30 20 Mar. (80) 2 Mon. Sat. . 6 Fri. . 3 Tues. 0 Sat. . 6 Fri. . 4 Wed. 1 Sun. . O Sat. 4 Wed. 3 Tues.. 1 Sun. . 5 Thur. . 4 Wed.. 1 Sun.. 6 Fri. . 5 Thur.. 2 Mon. 1 Sun. . 5 Thur.. 3 Tues.. 1 Sun. . 6 Fri. 3 Tues. . 2 Mon.. 4457 4458 169-1725 . 203-8121 4459 79-4955 4460 . 17 293.8108 328-4504 4461 4462 4463 204.1338 238-7731 4464 114.4568 4465 328-7721 4466 24-7798 4467 1 239-0951 114.7785 149-4181 4468 4469 4170
Page #119
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Mean Intercalated (adhika) lunar month. Kali. Saka. Chaitradi Vikrama. Kollam. A.D. Southern system. Northern system. 4471 12921427 4472 1293 4473 4474 4475 4476 4477 1428 1294 1429 12951430 1296 1431 1297 1432 1298 1433 1299 1434 1300 1435 1301 1436 1302 1437 1303 1438 1304 1439 4478 4479 4480 4481 4482 4483 776 544-45 1369-7043 Saumya ..49 Rakshaba . 545-46 1370-71 44 Sadharana . 50 Anala. I 1 Chaitra 546-47 1371-72 45 Virodhakrit . 51 Pingala 547-48 *1372-73 46 Paridhavin 52 Kalayukta 9 Margasira 548-49 1373-74 47 Pramidin 53 Siddharthin. 549-50 1374-75 48 Ananda 54 Raudra 550-51 1375-76 49 Rakshasa 55 Durmati 6 Bhadrapada 551-52 *1376-77 50 Anala. 56 Dundubhi . |.552-53 1377-78 51 Pingala 57 Rudbirodgarin 553-54 1378-79 52 Kalayukta 58 Raktaksha. 2 Vaisakha 554-55 1379-80 53 Siddharthin 59 Krodhana . 555-56 *1380-81 54 Raudrs 60 Kshays 11 Magha 556-57 1381-8255 Durmati 1 Prabhava 557-58 1382-83 56 Dundubhi . 2 Vibhava 558-59 1383-84 57 Rudbirodgarin 3 Sukla. . 7 Asvins 559-60 *1384-85 58 Raktaksha . 4 Pramoda 560-61 1385-86 59 Krodhana . 5 Prajapati 561-62 1386-87 60 Kshays 6 Angiras 4 Asbadba. 562-63 1387-88 1 Prabhava 1 7 Srimukha . 563-64 *1388-89 2 Vibhava 8 Bhava. . 12 Phalgans. 564-65 1389-90 3 Sukla 9 Yuvan. . 565-66 1390-91 4 Pramoda 10 Dhatri. 566-67 1391-92 5 Prajapati . 11 Isvara . 9 Margasirs. 567.68*1392-93 6 Aogiras 12 Bahudhanya. 568-69 1393-94 7 Srimukha . 13 Pramathin 4484 1305 1440 4485 1306 1441 4486 1307 1308 4487 4488 1442 1443 1444 1309 4489 1310 1445 4490 1446 4491 1447 4492 1448 4493 4494 1450 1315 1316 4495 1451
Page #120
--------------------------------------------------------------------------
________________ No. 6.] LXXVI-Contd. Day and month, A.D. 13 28 Mar. (87). 28 Mar. (87). 28 Mar. (87). 28 Mar. (88). 28 Mar. (87). 28 Mar. (87). 28 Mar. (87). 28 Mar. (88). 28 Mar. (87). 28 Mar. (87). 28 Mar. (87). 28 Mar. (88). 28 Mar. (87). 28 Mar. (87). 28 Mar. (87). 28 Mar. (88). 28 Mar. (87). 28 Mar. (87). 28 Mar. (87). 28 Mar. (88). 28 Mar. (87). 28 Mar. (87). 28 Mar. (87). 28 Mar. (88). 28 Mar. (87). MEAN SOLAR YEAR. * . * . * . . * . THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. * Week-day. 14 4 Wed. 5 Thur. 6 Pri. 1 Sun. 2 Mon. 3 Tues. 4 Wed. 6 Fri. 0 Sat. 1 Sun. 2 Mon. 4 Wed. 5 Thur. 6 Fri. 0 Sat. 2 Mon. 3 Tues. 4 Wed. 5 Thur. 0 Sat. 1 Sun. 2 Mon. 3 Tues. 5 Thur. 6 Fri. . + . * . * COMMENCEMENT OF THE * Time of mean Meshasamkranti. H. M. S. 7 15 0 zhaa dd ch 5 8 a j tth m 13 27 30 0 1 52 30 19 40 17 8 5 0 14 17 30 20 30 0 2 42 30 8 55 0 15 7 30 21 20 0 3 0 10 2 3 32 30 9 45 0 15 57 30 0 22 10 4 22 30 10 35 16 47 30 23 0 12 30 5 11 17 37 30 6 25 23 50 888888 2 30 0 12 15 MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Day and month, A.D. 19 9 Mar. (68) 27 Feb. (58) 18 Mar. (77) 6 Mar. (66) 25 Mar. (84) 14 Mar. (73) 4 Mar. (63) 22 Mar. (82) 11 Mar. (70) 28 Feb. (59) 19 Mar. (78) 8 Mar. (68) 26 Mar. (85) 16 Mar. (75) 5 Mar. (64) 23 Mar. (83) 12 Mar. (71) 2 Mar. (61) 21 Mar. (80) 9 Mar. (69) 28 Mar. (87) 17 Mar. (76) 7 Mar. (66) 25 Mar. (85) 14 Mar. (73) . . . . . * 1 Arya Siddhanta, mean system. Week-day. 20 6 Fri. 4 Wed. 3 Tues. 0 Sat. 6 Fri. 3 Tues. 1 Sun. 0 Sat. 4 Wed. 1 Sun. 0 Sat. 5 Thur. 3 Tues. 1 Sun. 5 Thur. 4 Wed. 1 Sun. 6 Fri. 5 Thur. 2 Mon. 1 Sun. 5 Thur. 3 Tues. 2 Mon. 6 Fri. . . * * * a (here=t, the index. of the tithi). 23 25-1015 239-4167 274-0564 149-7397 184-3794 60-0627 274-3779 309-0176 184-7009 60-3844 95-0230 309-3392 5.3469 219-6622 95-3456 129-9852 5-6686 219-9839 254-6235 130-3069 164.9464 40-6298 254-9451 289-5848 165-2681 Kali year. 1 4471 4472 4473 4474 4475 4476 4477 4478 4479 4480 4481 4482 4483 4484 97 4485 4186 4487 4488 4489 4490 4491 4492 4493 4494 4495 N
Page #121
--------------------------------------------------------------------------
________________ 98 Kali. Saka. - 1 2 co Chaitradi Vikrama. 3 Meshadi solar year in Bengal. 3a CONCURRENT YEAR. Kollam. 4 EPIGRAPHIA INDICA. 4496 1317 1452 801 569-70 4497 1318 1453 802 570-71 4498 1319 1454 803 571-72 4499 1320 1455 804 572-73 4500 1321 1456 805 573-74 4501 1322 1457 8C6 574-75 4502 1323 1458 807 575-76 A.D. 5 JOVIAN SAMVATSARA. 1394-95 Southern system. 6 Northern system. 7 14 Vikrama 15 Vrisha 16 Chitrabhanu. 17 Subbanu 8 Bhava. 1395-96 9 Yuvan. 1396-97 10 Dhatri. 1397-98 11 Isvara. 1398-99 12 Bahudhanya 18 Tarana. 1399-00 13 Pramathin *1400-01 14 Vikrama 19 Parthiva 20 Vyaya. [VOL. XVII. TABLE. Mean Intercalated (adhika) lunar month. 8 6 Bhadrapada 2 Vaisakha 11 Magha
Page #122
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. 99 LXXVI-Concld. 1 Arya Siddhanta, mean system. COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-SOLAB YEAR (MEAN SUNRISE OY CIVIL DAY ON WHICH CHAITBA SUKLA 1 ENDS). Kali year. Day and month, A.D. Time of Week-day. mean Misha Day and month, mean Misha1 A.D. samkranti. Week-day. a(here=1, the index of the tithi). 13 17 19 20 23 O Sat. 40-9515 4496 : 2 Mon. 75-5912 4497 289-9064 28 Mar. (87). 29 Mr (88) 28 Mar. (88) 28 Mar. (87) 28 Mar. (87). 29 Mar. (88). 28 Mar. (88). 4498 3 Tues.. 2 Mon. . O Sat. 4 Wed. 3 Tues. 3 Mar. (62) 022 Mar. (81) 3011 Mar. (71) 13 0 28 Feb. (59) . 19 30 19 Mar. (78) 11 30 08 Mar. (67) . 7 42 30 26 Mar. (86) 3 Tues. 4 Wed. 5 Thur. O Sat. I Sun. 165-5898 4499 200-2294 4500 O Sat. 4501 75-9127 110-5523 6 Fri. 4502
Page #123
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [VOL. XVII. TABLE LXXVII. DURATION AND COLLECTIVE DURATION OF MEAN SOLAR MONTHS ACCORDING TO THE FIRST ARYA SIDDHANTA, WITH INCREASE OF G AT EACH SAMKRANTI. Mean luni-solar month, ending after the second of the two. At the mean solar solar samkrintis samkrantis. connected with it. Collective daration in time and collective increase of a from mean Mesha-samkranti to the several samkrantis. Week dsy. M. S. Mina-samk. (of pre1. Chaitra .. viow year). (Mosha-samk. 1 2. Vaibakha .. Vishab Ha-samk. . 3. Jyoehtha..] Mithuna-sank.. 4. Ashadha : Karka-samk. . 6. Brivana... Simha-sahk. 6. Bhadrapada U Kanya-samk. 7. Aavina . Tuli-samk.. 000 10 31 27 21 2 5 307-3526 614-7052 922-0679 1229-4105 4 10 35 127 1636-7631 15 6 15 1844-1157 8. Kurttiks. The duration of each mean solar month is 30d. 10h. 31m. 238.; and during this period in addition to one whole revolution, the mean moon increases her distance from mean Bun, in measurement by 10,000ths of circle by, (or in other words the monthly increase of a =) 307-352623 726 Vrischika-samk. 2151-4684 2458-8210 2766-1736 9. Margasirs. 10. Paasha .. 11. Migha . 12 Phalguns .. U 1. Chaitra (of fal lowing year). 3073-5262 Dhanus-sahk. . Makara-samk. . Kumbha-sank . Mina-samk. . 13 Mesha-samk. (of following year). 3380-8789 277 12 30 6 3689-2315* * More fully 3688-231484714
Page #124
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. 101 TABLE LXXVIII. VALUE OF A (=t) AT BEGINNING OF CENTURIES OF THE KALIYUGA, ACCORDING TO THE FIR87 ARYA SIDDHANTA MEAN SYSTEM. [The value of a to be added for beginning of odd years of centuries is given in Table LXXIII above. W.-D.=Week-day.) Century K. Y. a(=t). 7715-3525 6583-1816 5112-3787 3980-2078 2848-0369 1715-8659 583-6950 9451-5240 8319-3531 7287-1822 5716-3793 4584-2084 3452.0375 The duration of each mean solar month is 30d. 10h. 31m. 248., and during this period in addition to one whole revolution, the mean moon increases her distance from mean sun, in measurement by 10,000ths of circle by, (or in other words the monthly increase of a=) 307-352623726. N.B.-These values of a agreo generally with Professor Jacobi's values above (Vol. XI, p. 164). The apparent differences are due to two causes; (i) The present estimate of the sum of the greatest equations of moon and sun is about 0-4 greater than that of Professor Jacobi. (ii) The values here stated for the beginn. of centuries 38 to 42 are for mean sunrise on Saturdays, while his aro for mean sunrise on the following Sundays. TABLE LXXIX. MEAN SUNRISE VALUES OF G (DISTANCE OF MEAN MOON FROM MEAN SUN), IN 10,000TES OP CIRCLE, FOR A MONTH PREVIOUS TO THE DAY OF MEAN MESHA-SAM KRANTI. Interval of days from mean Mesha. W..D. samkranti day. a. (mean sunrise value). Interval of days from mean Mesha-W.-D. Bankranti day. d. . (mean sunrise Value). 9502-4119 9841-0438 179-6756 518-3075 856-9394 1195-5713 1534 2032 1872-8350 2211-4669 2550-0988 2888.7306 3227-3625 3565-9944 3904-6263 4243-2581 4581-8900 4920-5219 5259-1638 5597-7856 5936-4175 6275-0494 6613-6813 6952-3131 7290-9450 7629-5769 7968-2088 8306-8406 8645.4725 8984 1044 9322-7263 9661-3681 N.B.-The use of this Table is explained in example 1.
Page #125
--------------------------------------------------------------------------
________________ 102 24-hour period. TABLE LXXX. THE SUN'S MEAN LONGITUDE DURING THE HINDU SOLAR YEAR, IN 10,000THS OF CIRCLE, ACCORDING TO THE FIRST ARYA SIDDHANTA, AT PERIODS OF 24 HOURS EACH, MEASURED FROM THE MOMENT OF MEAN MESHA-SANKRANTI. The same in degrees, etc., can be calculated by Table XLIV, Vol. XIV above. At 1 moment mean of Mishaaumkrunti. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 At moment of mean Vrishabha samkranti. 31 32 33 34 35 36 37 38 Sun's mean longitude. 2 0 27-3779 54-7557 82-1336 109-5114 136-8893 164-2671 191-6450 219-0229 246-4007 273-7786 301-1564 328-5343 355-9121 383-2900 410-6679 657-0686 684-4464 711-8243 739-2021 766-5800 793-9579 821-3357 833-3 848-7136 876-0914 903-4693 930-8471 958.2250 985-6029 1012-9807 1040-3586 24-hour period. 39 1067-7364 40 1095-1143 41 1122-4921 EPIGRAPHIA INDICA. 1 438-0457 465-4236 At moment 492-8014 of mean 520-1793 547-5571 574-9350 602-3129 629-6907 42 1149-8700 43 1177-2479 50 51 44 1204-5257 45 1232-0036 46 1259-3814 47 1286-7593 48 1314-1371 49 1341-5150 1368-8929 1396-2707 1423-6486 1451-0264 1478-4043 52 53 Sun's mean longitude. 2 54 55 1505-7821 56 57 1533-1600 1560-5379 1587-9157 58 59 1615-2936 60 1642-6714 Mithuna samkranti. 1666-6 61 1670-0493 62 1697-4271 63 1724-8050 64 1752-1829 65 1779-5607 66 1806-9386 67 1834-3164 68 1861-6943 69 1889-0721 70 1916-4500 71 1943-8279 72 1971-2057 73 1998-5836 74 2025-9614 75 2053-3393 2080-7171 2108-0950 76 77 78 79 2162-8507 80 2190-2286 81 2217-6064 82 2244-9843 83 2272-3621 84 2299-7400 24-hour period. 85 2327-1179 86 2354-4957 1 58885 89 90 At moment of mean Karka samkranti. 2135-4729 At moment 106 107 108 109 Sun's mean longitude. 110 111 112 2 92 2518-7629 93 2546-1407 94 2573-5186 95 2600-8964 96 2628-2743 97 2655-6521 98 2683-0300 99 2710-4079 100 2737-7857 2765-1636 101 102 2792-5414 103 2812-9193 104 2847-2971 105 2381-8736 2409-2514 2436-6293 2464-0071 2491-3850 2874-6750 2902-0529 2929-4307 2956-8086 2984-1864 3011-5643 3038-9421 3066-3200 113 114 3093-6979 3121-0757 3148-4536 116 3175-8314 115 117 3203-2093 118 3230-5872 119 3257-9650 120 3285-3429 121 3312-7207 2500-0 of mean Simha samkranti. 122 3340-0986 123 3367-4764 124 3394-8543 -3333-3 125 3422-2322 126 3449-6100 [VOL. XVII. 24-hour period. 127 128 129 3476-9879 3504-3657 3531-7436 130 3559-1214 131 3586-4993 132 3613-8772 3641-2550 3668-6329 133 134 135 136 137 138 146 147 148 149 Sun's mean longitude. 3778-1443 139 3805-5222 140 3832-9000 3860-2779 3887-6557 3915-0336 150 151 152 2 141 142 143 144 3942-4114 145 3969-7893 At moment of mean Kany a samkranti. 3696-0107 3723-3886 3750-7664 163 164 165 3997-1872 4024-5450 4051-9229 4079-3007 4106-6786 4134-0564 4161-4343 4166-6 153 4188-8122 154 4216-1900 155 4243-5679 156 4270-9457 4298-3236 4325-7014 157 158 159 4353-0793 4380-4572 160 161 4407-8350 162 4435-2129 4462-5907 4489-9686 4517-3464 166 4544-7243 167 4572-1022 168 169 4599-4800 4626-8579 4654:2357 4681-6136 170 171
Page #126
--------------------------------------------------------------------------
________________ No. 6.] THE FIRST ARYA SIDDHANTA, MEAN SYSTEM. 103 TABLE LXXX--Contd. 24-hour period. Sun's mean longitude. 24-hour period. Sun's mean longitude. 24-hour period. Sun's mean longitude. 24-hour period. Sun's mean longitude. 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 6023-1286 6030-5064 6077-8943 6105-2622 6132-6400 6160-0179 6187-3957 6214.7736 6242-1514 6269-0593 6296-9072 6324-2850 6351-6629 6379-0407 6406-4186 6433-7964 6461.1743 6488-5522 6515-9300 6543-3079 6570-6857 6598-0636 6625-4414 6652-8193 281 289 238 239 240 241 242 243 179 4708-9914 173 4736-3693 174 4763-7472 178 4791-1250 176 1818-5029 17: 4815.8807 178 1873-2586 170 1900-6364 ISO 4928-0143 181 19.30-3922 182 4982-7700 Al moment of MCM Lula sa 5000-0 kranti. 183 5010-1479 184 5037.5257 185 5064-9036 186 5092.2814 187 5119-6593 188 5147-0372 180 5174.4150 190 5201-7929 191 5229-1707 192 5256-5486 193 5283-9264 194 5311-3043 195 5338-6822 196 5366-0600 197 5393-4379 198 5420-8157 199 5448-1936 200 5475-5714 201 5502.9493 202 5530-3272 203 5557-7050 204 5585.0829 205 5612-4607 206 5639-8386 207 5667-2164 208 5694-5943 209 5721-9722 210 5749-3500 2111 5776-7279 212 5804-1057 213 5831-4836 Al momento of mean 5833-3 V rischika sankranti 214 5858-8614 215 5886-2393 216 5913-6172 217 59-40-9950 218 5968-3729 219 5995-7507 272 7446-7772 2737474.1550 At moment 1 of mean me 15 7500-0 Makara samkvanti. 274 7501-5329 275 7528-9107 276 7550-2856 277 7583-CC64 278 7611-0143 279 7038-4222 280 7665.8000 7693-1779 7720-3557 283 7747-9336 284 7775-3114 285 7802.6893 286 7830-0672 287 7857-4450 298 7884-8220 299 7912.2007 290 7939-5786 291 7000-3564 292 7094-3343 203 8021-7122 294 S049-0000 293 8076-4679 206 8103-8457 8131-2236 298 8158-6014 299 8185-9793 300 8213-3572 3301 8210-7350 302 $268.1129 303 $295.4.207 30+ S322 8686 At moment of mean 8333-3 Kumbha 8an kranti. 305 83.50-2484 306 8377-6243 307 8405-0022 3088432-3800 309 8459-7579 310 8487-1357 8514-5136 312 8341-8914 313 8569-2693 314 8696-6472 315 8624-0250 316 8651.4029 317 8678.7807 318 8700 1530 319 8733-5364 At moment of mean 66666 Dhana sankranti. 244 6680-1972 245 6707-5750 246 6734-9529 247 6762-3307 248 6789-7086 249 6817-0864 250 6844.4643 251 6871-8422 2521 6899.2200 253 6926.5979 254 6953-9757 255 6981-3536 256 7008.7314 257 7036-1093 258 7063-4872 259 7090-8650 260 7118-2429 261 7145-6207 262 ! 7172-9986 263 7200-3764 264 7227-7543 265 7255.1322 266 7282-5100 267 7309-8879 268 7337-2657 269 7364-6436 270 7392-0214 271 7419-3993 320 8760-9143 321 $788-2922 322 88156700 323 8813-0479 324 8870-4257 325 8897.8036 326 8925. 1814 327 8952-5593 328 8979-9372 329 9007-3150 330 9034.6929 331 9062.0707 332 9089-4486 333 9116-8264 334 1 9144.2043 At moment of uncan 19166.6 Mina-sunkranti. 335 9171-5822 336 9198-9600 337 9226-3379 338 9253.7167 339 9281.0936 340 9308-4715 341 9335-8493 342 9363-2272 343 9390-6050 344 9417-9829 345 9445-3607 346 9472-7386 347 9500-1165 348 9527-4913 349 9554-8722 350 9582-2500 351 9609-6279 352 9637-0057 353 9063836 354 9691.7616 355 9719-1393 356 9748-5172 357 9773-8950 358 9801-2729 359 9828-6507 360 9856-09 361 9883-4065 362 9910-7843 3631 9938-1622 364 9965-5400 365 9992-9179 Al moment of mean Me aha. 207 3111 > 10,000.0 sankranti of fouringur.
Page #127
--------------------------------------------------------------------------
________________ 104 EPIGRAPHIA INDICA. [VOL. XVII. TABLE LXXXI. SUN'S MEAN LONGITUDE. INCREASE IN FRACTIONS OF DAY ACCORDING TO THE FIRST ARYA SIDDHANTA. (For the same in degrees, etc., see above, Vol. XIV, Table XLIV.) INCREASE PER POUR. INCREASE PER MINUTE. INCREASE PER SECOND. In 10,000ths In 10,000ths No. In 10,000ths of circle. No. In 10,000ths of circle. No. No. No. of circle. U In 10.000ths of circle. of circle. 0-0190 0-5894 0-0098 1.1407 2-2815 0-0380 0.0570 3-4222 0-0003 0-0006 0.0010 0-0013 0.0016 0-6084 0-6274 0-6464 0-6654 0-6844 0-7035 0-0101 0-0105 0-0108 0-0111 0-0760 0-0951 4-5630 5.7037 6.8445 7-9852 9.1260 10-2667 0.0114 0:1141 0-1331 0-1521 0-0019 0-0022 0-0025 0-0117 0-7225 0-0120 0-1711 0-0029 0-0124 11.4074 0-1901 0.0032 0-0127 12-5482 13-6889 0-2091 0.2281 0-2472 0-7415 0.7605 0-7795 0-7985 0-8175 14-8297 15-9704 0-0130 0-0133 0-0136 0-0139 0-0143 0-0146 0-2662 0-0035 0-0038 0-0041 0-0044 0.0048 0.0051 0-0054 0-8365 17.1112 0.2852 0-8556 0-8746 18-2519 0-3042 19-3926 0-3232 0.8936 0-0149 0-3422 0.9126 20-5334 21-6741 0-0152 0-0155 0-3612 0-9316 0-3802 0-9506 0-3993 22.8149 23-9556 25-0964 26-2371 0-4183 0-9696 0-9886 1.0077 1-0267 1.0457 0-4373 0-0158 0-0162 0-0165 0-0168 0.0171 0-0174 0-0057 0-0060 0-0063 0-0067 0-0070 0-0073 0-0076 0-0079 0.0082 0-0086 0.0089 0-0092 0-0095 0-4563 0-4753 0-4943 0-0177 0-5133 0-5323 1.0647 1.0837 1.1027 1.1217 0.0181 0-0184 0-0187 0-5514 0-5704
Page #128
--------------------------------------------------------------------------
________________ No. 7.] TWO NEW GRANTS OF DHRUVASENA. 105 No. 7.-TWO NEW GRANTS OF DHRUVASENA [1] FROM PALITANA. BY V. S. SUKTHANKAR, PH.D. I edit here two new Valabhi copper-plate grants (one complete and one incomplete) which were presented, in 1918, to the Trustees of the Prince of Wales Museum, Bombay, by the Bhavnagar Darbar, which is ever ready to further the cause of epigraphic research by placing ungrudgingly the materials, as they are discovered, in the hands of students of Indian history for investigation and publication, and, when possible, by having them exhibited in centrally situated museums. The plates under reference were discovered at the bottom of a small tank outsid the Satrunjaya Gate at Palitana while the tank was being drained during the time of the la Thakor Saheb of that State.1 A.-PLATES OF DHRUVASENA I.; [VALABHI]-SAM[VAT] 207. The plates, which are inscribed on one side only, are two in number, each measuring roughly 11" broad by 6" high. The edges are just slightly raised in order to protect the writing, which (excepting portions of 11. 1-4) is in a state of perfect preservation. The plates are of fair thickness; but the letters, being deep, show through on the reverse sides. The engraving is well executed. Each of the plates has two holes bored in it. A ring of copper passing through one pair of them serves to hold the plates together at one end. The seal, which is an invariable accompaniment of such plates, is missing. The aggregate weight of the plates is about 102 tolas. Each plate contains twelve lines of writing; the last line but one of the second plate contains the date. From the foregoing description of the plates, as well as from the facsimiles of them appearing with this article, it will be evident that this record does not differ in any striking particular from any of the hitherto published records of the same king. Only in the portion dealing with the grant proper does the text of this inscription differ, for example, from that of other plates of this king which were discovered some years back also at Palitana, and have been edited by Dr. Sten Konow in a former issue of this Journal. The royal donor, Dhruvasena, as well as the dataka Mammaka and the writer Kikkaka, are names well known to the Indian epigraphist. It will, therefore, be unnecessary to go here into a minute description of the characters and orthography of this inscription. It will suffice to observe that the alphabet offers a specimen of final t (1. 15), final m (1. 23) and the numerical ideograms 200, 7, and 5, and that the name of the founder of the dynasty is spelt as Bhatakka (1. 3). At the end of line 12 is to be found a horizontal stroke, about " long, evidently drawn with a view to fill up the empty space remaining at the end. The reason for leaving the space vacant appears to be that the writer did not wish to commence, at the end of the line, a long word the whole of which would not have been contained in the short space that was left over. The inscription is one of the Maharaja Dhruvasena [I.] of the Maitraka dynasty, and the grant contained in it is issued from the city of Valabhi. The object of the inscription appears to be to record the confirmation by Dhruvasena of the donee, a Brahmana named Madhava, of the Sunaka gotra, student of the Chhandoga School, and resident of the village of Jyeshthanaka (stated to be Akshasaraka-pravesya) in the Hastavapra-harani in the possession of some 1 My friend Pandit Girijasankar Vallabhji of Rajkot, Curator of the Prince of Wales Museum, Bombay, informs me that the five Palitana plates edited by Prof. Konow (above, Vol. XI, pp. 104 ff.) were discovered at the same place and at the same time as the plates here described. Above, Vol. XI, pp. 104 ft.
Page #129
--------------------------------------------------------------------------
________________ 106 EPIGRAPHIA INDICA. [VOL. XVII. land already enjoyed by him in the village of which he was a resident. Besides Hastavapra, which is the modern Hathab (6 miles south of Gogha in the Bhavnagar State), and Valabhi, which is commonly identified with the modern Vala (situated in 21deg 52' N. and 71deg 57' E.), none of the places can be located. The date of the record is the year 207 (given as usual in numerical ideograms), and the 5th (tithi) of the dark fortnight of Vaisakha. The year when referred to the Gupta-Valabhi era yields A.D. (207+320)=A.D. 527. There are two expressions in this inscription, both occurring in the portion dealing with the grant proper, which deserve some comment : they are Akshasaraka-prarebya- (1. 12) and 8a-faibaram (1. 16). The latter we will consider first. Being mentioned along with the well-known technical expressions sa-hirany-adeyam and sabhata-rata, 80-saibaram must be a term of like nature, i.e. a technicality of the lawyers; but what its significance may be I am unable to surmise. There can be no question regarding the correctness of the reading; the letters are perfectly distinct. The word saibara is not to be found in dictionaries; nor have I come across it elsewhere. I can only think that it may be, as it stands, a clerical error; but I am unable to suggest any plausible emendation for it. The word pratesya in the other expression referred to above is also one that presents some difficulty to the interpreter. Here it is used in compound with Akshasaraka, evidently a placename, and serves to locate more definitely the village Jyeshthanaka situated in the Hastavapraharani. As far as I know, the word pravesya has been met with only twice before : once in another Valabhi grant, occurring there in a compound with the same place-name Akshasaraka, and once again in the Khariar grant of Mahasudeva, compounded with the word Navannaka, which is also a place-name. The former record forms one of the five Valabhi grants from Palitanal edited by Prof. Sten Konow, and is a grant of Dhruvasena I., dated in Samvat 210. In that connection Prof. Konow rightly points out that the phrase Akshasaraka-praresya of the grant corresponds to the Akshasaraka-prapiya in a third Valabhi grant, viz. the Ganeegad (Baroda) plates of Dhruvagena, dated Samvat 207. Hultzsch, when editing the latter grant, translated the phrase by which belongs to the Akshasaraka-prapa. Prof. Konow, who regards pravesya and prapiya as synonyms, rejects Hultzsch's rendering of Akshasaraka-prapiya and advances the suggestion that pravesya in this connection means the same thing as in the phrase a-chata-bhata-pravesya, and accordingly translates the phrase by which can be entered from (i.e., which borders on) Akshasaraka. I cannot, in the first place, admit that the expressions a-chata-bhata-pravesya and Aksbasarakapraresya correspond exactly. For in the former the first mer ber of the compound comprises the logical subject of the verb contained in pravesya; but such cannot be the case with the second expression, even if we assign to it the meaning which Prof. Konow does. Secondly, I do not understand what is meant by saying that a village could be entered' from such and such a place. If, moreover, pratesya meant the same thing as "bordering on,' as Prof. Konow asserts, I cannot help thinking that the writer would have employed a simple worel like samipa or parsra-tartin, which lie at hand, to express that simple idea of proximity rather than use the circumlocution of praresya or prapiya. Hultzsch, on the other hand, appears to me to be undoubtedly on the right track. He looks upon prapiya as a derivative of prapa, which he takes to be a word denoting a territorial division smaller than an ahara. Similarly the analogous term pravesya should also be looked upon as a taddhita of praresa. That this derivation is correct may be seen from the Khariar plates of Mahasudeva, in which a village is described (1. 4) as Kshitimad-ahariya and Narannaka-etat-pravesya. No one will dispute that ahariya is derived from ahara (district, province ') by the addition of the suffix -iya. That supplies us with the clue to the explanation of the other words under consideration here. All these words are derived Above, Vol. XI, pp. 101 ff., and Pates. 2 Above, Vol. III, p. 320, and Plate,
Page #130
--------------------------------------------------------------------------
________________ No.7.] TWO NEW GRANTS OF DHRUVASENA. 101 by the addition of the secondary -(Oya to the strengthened forms of the roota a-hri,pra-(a-vil and pra-a-)ap (' bring to,' 'carry to'), words with only minute differences of meaning. Ifeel, therefore, constrained to reject the interpretation of Prof. Konow in favour of the other. Praplya I take to be that which belongs to the prapa,' and pravetya 'that which belongs to the pravesa (or prateda'; both prapa and praveta I regard as territorial divisions smaller than the ahara. TEXT.1 Plate 4, 10 'paramabhaTTArakapAdAnuDyA(dhyA) to mahArAnadhruvasenaH kamalo saniva khAnAyusa niyuktakacATa11 bhaTadvAGgikAmahattaradhruvasvAnAdhikaraNikadAjapAbhikAdInanyAca' yathAsaMbakhyamAna 'kananu12 darzayatyastu vasaMviditaM yathA mayA hastavamaharakhyAmakSasarakamAvezya Plate Az 13 jyeSThAnakagrAme uttarasIni pAdAvartazataM SadhyadhikaM tasmina' prAmava'vyazunaka14 sagotrANAM chandogasabrahmacArINAM bramaNamAdhavapUrvabhujyabhujyamAnaka (:) mAtApitroH 15 puNyApyAyanAyAtmanA vehikAmubhikayathAbhilaSitaphalAvAptinimittA"mAcandrArkA garNavakSitisarit18 parvatasthitisamakAlInaM putrapautrAgvayabhojya" sazaibaraM sahi[ra"]NyAdeyaM sabhUtavA tapratyAyavizukSA udakAtisamrgeNa anadeyaM niSTha"[] yataH eSAM anadeyasthityA bhujatA" lApatA pradizatAca 18 svalpApyAvadhA" vicAraNA vA na kAryAmahaMsajera gAmibhadrapatibhiva"nisyA nyaizaUNyasthiraM mAnArtha 19 sAmAnya ca bhUmidAnaphalamavagacchaddhirayamamahAyonamantavya [1] (u) yacinyA dacchidyamAnaM" vAnumode From the original plates, and a set of estampages. Up to this, the text is practically identical with the text of the Pilitkni plate of DhravsainaL. (dated rampat 206), published above, Vol. XI, pp. 106 ff. The only varia lectiones are unimportant mistakes of orthography, which it would be unnecessary to register individually the facsimiles are there for reference. - Read nyAya. * Rend kAmanuIn the original a short horizontal stroke after * Read . Ashort vacant space between gand vya. Read yAmavAsavya. * Read degcArikA brAma. . Read away To The anusara is written over the line between and HT. The letters purova. bhujya-bhujyamanakahave been engraved over some faintly incised letters. " Read ta. " Resd vyaM. 11 Rends. 16 Read " Read bhaMgatA " Read gadhA. 16 Read 17. * Bend 1. 30 Read . * Read bAciyAdAna 10 Read na. " Read tAMba.
Page #131
--------------------------------------------------------------------------
________________ 108 EPIGRAPHIA INDICA. [VOL. XVII. 20 sa paMcabhi: mahApAtakasmopapAtakaisaMyuktastya'dapi cAtra vyAsagItA: mokA Hafan [n] agfaat 21 bhatA rAjabhimagarAdibhiH / *] yasya yasya yadA bhUmiH tasya tasya tadA 4 [11] acut aceat at a 22 aut [i*] at W AR [:*] pustfa fafenat" [**] qat at frafament Jacu #8T(:) [*] 23 af AfThai 18 Tarihuah [*) gaan: sitgitaa#: [*] poo o que eu [v] 24 T H ATT ]hte [11*] fafar fara afar [11] TRANSLATION [LI. 1-11 contain the usual preamble ; for translation, cf., for instance, that of the opening lines of the Palitana plates, No. 1, edited by Prof. Konow, Ep. Ind., Vol. XI, p. 108.] (Ll. 12-16.) Be it known to you that for the purpose of increasing the religious merit of (my) mother and father, and for the sake of the attainment of the desired reward both in this world and in the next, I have confirmed, as brahma-deya, with libation of water, (the enjoyment of) one hundred and sixty padavarttas, on the northern boundary of the Jyeshthanaka village belonging to the Akshasaraka-pravesya in the Hastavapra-harani, which had (formerly) been and are (still) being enjoyed (by the donee?), for the benefit of) the resident of the same village, (namely) the Brahmapa Madhava of the Sunaka gotra, a student of the Chhandoga School, --to last for the same time as the moon, sun, ocean, earth, the rivers and mountains, to be enjoyed by the succession of his sons and sons' sons --with (P) faibara, with gold (and) adeya, with bhuta, vata, and (?) surety of holding (pratyaya). (Ll. 17-19.) Wherefore, no enquiry should be made or obstruction caused to him) by any one, while he is, according to the proper conditions of a brahma-deya, enjoying, cultivating, or assigning (it to others). And this our gift should be assented to by thosg born in our lineage, and by future good kings, bearing in mind that power is perishable, the life of man is uncertain, and that the reward of a gift of land is common. And he who confiscates it or Assents to its confiscation incurs the guilt of the five great sins together with the minor ones. (Ll. 20-22.) There are also two verses sung by Vyasa about this. [Here follow two of the customary verses.] (L. 23.) The dataka is the pratihara Mammaka. (Dated the) 5th (tithi) of the dark (fortnight) of Vaisakha in the) year 2007. (L. 24.) (This is) the sign-manual of me Maharaja Dhruvasens [1.]. Written by Kikkaka. B.-ANOTHER PLATE OF (DHRUVASENA I.]. This plate, which contains only the opening portion of a land-grant of the Maitraka king Dhruvasona I., is inscribed on one side only and measures roughly 10" broad by 6" high. The . 1 Read tror. * Over at there is a peculiar sign, the meaning of which is not apparent. [Ithink it is upadmaniya.-Ed.] Read . * Read T. . Read ante. * Rendo afa. 1 The construction of line 14 is somewhat confused; it is not clear who the donee was, or who, at the time of the grant, was in possession of the land which is the object of the grant. As it stands, the text does not make Any Boo; my rendering is conjectural.
Page #132
--------------------------------------------------------------------------
________________ Two Palitana Grants of Dhruvasena [1]. naank n pus'kl hrnjrmkh'maanaa naas' 2 p jtt 25 naavai naanaa naank035 // : 55:52 2, 28uAA: Agic | 2 5 eeklc(c)60ee9l um:4laa|| m, nsl nuuN prkh lee h4 kN pnee80803 Sep188r laadeg8309laan lii -6473 75 54 hlga, . 2e6/jnecrjh 86) kai ru dhoo. n h 51 1958pNnaa 78702 10 : 47hn: 1 pr luh521 B tt } 9 l, 38:]ttaa gunnaan, khaar,tt tee inse Olpnaa 470l 878, 12 uhnaa6 ( Aii tooN 3 hii 14 8373 kh00 taar- 14 2558777@l hoo4hrr nee 880/ 5e nmukh p2) TSA01 Ptt haan(r) a 1 5 5, 720 B5 hunnnaa pee 18 40004h unplee 92 9vai8) .. laaiin 109 ) 2 82 8 40, 7kuulaaNtt 2 98 :4naal hunjd gaargu Rhng pmul 20 pTEh guy apnnaa a hl 2 , 27 jnbaannii 387%eps/4 22 ddtt jg 65, 4.4,00@ 24 jhlHkh4phr03 nuuN 7 di 24 WHITTINGHAM & GRIGGS, PHOTO-LITH. F. W. THOMAS SCALE ONE-HALF
Page #133
--------------------------------------------------------------------------
________________ noeru sutakora sa ngamaziinokosuchianhasutsu! ALIATORY TYPshikanaikareremasukasareru ta mata0idesukaranetonatsutasounaridekato NTTdouzuhaBRF TAREAT ATTAhasudenamarigakansu 26286: kumadaribuyosukaEDISERGorimasuka014 kubatsuguETROUVUAA188c8a3961:2nanoyone a03aylogimg28r8rgyDui surusurutsutearunoka! nadodemasakakomakanazashidesuBen saorimasukara izatonareru!213] niinsuo-yaninaremasu. 10wdedo FREE TRFAsukasanatsutakana riteiruyorikanaenokaori:ITE-TA8ARTEC 12Shi katomisao on RTEChasukosutodearu suginainaraRTsurunara tenoshinku] nomininatsutemasu! nadonakunarimasu. ASOSnanodema koto Kathiawad Plate of Dhruvasena [1]: Samvat 206. ohanashi] tanara2karuookamitoregarukototosareteo do, naimonogakariirudehana ku , USAENsanamisunayo5nokuziragahaminaina minatoma-kususuidanaatohurudehurusai. korekaranorimuichisuta-2denande ENyu-karao] bantsutonarutomina suhamisaki. intotonaru[suko-tonoteisuro-orudesu Zi haAGE VAAEAE SCALE ONE-HALF
Page #134
--------------------------------------------------------------------------
________________ No. 7.] TWO NEW GRANTS OF DHRUVASENA. 109 edges are just slightly raised, in order to protect the writing, which is in a state of excellent preservation throughout. The letters, which are deeply incised, show through on the reverse side of the plate. The engraving is well executed. The plate has a pair of holes bored at two adjacent corners and intended for receiving the ring and seal, which are missing. Its weight is 56 tolas. It contains fifteen lines of writing. The letters are of the period to which the plate refers itself, and of the type met with on other plates of the Maitraka dynasty. In short, this record is exactly like any of the large number of grants of Dhruvasena I. that have latterly been brought to light. A detailed description of the characters, language and orthography of these plates, or even an English rendering of the text, seems superfluous. We may take it for granted that the dataka of this grant was the pratihara Mammaka, and the writer Kikkaka. The grant was issued from Valabhi by the Mahasamanta Maharaja Dhruvasena [I.] to the Brahmana Santisarman of the Atreya gotra, (a student of] the Vaji saneya] School and a resident of Nagaraka, either bestowing upon him or confirming him in the possession of one hundred padararttas of land on the south-eastern boundary of the village of Bhadrenika, situated in Surashtra. I am unable to identify Bhadrenika. Nagaraka is probably Vadnagar, the home of the Nagar Brahmans. TEXT. Plate B. 12... THTAKAETTYenut alan vaate18 viniyuktakamAttaradAMgikadhruvasthAnAdhikaraNikAdInanyAMzca yathAsaMbadhyamAnakAna14 nudarzayatyastu vanaviditaM yathA surASTrAyAM bhadreNikAgrAmasya pUrvadakSiNa sini 15 JETA Trawuf ihtiyaf POSTSCRIPT A PLATE OF DHRUVASENA DATED SAM. 208. Since writing the above I have come across a new Valabhi plate containing the concluding portion of a grant of Dhruvasena dated in sa n. 206, about which I should like to add a few words in continuation of the above note on the Bhavnagar plates. This new plate was placed in my hands for decipherment by Mr. J. C. Chatterjee, Dharmadhyaksha (Secretary in the Ecclesiastical Department) to the Government of His Highness the Gaikwar of Baroda. It was sent to him, he told me, officially from Kathiawad for decipherment: that is all that I could elicit from him regarding its previous history. The plate is 114 inches long by 6 inches broad; the edges are raised to protect the writing, which is in a state of perfect preservation; and the characters belong to the period to which the plate refers itself: in one word, the grant is similar in every respect to the records of the Valabhi kings that have hitherto come to light. From the original plate, and a set of estampages. 2 Up to this the text is practically identical with the text of the Palitani Plate of Dhruvason I. (dated 206). published above, Vol. XI, pp. 105 ff. In l. 6, read t-pad-abhipranama" for t-pabhiprandma and Manvadina for dina. Read Cefa. * The rest of the inscription is missing
Page #135
--------------------------------------------------------------------------
________________ 110 EPIGRAPHIA INDICA. [VOL. XVI. The inscription is one of Mahiraja Dhruvasena (I.) and records the grant of a village (of which the name must have occurred in the missing portion of the grant and is therefore now lost) to a Brahmana named Rotghamitra of the Vrajagana gotra, a student of the Chhandoga School, and resident of Simhapura, for the maintenance of certain sacrifices. The grant is dated sam. 200 6, Asvina sukla 3. The samvat year, when referred to the Valabhi era, yields A.D. (206+ 319) 525. The dataka was Mammaka, and the writer Kikkaka, as usual. The only point worthy of notice in this grant is the village-name Simhapura, which is mentioned in it as the residence of the grantee. It is tempting to identify it with Sihor in the east of the Kathiawad peninsula, a junction on the Bhavanagar-Wadhwan Railway, not far from Vala, the ancient Valabhi. KATHIAWAD PLATE OF DHRUVASENA (I.J.) TEXT. 1 ranava-kshiti-sarit-parvvata-sthiti-samakalinam patra-pantr-anvaya-bhojyam bali2 charu-vai vadov-adyanam kriyanam samutsarppan-arttham Simhapura-vastavya brahmana:Rotghamitraya 3 Vrajagana-sa-gotraya (Ch)Chhandoga-sa-brahmacharins brahma-dayam nisrishta [*] yato=syrochitayi brahma. 4 deya-sthitya bhumjatah ksishatah pradifatah-karshapayatas-cha na kais-chit-svalp apy=abada vicharana va 5 karyy-asmad-vamsajair=agummi-nfipatibhis-ch=anityany-aisvairyyany=asthiram manu shyam ch=avekshya samanyar cha 6 bhumi-dana-phalam=avagachchhadbhir=ayam=&smad-dayd=numantavyo yas-ch-achchhin dyad=achchhidyamanam v=inumodet 7 sa panchabhir-mmaha-patakais=s-opapatakais=samyuktas=syad=api ch=atra Vyasa-gitan slokau 8 bhavatah [l*] shashtim[*] varsha-sahasrani svargge modati bhumidah[*] achchhetta ch=anumanta cha tany=&va narako 9 vasot [lle*) sva-dattam para-datta[m(r)]=vva yo hareta vasundharan [*] gavam fata-sahasrasya hantu[bo] prapnoti 10 kilbisham[|| * * ]-iti sva-hasto mama maharaja-Dhruvasenasya [11] dutakah pratihara-Mammakah [ll] 11 likhitam Kikkakena [ll] sam 200 B Asvayuja su 3 [ll] No. 8.-SRIRANGAM COPPER-PLATE GRANT OF DEVARAYA II; SAKA 1349 (1350). BY THE LATE T. A. GOPINATHA RAO, M.A., TRIVANDRUM. The temple of Sri-Ranganatha at Srirangam possesses, among others, two sets of copperplates belonging to the reign of the Vijayanagara king Devariya II. The inscriptions engraved npon these two sets are edited below from the impressions prepared under my supervision. No. I. SAKA-SAMVAT 1949. This set consists of three plates (size 108 x 67 in.), of which the first and the third bear writing on one face only, namely, the second side of the first and the first side of the third. From the original plate and a set of impressions. [Read agami,-Ed.]
Page #136
--------------------------------------------------------------------------
________________ No. 8.] SRIRANGAM COPPER-PLATE GRANT OF DEVARAYA II. 111 The inscription is in good state of preservation. The alphabet in which the record is writter is Nandinigari, and the language partly Sanskrit and partly Kannada. The first section covers 41, and the second 34 lines, and the remaining portion contains the usual admonitory and imprecatory verses. At the end appears, as is usual with the documents of the kings of the first dynasty of Vijayanagara, the word Sri-Virupaksha, the sign-manual of the king, written in the Telugu-Kannada alphabet. The same sort of mistakes, careless execution of the engraving, leaving room for a number of corrections, erasures, interlineations, etc., and other faults common to the other grants of this period are to be found in these two set of copper-plates also; there is no necessity for them to be noticed in detail here; they are noted in the foot-notes at the appropriate places. The record is dated Saka 1349, which is expressed by the chronogram dhivaluka; this year corresponded to the cyclic year Plavanga. In the Kannada portion the Saka year is given as 1350, and the same Plavanga is said to be current. On a Sunday, which was the Utthana. dvadasi tithi in the bright half of the month Karttika, the king Deva-Raya II granted to the God Ranganatha of Srirangam the village of Pandamangalam together with the sub-villages, Tirunalur, Seranaibanda-peruna-nallur, and Sunepuha-nalur, in the name and for the merit of his mother Narayanambika. The genealogy of the king is traced thus : Sangama His middle son Bukka I md. Gaurambika Hariharesvara Pratapa-dera-Raya I md. Demambika Vijaya-Bhupati md. Narayanambika Deva-Raya II Deva-Raya Il bears the birudas, Raj-adhiraja, Raja-param-sbrara, Bhash-atilarighi-bhupalabhujariga (=Bhashege-tappwa-rayara-ganda), Maru-rayaraganda and Hindu-raya-suratrana, Having ascended his ancestral throne and while protecting the kingdom, residing in his capital Vijayanagara, which is situated on the bank of the river Tungabhadra, king Deva-Raya made the grant mentioned above in the presence of the god Virupaksha on the bank of the Tungabhitdra. The villages Pandamangalam, Tirunalir and Seranaibanda-peruma-nallar are said to have been situated in the Rajagambhira valanadu on the south side of the river Kaveri; and Sunepuha-nalar in the Melmuri of the Mala nadu, a sub-division of the Rajaraja vajanadu, on the north of the same river. The Kannada portion adds that the villages belonged to the Amarada hobali. All of them belonged also to the Tiruchchirappalli rajya or chavadi. The purpose for which the grant is made is given in full detail in the Kannada portion. From the income of the villages twelve perpetual lamps should be burned, flower-garlands dedicated and one festival celebrated. The grant was made as an anxiliary to the Go-sahasra Mahadana performed by the king. The grant was ordered to be executed from the first tithi of the bright fortnight of the month Ashadha. The income from the villages situated on the south of the Kaveri was 1403 coins (kula-gadyana), and that from the village on the north of the river 420; total 1,82
Page #137
--------------------------------------------------------------------------
________________ 112 EPIGRAPHIA INDICA, (VOL. XVII gadyanas. A number of taxes leviable in these villages are included in the grant: they are taxes on the nansey, pumsey, pum-payir, vrisal- and manai-pperu-kadamai, tari-kkadamai, maradai, maravadai, kulavadai, kalayam, tirigai-ayam, per-kadamai (tari-kadamai), alukku-nir-palfam, mahamai, kattigai-avasaram, patai-kanikkai, Adi-Karttigai-pachchai, and all old and new taxes. Several of these have remained unexplained up till now. It is easy to understand the nature of the first four; they are levied on wet and dry cultivation, on inferior crops, on houses and compounds and on looms; mavadai, mararadai and kulavadai are taxes on animals, trees and tanks : that is, perhaps, when animals are sold in markets; on fruit-bearing trees and for fishing in tanks. Kalayam literally means tax on stone; it is very likely a tax payable for quarrying stones from hills; what tax is meant by tirigai-ayam is not known. Per-kadamai means taxes on persons, a sort of poll-tax evidently. Alukku-nir-paffam is a tax for maintaining the person appointed for making regular supply of water to the fields: this appears to be the same as niranikkam. Magamai is a corrupt form of maganmai, the nature of being a son to another ; this levy is still in force among certain merchants in the Tanjore and Trichinopoly districts. On all sales and purchases the merchants collect a small, but fixed, sum and utilize the money thus collected for some public purpose. Compare similar words, as kayinmai corrupted into koyma, branma, etc. 'Kattigai-avasaram appears to be some sort of tax on fire-wood; and patai (padai)-khanikkai is the contribution to be made for the maintenance of the army. Pachchai means a kanikkai, a naxar, a present on important occasions. In this sense the word is employed in contemporary literature ; for instance, in Sri-rachana-bhashanam, I, 33 and 34. Such kanikkais seem to be given in the months of Adi and Karttigai. The following places and rivers are mentioned in the inscription :-Tungabhadra, Vijayanagara, Tiruchchirappalli, Kaveri, Raja gambhira valanadu, Panda-mangalam, Tirunalur, Beranaibanda-peruma-pallur, Rajaraja ralanadu, Melmur of the Mala nadu and Sunepuha-naltir. Of these the Tungabhadra and the Kaveri are the well-known rivers of South India. Tiruchchirappalli is the modern town of Trichinopoly, the head-quarters of the district of the same name. The part of the conntry immediately to the south of the river Kaveri was known to medieval inscriptions as the Rajagambhir talanadu, and that on the north of the kame as the Rajaraja valanadu. Mala nadu is & sub-division of this territory and has given its name to a section of the Tami] Brahmanas, i.e. the Btihach-charana community of Mala nadu. Vijayanagara, the capital of the famous Hindu kings of Southern India, is the modern Hampe on the Tungabhadra. Panda-mangalam is a village & mile and a half west of Trichinopoly : this and Tirunelor are in the Trichinopoly Talak; the correct form of the name Soranaibanda-perama-nallar is Seragai-vepra-peru mal-nallar. There is a village some distance south of Pandamungalam called Vendaraya-Dallor. This is perhaps the same. Sunepuha-nalar is situated at a distance of seven and a half miles to the north-west of Trichinopoly. TEXT [Metres: v. 1-25, Anushubh, and v. 26, Salini.] First Plate : Second Side. i forefana na: [n") 74(:))FT [n*) (:) 2 tsfri A[][] [] tot HFU [n*) TH(:) golfo From ima prensions prepared under my supervision. * Rend Erfer
Page #138
--------------------------------------------------------------------------
________________ No. 8.] SRIRANGAM COPPER-PLATE GRANT OF DEVARAYA II. 118 3 staMbhAya saMbhave(ta) [ 1"] bhU[ya meM bhavatAM bhUta bhUyAdAccharya4 kaMjara:[*] pAhuvihArakAMtAra [*]gamAnyasya [yo]b ginaH / / 2"] kSemaM vaH pracurIkuryAtkSoNImabhyuhahaMnayaM[1] [ko]6 DAkRterabhUdyasya krIDApalya[la] maMbadhi'[: 3*] pasti cIrA[]7 vodbhUtamapI puSpi]manuttamaM / pannAnadaM nirmAtyamAdha.' 8 te zirasIzvaraH [ // 4"] sadAmodanidhestasya saMtAneya[saM]-10 9 [ni]te [*] prabhUdAyaryama[1]dhuryaM vasudhAyAstapaHphakhaM [u b*] 10 saMgamo nAma ga[jAbhU[sArabhUte tadanvaye [*] reje yasya 11 yaza:ziMdhauH" sara[NI]va surApagA [ // 6"] sarvarabanidhei]12 stasya saMmADAsIttanUbhuvaH / mo bukamahIpAlo ma18 NonAmiva kaustubha: [ // 7] tasya gaurAMvidAjAnesta(nayo vi). 14 nayobhUhuNe bata: [*] [hAragaurayazaHpu"rahArihariha[2]15 zvaraH [n 8*] "yaSoDapamahAdAnayazasA digvihAriNAM [*] bhUya[sA]16 mabhavanAla bhuvanAni caturdaza [ // 9*] pratApadevarAyAkhyaH 17 putrobhU[ ]"vi vizrutaH [1] pramoda va mUrtI ya: prajAnAM svairgaH . 18 Naira[bhu]"t [n 10.] pratya[thi]samidho hutvA pratApAgnau rAMkaNe [*]" 19 vijito yen(|) vIreNa vijayazrIkaraNAH [1 11"] tasya de.. 20 mAMbikAjAnistanayo vinayobata: [*] vidyAnidhi. 21 vizeSatro vorI vijayabhUpatiH [ // 12"] dayAnidhera[bhU]- . 22 tasya devInArAyaNAvikAM ] poreriva mahAlamI: zaM. 23 [ka]rasyeva pArvatI [a 13*] putrarUpaM tayo [:] mAdhyaM purvajanma ta. Second Plate : Furst Side. .24 pa:pAla [1] devarAyamahIpAlo dAtA dIvyati bhUtale [u 1401 25 vikrame vikramAdityaM bhoge bhojamivAparaM [1] rAjarAjaM vi. 1 Readf. * Bead dApaya. - Read degmambudhiH - Read santAnaM yaduHsaMcitam. # Read 11. " Read vAvaM. >> Read more Read bhUyasya * Read kAntAramA * Read degmam. 1 Boad yama: sindhoH Read a. 11 Rend . * Read bhUtya. * Read cayana * Read cabAna badanirmAba'. 1 Read sAbAgasautamabhavAma. " Rend yapIDA 28 Read . * Ready
Page #139
--------------------------------------------------------------------------
________________ 116 EPIGRAPHIA INDICA. [VoL. XVII. 26 taraNe rAjAnaM yaM pracakSate [ // 16*] abhaMgamaMgakALiMgavaMgAdyA. 27 zAmarAdibhiH [*] rAjAno yaM viSevaMte rAjacinhai: svayaM[4]28 taiH [ 16*] rAjAdhirAja(:)stejasI yo rAjaparame [va]raH [*] bhASAti. 29 laMdhibhUpAlabhujaMgabi[ka]dobataH' [ 17*] mUrurAyaragaDAka: 30 pararAjabhayaMkaraH [1] hiMdUrAya[sa]ravANI vaMdivargeNa vaM 8l Wte [n 18*] zrautuMgabhadrAparidhe nagare vijayAye [*] piyaM 32 siMhAsanaM prApya pAlayanpU[thi]vItimA [n 19*] paMNya[*]kA33 gragaNyo] sau devarAyamahIpatiH[*] dhivalIke sakathA34 [bde] [vaMgAiya[vaccha 2] [120"] ka[]rttike mAsi suMdhAyAM" hAda[myA]35 mArkavAsaye [*] tuMgabhadrAnadItI[2] zrIvirUpAkSasaMmi36 [dhau] [ // 21*] tri[si]rApalirA[jye] rAMjagaMbhIrabalabhide" kAveriya37 dakSiNe pADamaMgalagrA[ma*] []lubhau tirunalUrapi seranaibaMDa38 perumAnalurapi uttareyAyakanyAyo" rAjarAjabalabhi39 dhe pravajapade sunepuhanaluradhA ubhau zrIraMgarAjaya pari40 yArtha nArAyaNababhidha[*]nata: thenaiva" devarAjena dattaM gova41 budhArayA" // svasti zrI jayAbudAya sekavarSa' 1350 navaM42 gasaMvaccha rada kArtikasudha uttAnuha[[*] dasi"puNyakAlada 43 zrImanmahArAjAdhirAjaparamekha ra zrIvIrapratApade44 varAyamahArAyara zrIraMganAthadevarige nArAyaNadevI. 45 [*]vagala hesarazi oMdu pavasarava namuva padake dina 46 [oM]dake haberaDu parivANanaMdAdIvirgavagamAle poM Second Plate : Second Side. 47 du tirunAtu na(1)Davudake koTa darmazAsana [:] uttAna"[1]. . Bend niSevale. + Read bhunAvirudonnata: - Read mahAsa - Read degmi. * Read hindu * Read zakecAbda. * Read gaNIsau. Read puNya. n Road - Read ssa. 12 Read t. vAya. " Eend rAmagauravalAmiyakAvA. " Read sabyakanyAyA. " Read pAsamAsayAma ityubhI-. " Read cAcAbhidhAnataH tiva. " Rad dhIratarAjasva paricaryArtha'. 10 Rend sanjuidhArayA. 21 Road utthAnavAdamI. - Read nayAbhayudayamaka. n Read ma. * Read degvadI. 11 Read 7. * Read H. * Bead * Resd . 10 Read ssa.
Page #140
--------------------------------------------------------------------------
________________ F. W. THOMAS SCALE TWO-THIRDS WHITTINGHAM & GRIGGS, PHOTO-LITH. 10 12 14 16 18 20 22 somAthi pataye namaH namaHstre namaH stre namaH lugA bidra baamakAna vAmana gAtamu sutAyata tAdA (avikA nAtA gamA zinamaMtaHkaryANI mRtyu hAta tujhA kI apalamamaM buddhistadI to hutamapApAnummA amAnA malA mA nirAsI evaM sadAmoM duniyAtrA saMtAnaya naya AludA samaya va yA yAsAra saMgamA nAmasA tu te tada vaye rA parAzrayIvara nAgAsa varAtraniya saMDAsInatama mahIpAlAna nAmitako mRtaH sAgaurItikA manastatyati niyoga yarAH prahAcI khAU dArAtayarA sarivihAyasa matRtatAlanUtanAturAtA de tayAra putanutitirAtaH pramAitamutrIyaH ghAta simiyAda nAgha milIyanavItasAkhIkA saMgrahaH tasAde mAlikA sAtastratayo tinayAta taH vittiya tarI ovIta ayanupatiH yAtiya sAre tItA yA bakArai citumahAla strI rAM pAvatI putrapatyAlA vasamata 4 6 8 10 12 14 10 18 20 22 24 28 28 30 32 34 36 38 40 42 44 46 iia. paHpAla tAya mahIlA hAtA hI jJAti vikramavikramadita tolA amitAva aMti saMta anaMga maMgakA ligaaeN| svAtmaniyaMdviSataMtra ai jaina Adi Aste aratIya aparA maramataH tAtpati lekina pAlana saMgati virAgur3Aka prajayakamAsurAva gAyatra siMhAniyA pApAjayatavidItmA yA se| rAgAlA pAya sahI vilAsarA vaizAkha karUna kAmAMsI yAcA hA rA kAyanugatAtIla vAsaMti vipili balukA veriya bar3a abalati ye maMgalavAra mAtalA pahalu cyAu tAsagA yA dhannA mAyA naniyatataH vade va nAna tayA yA khasiyA varSAla gata vanakA tikatA iti prAtakAla sImaM mahArAjAnA paDe mahAnAsI maMgatAghadeva ginAI vI savAla he sallaOM duA vasa navasa camara ke dina ke kSetra hani vAmana dADI vi vanamAla a 24 28 28 30 32 34 36 38 42 44 48 Srirangam Copper-plate of Devaraya II : Saka-Samvat 1349 (1350).
Page #141
--------------------------------------------------------------------------
________________ iib. 152 tipitAlakAhanoharamarAsinatAnahI 48, sopaM lAladalagatadAtIcar3aliyAvinA kA sanisiyalli tAUmADirasaha vagAhAnAggavA 50 jisa aMganAghadevanigamaMgagatA jama miti piDiga tasavakaDamAsAisathapAsamAnatA "tAjilipibapalinA vaDiyAgatAsAlA bADama-ma hAtaliyApahi magala imAma dalahalititAla jagAsavana taDapanA mAlatala gAmamatavihAhAmA hA ke kula3.43 kA mAmalA clnaa| umalatAha malemakisane murulalagA ma ra 3 ka la 4205 taya gAma. yAsaha / kakalagaADIbarAmI icavata sIme ga salavanavadhavA pacipA yuvA salamatapeja hama tanika imAmA va De mnvdde| kalavaDe kAlAyatinigamAya dha kaha ma tamilAi me tuvAtIpA Tama meM kaThiI vasana kA ke mAhi jAti pacana ni, tAisabalatvanA dApasa kala tatA dApani citipakalapANAmasimAjAma 70 sisAyAmatADamasatIgatatvAmAsAvitava0 gimAvar3A striAciyAgisavamAA vAgi samisi choTe vA giyA jaMgalAghavanigamagAMgatA 2 "samatapaDiyanataisisakAdi antavisa ||ddaatpaalnpaamyaadaataa yAtupAlatara 4 jAvarAma vAtAtipAlanAdabutapadAvAdattA patA kAyApalavasaMyanAma savapasaharamA mavikSAyAmAyatavimivAra ke vanazinAlAsA timAma vatana gItatA gamAnakA nayAhayAvipada lAva yanAvaha tAhi gurapAra jAtAnA 40paDatADA pAravara taMtikAraleta vatAsAmA / vAmasatatakA kAlakAlepAlatoyAnavahivA 82 tiyatAttAvinAviDAstAniyAyAvatamAmavara JAY KAM FOC 62
Page #142
--------------------------------------------------------------------------
________________ No. 8.] SRIRANGAM COPPER-PLATE GRANT OF DEVARAYA II. 113 48 dasIpuNyakAladalu tuMgabhadrAtIradali zrIvirUpa[1]49 saMnidhiyali nAU' mADida sahasagodAmAggava[1]-" 50 gi zrIraMganAthadevarige aMgaraMgabhoga amiritubl paDige tassavaccharada pAsAGa sutha pAhya pArabhya52 vAgi ciripallicAvaDiya rAjagaMbhIra poMka 53 nADa amaradahomaliya pAMDamaMgalada grAma 1 . 54 daraluhalli tiranAlara grAma 1 seranebhaMDaperu55 mAlainalUra grAma 1 pat' piDAkaisaha pAma bhoMda56 ke kula 1403 [1] vaDakara rAjarAjavaLanA57 Da malanADa melamuriya sunepuhanalura grA58 ma oMdake kula 420 [*] ubhaya(:)grAmayeraDa59 kaM kuLagadya[*]Na 1823 [*] kaMdagrAma era60 Dara catusomege saluva naMce puMce vAM61 napayiru puMpauru vAMsalumane peruka62 Dame tarikaDamau" mAvaDe maravaDe 63 kuLavaDai kalAyaM tirigai bhAyaM pe. 64 kaDamai tarikaDamai bholakunIpA65 TaM mahamai kaThigaiavasara paTe-13 66 kANike pADikAtikai(7)pacai ma. 67 tu" enujaMtA hosavari" ileva Third Plate: First Side. 68 ri muMtAda sakala suvarnAdAya sakalabhatA-10 69 dAya nidhinikSepajalapASANa pakSiNi pAgAmi 70 sihasAdhya muMtAda aSTabhogataja[:]khAmyasa[hitava[1]. 71 gimAcaMdrArka stA"yiyAgi sarvamAnyavAgi serisi 72 koTevAgi zrIraMganAthadevarige caMgaraMgabho. 73 ga pramutapaDiyanu naDasi sukadiM anubhavisu74 badu / dAmapAlamayormadhye dAnAccheyonupAlanaM [1] dA1 Road pukha. * Rend nAbAgi.. * Read tasaMvatsarada pApADhaeja pAyame. * Read tiracirApali. * Rend zeranaivenapenamAnnara - Read cantu. * Read baDakara * Read pAndake. 10 Rond punpayir pAza manapevakaDamai.. Read kaDama. 13 Read Odru. This and tari-kadamai are repeated annecessarily. W Road . * Read 'kArtika paJca mattu. 16 Read eft 16 Read . 1 Read sthA. " The letter na in pAvana looks like a. - Read bhAvu:
Page #143
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. 75 nAtsvargamavApnoti pAlanAdacu taM padaM // 76 ratAvA yo harata vasuMdharA[m / "] 77 pi viSTAyAM jAyate krimiH // [28] 78 vaiSAmeva bhUbhujAM [] 79 vasuMdharA // [21 *] svadattAMddiguNaM puNyaM paradattAnupAla na bhogyA na karayAcA viprada 80 naM [*] paradattApadAreNa vadataM niSphalaM bhavet // [25* ] sAmAnyo81 yaM dharmasetu nRpAcAM kAle kAle pAlanIyo bhavadbhiH / sarvA 116 82 niyatAnumnAvina[: *] pArthiveMdrAn bhUyo bhUyo " yAcate rAmacaMdra [: 26* ] 83 zrovirUpAkSa " [22] khadattAM [pa] - SaSTivarSasaca [cA]-" ABSTRACT OF CONTENTS. Verse 1. Adoration to Sambhu (Siva). V. 2. Adoration to Ganesa V. 3. Adoration to Varaha. Vv. 4-5. On earth, as the fruit of its tapas, was born Yadu in the family of the Moon, which came out of the ocean of milk and is worn by Siva on his head. ekeva bhaginI loke sa Vv. 6-7. In his race was born a king named Sangama. His middle son was Bukka, who resembled the jewel kaustabha among other jewels. [VOL. XVII. Vv. 8-9. To him by Gaurambika was born a son, named Harihara, who was gentle and famous. The renown of his making the sixteen great gifts (mahadana) redounded even beyond the fourteen worlds. Bond yu. Bend 81. Vv. 10-12. His son was Pratapa-deva-Raya, who appeared the embodiment of the happiness of his subjects. He conquered his enemies in battles by the prowess of his arms and obtained the favour of Vijaya-Lakshmi ( goddess of Victory ). To him, as husband of Demambika, was born the prince Vijaya-Bhupati. Vv. 13-18. The queen of Vijaya Bhupati was Narayanambika. As the fruit of the meritorious acts done by them in their previous birth, Deva-Raya was born to VijayaBhupati and Narayanambika and distinguished himself on earth. He is compared to Vikramaditya in valour, to Bhoja in his bhoga (P) and to Raja-raja (ie. Kubera ) in his munificence. The kings of the Anga, Kalinga, Vanga, etc., countries did homage to this king, holding chamaras and other royal insignia in their hands. He bore the birudas Raj-adhiraja, Raja-param-dvarn, Bhashatilanghi bhopala-bhujauga Maru-riyars-ganda Para-raja-bhayan kara and Hindu-raya-suratrana. * Read dattAM * Bend kRmi: V. 19 to the end of line 41. Deva-Raya, who, seated on his ancestral throne in Vijayanagara, which has the Tungabhadra as its ditch, ruled the earth, made the grant of the villages of Panda-mangalam, Tirunalur, Seranaibanda-pervma-nalur and Sunopuha-nalur to the god Ranganatha. The gift was made in the Saka year 1349, which is given by the chronogram dhivaloka and which corresponded to the (cyclic) year Plavanga, on a Monday 8 Read "pahAreNa vadataM. 1 Read bhUyo bhUyo. [Read hAra - Ed.] 10 Bead 'maitAn bhAvina : This line is written in Telugu-Kannada characters. * Read paSTiM hasrANi Read of. * Read.
Page #144
--------------------------------------------------------------------------
________________ No. 9.] MOMIGATTI INSCRIPTION OF VIKRAMADITYA VI. 117 the twelfth tithi of the bright fortnight in the month Karttika, in the presence of the god Virapaksha on the bank of the river Tungabhadra. The villages Panda-mangalam, Tirunalir and Soranaibenda-peruma-nalor are said to have been situated on the south bank of the river Kaveri, in the Rajagambhira valanadu, belonging to the Trisirappalli rajya, and Sunaipubanalur in the Rajaraja valanadu of the same rajya, but situated on the northern bank of the Kaveri. Lines 41-74. In the Saka year 1350, Playanga, on the auspicious occasion of the Utthanadyadasi in the bright half of the month Karttika, the king Vira-Pratapa-deva-Raya Maharaya gave the following sasana (order) for performing one avasara consisting of twelve harivanas of perpetual lamps, garlands and one festival every day to the god Ranganatha in the name of Narayanadevi-auva : the gift of the villages of Panda-mangalam, Tirunalur and Seranaibandaperuma-nalur, yielding 1,403 kula-gadyanas, and Sunepuha-nalur, yielding 420 kula-gadyanas, was made for the anga, ranga, etc., of the god Sri-Ranganatha, as an auxiliary to the gosahasra mahadina made by the king on the auspicious occasion of Utthana-dvadasi in the presence of the god Virupaksha on the bank of the river Tungabhadra. The villages Panda-mangalam, Tirunalur and Seranaibanda-peruma-nalur were in Amarada hobali of the Rajagambhira valanddu in the Chirichrapalli chavadi, whereas Sunepuha-nalur was situated in the Melamuri of the Mala nadu, & sub-division of the Rajaraja valanadu in Vadagarai (northern bank of the Kaveri). These villages were to be enjoyed from the first tithi of the bright fortnight of the month Ashadha of the same year. The king granted these villages with the following rights of enjoyment : namely, the taxes on the lands under wet and dry cultiva. tion, as also van-payir and pum-payir, the taxes called thev asal., manai-peru-ka damai, tarikkadamai, mavadai, maravadai, kulavadai, kal-ayam, tirigai-ayam, per-kkadamai, tarikkadamai, alukunipattam, mahamai, kattige-avasara, padai-kanikkai, Adi-Karttigai-pachchai and all other new and old taxes, all income in gold and paddy and the eight kinds of enjoyment, nidhi, nikshepa, etc. Vv. 22-26. The usual admonitory and imprecatory verses. Line 83 contains the words Sri-Virupaksha, the king's signature. No. 9.-MOMIGATTI INSCRIPTION OF THE 49TH YEAR OF VIKRAMADITYA VI. BY LIONEL D. BARNETT.. Momigatti is a village in Dharwar District, a few miles to the north-west of Dharwar town, in lat. 15deg 30' and long. 74deg 59', according to the Bombay Survey. The present inscription, now published for the first time, was found in the local temple of Kalamasvara, on the left side of the image. An ink-impression was prepared for the late Dr. Fleet, which is now in the British Museum ; from it I have edited the text. The stone has a rounded top decorated with sculptures, namely, in the centre a linga, on the proper right of which is a priest stand. ing facing it, while another apright figure stands to the proper left, all three being in a shrine : to the proper right of the priest, a cow and calf; to the right of the latter, & scimitar ; in the opposite corner, a bull; above these, the sun (on proper right) and moon (on left). Below this is the inscribed area, in two compartments : the first of these, comprising lines 1-2, is 2 ft. 31 in. wide and 2 in. high, and the second, containing lines 3-30, is of the same width and 2 ft. 9 in. high.-The character is good Kanarese, of an upright rounded type that was beginning to come into use about the middle of the twelfth century. The height of the letters varies from in. to 4 in. The jh (1.9) and 1 (II. 19, 26) may be noted.--The language is Old Kauarese, with two The "Meemeeguttee of the Indian Atlas seems to be intended for Momigatti ; bat its position does not quite tally with that of the latter as given in the Sarvey.
Page #145
--------------------------------------------------------------------------
________________ 118 EPIGRAPHIA INDICA. [VOL. XVII formal Sanskrit verses (Nos. 1 and 5). The ancient has been changed to ? in kulam (1. 14), belpa (1. 16), alidavarggoy- (1. 27), el-koti (1. 28), and to r in garddey [* ]man (1. 22); it is falsely used for in todald (1. 16). P is changed to k in hallio (11. 19, 20), but elsewhere retained. Three words are of some lexical interest, viz. tyoga-jaga-jhampi jhampalacharyya (1. 9), on which see above, Vol. XII, p. 251, and nrita (1. 14), which is abstracted from the ordinary sunrita, and is parallel to ansitika," untruthful" in Asvaghosha's Buddha-charita, II. ii. The record, after referring itself in 11. 2-4 to the reign of Tribhuvanamalla (Vikramaditya VI), introduces the Kadamba fendatory Jayakesi (II), who is decorated with the characteristic titles of his dynasty, and his senior queen Mailala-devi (the daughter of Vikramaditya VI), as jointly reigning (11. 4-13). On the historical points involved herein it suffices to refer the reader to Vol. XIV above, p. 299 f. Then follow verses in praise of Vamasakti, a Saiva divine, and Udayamma Gavunda (11, 13-17), after which comes the formal statement of a gift of land and houses by the latter to the sanctuary presided over by Vamasakti (11. 17-24). The date is given on 11. 17-18 as: the cyclic year Krodhi, the 49th of the Chalukya Vikrama era ; Ashadha fuddha 5; Sunday. This is irregular. The given tithi was current at Bunrise on Wednesday, 18 June, A.D. 1124, and ended about 9 h. 16 m. after mean sunrise. The only places mentioned are Kundar (1. 19), Eranigereyahalli (1. 19), Konnagagere (1. 21), and the tirthas (1.25). Kundar is the modern Narendra, on which see above, Vol. XIII, p. 298. TEXT. [Metres : vv. 1, 5, Anushtubh ; v. 2-4, Kanda.] 1 Namas-tunga-s[i]ras-chumbi-chamdra-chamara-charave (1") trailokya nagar-arambha-ma!a-stambhaya Sa(ta)mbhavi || [1"] Svasti samasta-bhuvan-draya Sri-Pri(pri)thvi-vallabha maharajadhiraja paramosvara paramabhatt[a]3 rakam Satyasraya-kula-tilakam Chaluky-abharanam srimasto]-Tribhuvanamalla devara vijaya-rajyam=u. 4 ttarottar-abhivridhidhi-pravardhdbamanam-a-chamdr-Arkka-tarar-baram saluttam-ire Tat-pada-padm-Opajivi | (c) (c) 5 svasti samasta-bhuvana-samstayamina Hara-Dharani-prasuta-Trilochana-Kadamba vamsa-mah-oda (ya] 6 Mahidharondhra(dra)-sikhar-abhyudayamana-maha-prachamda-marttarhda marttanda kar-titivra-nija-prata(pa]7 Valikrikri)ta-sakala-mahi-mandalan=attunga- sinha-lamchchhanam vanara-mahi dhvajam perm matti-taryya-nirgghoshanam 8 chaturi(ra)fiti-nagar-adhishthit-ishtadas-Tavamedha-diksha-dikshita-kula-prastita Hima vad-girimdra-rumdra-Sikhara9 sthapita-maha-lakti-prabhavam tyaga-jaga-jhampi jhampal-acharyya nissanka-Rama bu(eu) bbate-kanaka-nikash-Opala 1 I have to thank Mr. R. Sewell for his kindness in verifying my caleulation * From the ink-impronion
Page #146
--------------------------------------------------------------------------
________________ No. 9.] MOMIGATTI INSCRIPTION OF VIKRAMADITYA VI. 119 10 saran-agata-vajra-prakara lok-aika-kalpa-druma samkranti-dhavala mirtti-Narayana kirtti-marttamda 11 mandalika-lalata-patta vairi-gharatta su(su)bhata-raja-Sikhamani Kadamba chudaman=Ity-akhila-nam-ava12 li-sami(ma)lamkritar=appa sriman-mahamamdalesvaram Jayakesi-devar srimat piriy-arasi Mailala-mg13 hideviyaru sukha-samkatha-vinodadim rajyam-geyyuttam-ire | O Pasid=ar: bband-una b@didod-osed=&14 ttwill-ennad-ikkut-irppare kulam vasudhatalam-ellam bannisuvinegar Vamasakti. pandita-devar (2*] Nrita-vakyam vamdi-ja15 n-asrita-sura-taru Malla-Gavumdan=arra(gra)-tantijamm atimantam Hara-bhaktam kshitiy-olag=Udayamma-Gavu16 dan=uttama-purusha || [3] Sidil-annam ripu-nichayam todald(rd)-edeyo! belpa janake sura-taruvannam kudut-e17 deyo! Banana vol Mrida-bhaktam dharanitalado!=Udayama-Gavumdal || [4] Svasti grimach-Chalukya18 Vikrama-varshada 49neya Krodhi-samvatsarad=Ashada(ha) su(su)ddha 5. Adityavaradamdu sriman-maha-pa19 tanam Kundora padinaruvar=ggavumaugala Pancha-matha-sthanada sannidhiyo! Eranigereyahalliy-A20 karika(?)? Malla-Gavum dana magan=Udayama-Gavumdam halliyindam paduval= kal-pumjikey=adarim ma21 dal-ondu mattar-pparala keyyuman=or=umba Konnasagereya madana kotiyalu nuru ka22 mma garddey[u*]mam devarim temkal-eradu maneya nivesanamumam Kali-deva svamiya sthan-acha[ryya Va]23 magakti-panditargge kal-garchchi dhara-purvvakammadi sarva-namasya(sya) Barvva-badha-pariharam-[agi]24 y-Udayama-Givundamna-chandra-sthayiy-agi bitta dharmma | I dharmmamam pratipali[si]25 davargge Gamge Varanafi Kurukshetra Prayagey-emba punya-tirttha-sthanamgalol sasira kavisle) - 26 ya kodun kolagamam pafcha-ratnadol=katcisi veda-paragar-appa maha-brah manargge danam-geyda [pha)27 la 1 dharmmaman-alidavarggey 888[i*]ra kaviley[n]man-a veda-paragar-appa maha-brahmapa (ru)28 mam e!-koti tapodhanarumanus punya-tirttha-sthanamgalo!-konda maha-patakan akku || 29 Sva-datt [a] para-datt[a"] va yan(70) hareti(ta) vasundhara[m*) shashtir virisha-shasani vi30 shta(shtha)yam jayata krimi[5*] 1 The syllable ma is metrically superfluous. Read varsha-sahasrani. Apparently so; but the first ka may be read as ra or ga. * Read krimin.
Page #147
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. VOL. XVII. TRANSLATION. (Verse 1.) Homage to Sambhu charming with the yak-tail fan which is the moon kissing his lofty head, the foundation-column for the construction of the city of the three worlds (Lines 2-4.) While the victorious reign of-hail ! ---the refuge of the whole world, favourite of Fortune and Earth, great Emperor, sapreme Lord, supreme Master, ornament of Satyasraya's race, embellishment of the Chalukyes, king Tribhuvanamalla, was advancing in # course of successively increasing prosperity, (to endure) as long as moon, sun, and stars : (Lines 4-13.) While he who finds sustenance at his lotus-feet, -hail !-the Mahamandalesvarn Jayakesi-deva, who is decorated with the whole series of titles of honour, to wit," the noble scion of the Trilochana-Kadamba lineage sprung from Hara and the Earth which is praised over the whole world; great august sun rising upon the peaks of the Lord of Mountains ; fascinating the whole circle of the earth by peculiar majesty exceedingly intense as the sun's rays; having for crest a stately lion ; having a banner (bearing the derice) of a great ape ; who is (saluted) with the noise of permati drums and (other) musical instruments; who is sprung from the rnce presiding over eighty-four cities and consecrated in the consecratory rites of eighteen borse-sacrifices; who has established the puissance of his might upon the massive summits of the Lord of Mountains, the Himavat; a jhampalacharya surpassing the world in bounty ; Rama in intrepidity; a touchstone for the gold of warriors; an adamant castle for seekers of protection ; a unique tree of desire for the world ; white (of fame) as the time of conjunction; a Narayana incarnate ; a sun of glory; a frontal fillet of feudatory princes; a grindstone to foes; & Crest-jewel of warrior kings; a crest-gem of the Kadambas," and the Senior Queen Mailala-mahdevi, were reigning with enjoyment of pleasant conversations : (Verse 2.) If any, being hungry, should come and ask for food, Vamasakti Pandita-deva will gladly give to him rice without saying nay, so that the whole earth praises (him). (Verse 3.) Of Malla Gavunde, who is pleasant of speech, a celestial tree to panegyrists and dependents, the eldest son is Uday.mma Gavunda, who is sage, devoted to Hara, a right noble man on earth. (Verse 4.) Like a thunderbolt on occasions when hosts of foes assail (him), like a celestial tree on occasions when he makes gifts to suitors, devoted to Mrida like Bana, is Udayama Gayunda on earth. (Lines 17-24.) Hail ! On Sunday, the 5th day of the bright fortnight of Ashadha in the ogclic year Krodhi, the 49th (year) of the Chaluk ya-Vikrama era, in the presence of the Sixteen Gavundus of the great city of Kundur (and) the establishment of the Five Mathas, Udayama Gavunda, son of the Akarika(P) Malla Gavunda of Eranigereyahalli, having laved the feet of Vam sakti Pandito, Acharya of the establishment of Kali-deva-svami, with pouring of water granted for as long as the moon shall endure a pious foundation on sarvanamasya tenure, immune from all conflicting claims, (comprising) a gravel-field of one mattar west of the village (and) east of the stone-heap, and a paddy-field of one hundred kamma at the eastern corner of the Konnasagere used by the town, and two dwelling-houses south of the sanctuary of the god. (Lines 24-28 : a prose formula of the usual type.) (Verse 5 : a common Sanskrit verse.) 1 Cf. divalichara-dhavalar, above, Vol. XII, p. 269. The phrase probably refers to the Diyavall or Diwali festival, from Asvina kr. 14 to Karttika su. 3.
Page #148
--------------------------------------------------------------------------
________________ No. 10.] ARASIBIDI INSCRIPTION OF THE REIGN OF SOMESVARA I. 121 No. 10.-ARASIBIDI INSCRIPTION OF THE REIGN OF SOMESVARA I: SAKA 969. BY LIONEL D. BARNETT. Arasibidi, the ancient Vikramapura, is a decayed village in the Hungund taluka of Bijapter District, situate in lat. 15deg 54' and long. 75deg 58' (cf. Ind. ant., Vol. 30, p. 260). Its name is written as Arsubidda on the Indian Atlas sheet 58 and the Hyderabad Survey sheet 30. In the local temple known as the Salegudi was found a broken tablet containing the present record ; en ink-impression was prepared for the late Dr. Fleet, which is now in the British Museum, and from it I now edit the text. The upper part of the stone is decorated with some sculpture. Immediately over the inscribed area, on a plinth, is a figure of a squatting Jina, with a cow and sucking calf on his proper left, between two columns; and above this is a series of architectural divisions culminating in & vase-shaped fikhara. The inscribed area below is about 2 ft. 21 in, broad and 2 ft. 2 in. high ; but a line or two at the bottom is lost.-The character is a fair Kanarese of the period. the letters vary from in. to in, in height. The ri of rishiyargga[*] in 1. 8 is denoted by a modified ri with a tail attached -The language is Old Kanarese prose, except for the Sanskrit verse-formula of which the first two letters appear on 1. 22. The archaic ! is changed tol, except in appattara (1. 12, for elp, through erppo). The word sarugi (1. 7) is of some lexical interest. The record, after referring itself to the reign of Trailokyamalla deva, i.e. Somesvara I (11, 1.4), relates, that Akka-devi, while in the camp around the fortress of Gokage, made a grant of lands to the Gonada-bedangi Jain temple at Vikramapura, for the maintenance of the establishment and of the attached friars and nuns, among whom special mention is made of Nagasena Pandita of the Hogari Gachchha of the Varasena Gapa of the Mala Sangha (1. 4-9). The rest of the inscription is taken up with the details of the endowment; among these we learn that some of the land was purchased from Dadigarasa (1. 17), who was very possibly a member of the Bappura family which has left a record of its history in the Sadi inscription no. K. (above, Vol. XV, p. 106; cf. Ind. Ant., Vol. XXX, p. 266). The date is given on 11. 9-11 as: Saks 969, the cyclic year Sarvajit; the new-moon of Chaitra, a Sanday; an eclipse of the sun. These details are perfectly regular. The given titii corresponded to Sunday, 29 March, A.D. 1047, on which day it ended 6 h. 14 m, after menn Bunrise. On the same day, at 5 h. 54 m. after mean sunrise, there was an eclipse of the sun (Indian Calendar, p. 121). The following place names are mentioned : Gokage (1.6); Vikramapura (11 6, 13); the Kisukadu Seventy (11. 11-12); Ganada H&lur (1. 12); Muruvadina Palu (1. 13); Rayagatto (1. 15); the tank of Kappadi (1. 18); Bengres (1. 19). Gokage in the modern Gokak, the headquarters of the Gokak taluka, in Belgnum District, situate in 16deg 10 lat. arid 74deg 49' long. Vikramapura is Arasibidi (see above). On Kisukadu see Ind. Ant., Vol. XXX, p. 259 4. Gipada Halar is given on the Indian Atlas as "Ganudu hal," about 3 miles S.E. of Arnsibidi in lat, 15deg 52' and long. 76deg 1' (cf. ibi l., p. 261). The other local names I cannot trace. See Dyn. Kan. Distr., pp. 485, 439. Dr. Fleet understood the words sutt-irdda to nesu" besieging," which is possible, but not necessary. * This title is evidently derived from Akka-devi's titlo gurada bedangiyar, and shews that the temple was under her especial patronage. This name occars slso, in the older forin Pogari, in Ind. Ant., Vol. XIX, p. 272, and Ep. Carn. VII. i., Sk. 124. * I have to thank Mr. R. Sewell for his kindnos in verifying my calculations.
Page #149
--------------------------------------------------------------------------
________________ 122 EPIGRAPHIA INDICA. [Vol. XVII. TEXT.1 . Svasti samasta-bhuvan-asraya Sri-Prithvi-vallabha maharajadhiraja paramesvara-pa2 ramabhattaraka Satyasraya-kula-tilaka Chaluky-abharana Srima[t]-Trailokyama3 lla-devara vijaya-rajyam-attardttar-abhivri(vpi)ddhi-pravarddhamanam-a-chamdr arkka-ta4 ram-baram saluttam-ire (1") Svasti ari-nri(nri)pa-makata-ghatita -charap-aravi. (vi)mdeyar=Gganga-snana5 pavitreyar-ddin-anatha-chi(chi)ntamapigal-eka-vakye[ya"]r=ggunada bedamgiyar=appa srimad-A6 kka-devi[ya"]r Gokageya koteya vu(su)tt-irdda bidinalu Vikramapurada Gonada-bedamgiya 7 Jin-alayakke k handa-sphutita-sudba-karmmakkam gandha-dhupa-dipakkam saragiga [m] Mala-sanga(gha)8 Va[ra]sena-gapada Hogariya gachchhada Nagasena-panditargga[] all-irppa 'pishiyargga[m] ajjiya9 rgga[m] ahara-danakkam ajjiyara kappacak[k*]am kuduva bhumi SA(sa)ka varsha 989 neys 10 Sarv vajit-samvatsarada Chaim(chai)trad=amasye Adityavaradandina suryya-gra11 hapa-nimittam dhara-parvvakar mali nagaradh(a)=anubhavape(ne) mukhyam agi Kisu12 kad-eppattara baliya sarvva-namasyam-agi bitta badam Ganada Halur-omdu 13 Vikramapurada yisanyada des[e(r)]y[im"] tomtam mattar=ondu Arim terka Majavadins pa14 Ja nairityada deseyim pandita-Nagadevat ge Barv -namasya martta pann. neradu allim tenka 15 Parekara Ketajamge sarva-namaya mattaraeirppatta-nalku tirim badaga Raya gatteyim 16 muda parekasa Ketajamage tomta mattar omdu allim paduva kalkutiga Surojange sa17 rbba-namasyam mattaru pannerada tomta mattar-omdu Dadigarasana kayyala maru-gopdu devargge kot[ta] 18 bhumi Kappadiya kereyim temka manneya-v [O]ladalu Arvva-namasya mattaru 50 [I] 19 (1) dharmmamam sva-dharmmadi rakshishi(si)davar Varanasiyalu onda koti kavileya20 man veda-palanar=appa br[a]hmanarige kotta pha[la]mam padevar (1) dharmmaman-alidava21 r i sthanadolwanita kaviloyuman=anirpe(ta) brahmapar[umam ........] 82 sa(r) | Sama[ny8=yam .....................] 1 Prom the ink-impression. * The engraver has written ghata, and added fi in smaller script ander the line. Read mattar.
Page #150
--------------------------------------------------------------------------
________________ No. 11.) THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 123 TRANSLATION. (Lines 1-4.) While the victorious reign of-hail !--the asylum of the whole world, favourite of Fortune and Earth, great Emperor, supreme Lord, supreme Master, ornament of Satyasraya's race, embellishment of the Chalukyas, king Trailokyamalla, was advancing in a course of successively increasing prosperity, (to endure) as long as moon, son, and stars : (Lines 4-9.) Hail ! she whose foot-lotuses are touched by the diadems of opponent kings, who is pure through bathing in the Ganges, a wishing-jewel to the distressed and master. less, uniform in speech, adorned with virtues, Akka-devi, in the camp around the fortress of Gokage, granted land for the expenses of) plastering the broken and burst (masonry) of the Gopada-bedangi Jina temple at Vikramapura, and for the supply of) scent, incense, and lampe, and for sarugi, and for the maintenance of Nagasena Pandita, (1 friar) of the Hogariya Gachchha of the Varasena Gana of the Mala Sangha, and of the friars and nuns residing there and for the cloaks of the nuns : (Lines 9-18.) The lands given by her) to the god, which she purchased of Dadigarasa, on Sunday, the new-moon day of Chaitra in the cyclic year Brrvvajit, the 989th (year) of the Saka era, on the occasion of an eclipse of the sun, with the performance of pouring of water, were : Gapada Halur, a town forming part of the Kisukadu Seventy, granted on sarva-namasya tenure, in its entirety, with usufruct of the citizens (?); one mattar of garden on the north-east of Vikramapura ; south of the town, on the south-west of the Muruvadu Waste-land, twelve mattar on sarva-namasya tenure for Pandita Nagadeva ; to the south thereof, twenty-four mattar on sarva-namasya tenure for the drummer Ketoja ; north of the town, east of Rayagatte, one mattar of garden for the drummer Ketaja; on the west thereof twelve mattar on sarva-namasya tenure (and) one mattar of garden for the stone-mason Suroja; (furthermore,) 50 mattar on sarva-namasya tenure in the estate of the seigniory south of the Kappadi tank, (Lines 19-21 : a prose formula of the usual type.) (Line 22: the beginning of a common Sanskrit verse.) No. 11.-THE BRAHMA-SIDDHANTA OF BRAHMAGUPTA (A.D. 628). WORKING TABLES FOR COMPUTATION OF ANCIENT DATES BY THE TRUE, OR APPARENT, MOTIONS OF SUN AND MOON. BY ROBERT SEWELL (I.C.S., RETIRED). A continuation of the author's "Indian Chronography." 311. In pars. 257 of my article on "The true longitude of the sun in Hindu astronomy, the Siddhanta-Siromani" (above, Vol. XIV, p. 241), and again in a later article on The Siddhanta. Siromani, $ 2711(Vol. XV, pp. 159 sqq.), I discussed the question of the values assigned in the seventh century A.D. by Brahmagupta to the twenty-four base-sines of angles in the quadrant; and expressed the opinion that when, but not until, definite assurance was obtainable that the values stated in the only available copies of the Brahma-Siddhanta were really those fixed by its author, working Tables framed according to its postulates might safely be prepared for the computation of ancient dates. This term occurs elsewhere, e.g. in Ep. Carn. II (Sravana Belgola), No. 56, p. 62. * Literally, "one." One MS. copy in the India Office, London, and Benaros printed edition.
Page #151
--------------------------------------------------------------------------
________________ 124 EPIGRAPHIA INDICA. [ Vou. XVII. In response to my appeal Mr. G. R. Kaye (Curator, Board of Education, Simla) has been kind enough to assist me. He tells me that there can be no doubt but that the values given for the several buse-sines in the edition of the Brahma-Siddhanta, printed and published in Benares, are correct, and that Brahmagupta certainly made his calculations with a radius (sin. 90deg) of 3270', discarding that of 3+38', which seemingly had been in use in India since the time of the Greeks. Mr. Kaye went fully into the subject in a very learned article, "Ancient llinulu Spherical Astronomy," published in the Journal of the Asiatic Society of Bengal in 1919 (New Suries, Vol. XV, N. 3), which contains (Table 8, p. 187) a list of the sine-values as determined by the authors of the Puulisu., Arya-, and Brahma-Siddhantas. He points out that, when properly applied, the equations of the sun's and moon's centres obtained from the sine-values of Brahmagupta agree with those derived from the values assigned by the other authorities. Accordingly I have prepared the Table of Brahmagupta's sines and resulting base-equations of the sun's centre (Table LXXXIX below), and a comparison between these and the equations of the Siddhantu-Siromani (Table XLVII above, Vol. XIV, col. 9, and Prof. Jacobi's Tables, XXIV1) above Vol. I) proves that there is only a verytrifling difference whether we use Brahmogupta's, or the older--and later-sine-values. By the Siddhanta-Siromani, with radius 3438', the sun's greatest.euuation, that of 90deg, 2deg 10' 31", exact. By the Brahma-Siddhanta, with indius 3270', it :) 10 31":19. We may therefore safely use Table LXXXIX (below) and Table LIX (ubuve, Vol. II) for the sun's and moon's equations by the Brahma-Siddhinta. 312. The Brahma-Siddhinta was composed by Brahmagupta in A.D. 628 and is said to have been extensively used in some parts of India, its principal rival being the Arya-Siddhanta of Aryabhata, known in later years as the Laghu-Arya to distinguish it from the Maha-AryaSilinta of the tenth century. This last, called also the Second Arya-Siddhanta, seems to have had no great following. The Rajampiganka, an astronomical work of A.D. 1042 introluced, according to the information available to the late Sankara Balkrishna Dikshit some important changes into the system of Brahmagupta ; but unfortunately no complete copy of it has yet been obtained, and the necessary particulars are not to be found in those fragments which have come to light. It is not possible therefore to frame any accurate Tables for calculation by the Rajamrigatika, and we must rest satisfied with the assurance of Mr. S. B. Dikshits that the Siddhanta-Siromani is the same as the Rajamrigarika in the matter of calculation of a panchang. Tables for use by the former have already been published by me, comprising the period A.D. 1100-1750 (above, Vol. XV). All the authorities appear to arrive at similar or almost similar results in their computation of the lunar tithis, when worked by the true or apparent motions of sun and moon; but, since they differ in their estimate of the position of the sun's apsis at a given date, they necessarily differ somewhat in their estimate of the moment in ear h year when the true sun regches long. 0deg, the moment, that is, of "true Mesha-samkranti." This difference leads to differences in the lengths of the true solar months, and consequently to differences in the intercalation and suppres, sion of true lunar months; which differences, again, occasionally cause differences of a whole lanar month in the beginning of the luni-solar year and differences in the names of some of the lunar months therein. It wonld be interesting to learn his reason for the change. Later Indian astronomers reverted to the radios of 3438', which is correct. With = 3.14159 the radius=3437-74967. Brab magupta's radias 3270 implies & ratio F-3-303. The ratio according to Archimedes (B.C. 250) was 8-14256. The ratio 1: 710 mentioned in the Surya-Siddhanta - 3:16228. ? Or Table XLVII (ahore, Vol. XIV), col. 9; also Professor Jac bi's Tables XXIVA, XXIVB (Vol. 1). Indian Calendar, p. 8.
Page #152
--------------------------------------------------------------------------
________________ No. 11.) THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 125 But we are now better able to deal with these matters than before. Dates can be easily computed by the true motions of sun and moon according to the Surya-Siddhanta for the whole historical period from A.D. 300 to 1900 (Indian Calendar); according to the Arya-Siddhanta from A.D. 900 downwards (above, Vol. XVI); according to the Brahma-Siddhinta (the present paper) from A.D. 600 to 1200; and according to the Siddhanta-Siromani, Rajamrigarika and other works of the time of Bhaskaracharya from A.D. 1100 to 1750 (above, Vol. XV); these periods comprising the outside limits of use. And, as regards computation by the mean motions of sun and moon, which system is believed to have been in universal use down to about A.D. 1100, and perhaps in some places to & considerably later date, we now have Tables for work by the Arya-Siddhanta from A.D. 500 to 1400 (above, Vol. XVII); while I hope to be able to publish here after a set of similar Tables for the Brahma-Siddhanta, algo embracing the outside period of use. All these Tables are framed on the same system, so as to enable calculation to be made as easily and rapidly as possible. Elements of the Brahma-Siddhanta. 313. (i) The length of the mean solar sidereal year is 365-2584375 days, or 365d 6h 12m 9. The Siddhanta-Siromani adhered to this estimate. (ii) Brahmagupta's sines of angles of the quadrant differ from those of the other anthorities. His sine of 90deg, the radius, = 3270' instead of 3438. His sine of 3deg 45' = 214' instead of 225'. The 24 base-sines are given in Table LXXXIX below. (iii) The equations, however, which are based on these sine-values are practically the same as those of the Siddhanta-Siromani (compare Table XLVII above, Vol. XIV, col. 9, and Table LXXXIX below). Tables LV, LVI, LIX (above, Vol. XV) may be therefore used as well for the Brahma-Siddhanta as for the Siddhanta-Siromani. (iv) The greatest equation of the sun's centre, that of 90deg, is, in 10,000ths of the circle, 60-425925. The greatest equation of the moun's centre is, in similar measurement, 139-858101852. The sum of the two is 200-28-1027. (v) The epoch of the Kaliyuga era was mean sunrise, taken as 6 A.M., on Friday, 18 February, B.C. 3102, that moment being Ohm 0 Lanka time. This was the moment of mean Mesha-samkranti, when the mean san's centre reached long. 0deg. True Mesha-samkranti, when the true sun's centre reached long. 0', occurred on Tuesday, 15 February, B.C. 3102, at 19h 52m 215 after mean sunrise at Lanka. (vi) The circumference of the sun's epicycle is 13deg 40', that of the moon 31deg 46'. The epicycles are not contracted at any point. In this the Siddhanta-Siromani concurs (Jacobi, Vol. I above, p. 441). (vii) The line of apsides of the sun's orbit has & constant forward shift, the perigee-point (on the longitude of which my calculations are based) moving 0deg 144 per apn., or 14"-4 in a century. According to the Siddhanta-Siromani the movement in more rapid, amounting to 1".044 per ann. (Jacobi, op. cit.). (viii) The sodhya, or time-interval between true and mean Mesha-sath krantis, was, in K.Y. O or at the epoch of the Kaliyuga era, according to Dr. Schram, 24:171971 or 24 4 7 38-5. With this the Siddhanta-Siromani agrees. But in later years the sodhya, as postulated by the two authorities, differs in value owing to the difference between the two Siddhantas in their estimate of the movement of the sun's apsis. (See vii above.) Also by the Indian Chronology of Dewan Bahador L. D. Swamikaona Pillai, M.A., whose Tables are framed on a difforent system. ? Indian Chronography, $ 89 D, p. 16.
Page #153
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [VOL. XVII. (ix) The position of the sun's apsis (perigee) at K.Y. 0, the epoch of the Kaliyuga, was 257' 45' 36",1 and his mean anomaly was 102deg 14' 24", or, in 10,000ths of the circle, 2840. 126 (1) The position of the moon's apsis (perigee) at the same moment was 305deg 29' 46"; and her mean anom. was 54deg 30' 14", or, in 1,000ths of circle, 151-399691358. (xi) The sun's mean velocity (he is treated as a planet) and the length of the mean solar year being the same both by the Brahma-Siddhanta and the Siddhanta-Siromani, his mean long. at any moment must be the same by both, and so also the length of the mean solar month. But the two authorities are not in exact accord as to his true long. and the length of the true solar month. Shift of sun's apsis. The sodhya. Length of true solar year. 314. The length of the mean solar year being the same, viz. 365d 6h 12m 9, by both the Brahma-Siddhanta and the Siddhanta-Siromani, the first portion of SS 273 above (Vol. XV) and accompanying Table A apply as well to the former as to the latter. But for the latter portion that section and its Table B, the following must be substituted when dealing with the Brahma-Siddhanta, the two authorities not being in accord as concerns the matter in question. 315. As stated above, the sun's perigee-point according to the Brahma-Siddhanta advances annually 0144 along the ecliptic, and in consequence of this shift the true sun's velocity at long. 0" is a little greater every year than the year before, i.e. the true sun reaches long. 0deg, or the moment of true Mesha-samkranti occurs, a little earlier each year. In every year there is a slight increase in the distance and time-difference (our fodhya) between the mean and true suns at that point of the orbit. Dr. Schram has carefully calculated the value of this sodhya at the moment of true Mesha-sam kranti at the beginning of several millenniums, and his results for the period embraced in my general working Table LXXXII are stated in the following Table B. TABLE B. VALUE OF BODHYA BY THE BRAHMA-SIDDHANTA. K.Y. year expired. 3700 8800 8900 4000 4100 4200 4800 A.D. EXACT VALUE OF SODHYA AT BEGINNING OF CENTURIES. days and decimals. 599-600 2.1729145 699-700 2-1729400 799-800 2-1729655 899-900 2-1729910 999-1000 2-1730165 1099-1100 2-1730420 2-1730675 1199-1200 d. h. m. 8. 2 4 8 59-8128 249 2.0160 4.2192 2 4 9 2 4 9 2 4 9 8-6256 10-8288 2 49 2 49 13-0320 6.4224 One result of this shift of apsis is that, by the Brahma-Siddhanta, the true sun reaches the 0deg point of long. 0022032 earlier every year than the year before, and in consequence the length of the true solar year, or the time needed for the true sun to travel from true Mesha-samkranti Jacobi, above, Vol. I, p. 442, SS 83, where he gives the place of the apsis (apogee) as 77deg 45' 36". See also E. Burgess's" Surya-Biddhanta." Moon's apogee given by Jacobi as 125deg 29' 46",
Page #154
--------------------------------------------------------------------------
________________ No. 11.) THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 127 in one year to true Mosha-sankranti in the next, is (365d 6h 12mg-0022032) 3654 6h 12w 89-977968. [The exact moment of true Mesha-sankranti in each year from A.D. 599 to 1200 is given in the general Table LXXXII below, cols. 13-17. It can be tested by the use of Table A, S 273, referred to above, and Table B here given, using the longer rule" stated in $ 273 or in Indian Chronography, p. 61.] Another result of the shift is that the sun's mean anomaly, or the mean sun's distance from the sun's perigee-point, decreases every year by 0144 or 14:4 in & century. Reckoning in 1,000ths of circle for valuation of our c (sun's mean anom.) in the Tables, 14'4 = 0*01. The value of c therefore decreases 0oi in a century, and this decrease has to be taken into Account from K.Y. O, the epoch of the Kaliyuga. This has been done in the preparation of the Tables which allow. The increase of a, b, c, in centuries, years, days and fractions of days. 316. Following on what has been stated, we learn that Tables LIVA and B, which deal with the periodical increases of a, b and c according to the Siddhanta-Siromani, may safely be used for calculation by the Brahma-Siddhanta, with the one reservation as to the increase of a in a century. a being the distance of mean moon from mean sun, and the longitude of the mean sun not being affected by the shift of apsis, but only his mean anom., or distance from the point of the apsis, it appears that the rate of increase of a must be same by both authorities. As to the rate of increase of c it is, by the Siddhanta-Siromani, centennially less by 0-0805 ($ 273 above), and this was taken into account in the preparation of the heading of Table LIVA where a footnote is appended shewing what the rate of increase would be per century if no such deduction had been made. This rate is, in thousandths of a circle, 997-690008075 in a century of 36525 days, and 0.427795618 in a century of 36526 days. By the Brahma-Siddhanta, the centennial decrease in the sun's mean anomaly being 0:01, the amount of increase of c per century is, for a century of 36525 days, 997678896964, and for a century of 36526 days is 0-416684507. The difference between the two authorities in shorter periods may be ignored except in some extraordinarily close case. If it is ever needed, the increase in c in one year may be reduced by 0.0001 from the Table quantity. Otherwise Tables LIVA and B stand good for calculations by the Brahma-Siddhanta. The values of a, b, c at the beginning of K.Y. 3700. 317. The general Table LXXXII below begins from the beginning of K.Y. 3700 expired. Table LXXXVI states the value of a, b, c at that moment, and at the similar moment at the beginning of subsequent centuries. It is necessary therefore to explain how these figures were calculated. (i) The value of a (distance of mean moon from mean sun) in K.Y. 3700. According to Hindu astronomers mean moon and mean sun were in conjunction at the moment of mean Meshasankranti in K.Y. O, the epoch of the Kaliyuga; or, in other words, at that moment a = 0. In the 37 succeeding centaries there were 32 common and 5 defective centuries. Taking the centary values of a given in the heading of Table LIVA and multiplying for 32 common and 5 defective centuries, we arrive at the figure 6567.108945284 as the value of a at the beginning of the 37th century K.Y., whole revolutions of 10,000 each being omitted. From this figure has to be deducted,-according to the working system of the Indian Calendar, which follows Largeteau and Jacobi,--the sum of the greatest equations of sun and moon, viz. 200-284021 (above $ 313, iv). This gives us the value of a at the beginning of K.Y. 3700 (expired) as 6366-824917506. 1 Professor Jacobi differs by sbont 17 units. He gives the figure 6384-0 (Vol. XI adore, p. 167, Table IXA). I can give no explanation of the rouson for this; and can only state fally, as in the text, my bases of calculation.
Page #155
--------------------------------------------------------------------------
________________ 128 EPIGRAPHIA INDICA. VOL. XVII. Now this value stands for mean sunrise of Sunday, 22 March, A.D. 599, i.e. for the sunrise succeeding the moment of occurrence of mean M5sha-sankranti in K.Y. 3700; but in all my Tables tire calculation is for mean sunrise on the actual day of that occurrence, and we have therefore to deduct one day's value of a (riz. 338-631985412-Table LIVA above) from the above estimate. This done, we have, for mean sunrise on Saturday, a=6028 192932094. (ii) The value of b (moon's mean anom.) at the same moment. At the epoch of the Kaliyuga the moon's mean anom. was, as stated above ( 313 x), in 1,000ths of a circle, 151-399691358. Using the century figures of b in the heading of Table LIVA, and multiplying for 32 common and 5 defective centuries, it is found that, excluding whole revolutions of 1,000 each, the result is 604 144838202. Adding the value of b at K.Y. O, as above, we have at beginning of K.Y. 3700, for the value of b, 755-544529560. But this (see above, 1) was its value at mean sunrise on Sunday, 22 March, A.D. 599. Deducting one day's value of b (36 291649786) the fixture for mean sunrise on Saturday, 21 March, amounts to 719-252879774. (iii) The value of c (the sun's mean anom.) at the same moment. The correct increase of c by the Brahma-Siddhanta in centuries of 36525 and 36526 days has been given abovy in the latter part of $ 316. Multiplying those quantities for 32 common and 5 defective centuries, and discarding whole revolutions of 1,000 each, we arrive at the increase, after 37 centuries, of 1.728389014. To this has to be added the value of at K.Y. O (abore, 313, 1x), ris. 284.0. The value of c, therefore, at mean sunrise of Sunday, 22 March, A.D. 599, was 285.728589044. Deducting the c for one day (2737787543) we have finally, for mean sunrise on Saturday. 21 March, c=282.990601501. The entries, therefore, for the aforesaid Saturday of K.Y. 3700 in Table LXXXVI below are a = 6028-1929 b = 719.2529 c= 282-9906. The rest of that Table follows by addition of the proper century values. Duration of true solar months. 318. It hrs been mentioned above ($ 313,xi) that, while the length of the mean solar month must be the same both by the Brahma-Siddhinta and the Siddhinta-Siromani, the lengths of the true solar months according to the two anthorities differ because of their different estimate of the shift of the sun's apsis. Thus in K.Y. 4000, the middle year of my general Table LXXXII below, the sun's perigee-point according to the Siddhanta-Siromami was at long. 258deg 55' 12". while by the Brahma-Siddhanta it was at long. 257' 55' 12". Hence the velocity of the true sun (he is alwnys considered as a planet) at the several true solar sankrantis, when the true sun's centre enters the several signs, is not the enme by the two authorities quoted. And this has necessitated the preparation of a new Table (LXXXIIIA below), giving the lengths of the true solar months and increase of a, b, c therein individually and collectively according to the Brahma-Siddhinta. There being in K.Y. 4000 a difference of only +' 49" between the positions of the sun's perigee, as estimated by the Brahma-Siddhanta and by the First Arya-Siddhanta, the former placing it at 257deg 55' 12' and the latter at 258deg, it was considered sufficiently safe to use Table XLIX (above, Vol. XIV) for the trae sun's velocity at different points of his orbit in hours and minutes, and Table L-A for seconds. His true long. at each sankranti was computed from his known mern longitude + the equation of the centre, which was calculated in each case. 1 Professor Jacobi's figure for this is 758:1, in my notation, against my 756-5. * This grocs with Professor Jacobi's Axtare, whieh, menadred from perige and in my notation, is 2857
Page #156
--------------------------------------------------------------------------
________________ No. 11.) THE BRAHMA-SIDDHANTA : TRUE, OR APPARENT, SYSTEM. 129 Thus was obtained the length of each month in days, hours, etc. For the increase of a, b, o during the periods so determined Tables LIVA and B, which are applicable to the Brahma. Siddhanta as well as to the Siddhanta-Siromani, were used. Note on work for the nakshatra. 319. In our method of work := the true sun's longitude and t = the tiths-index (which shews the true moon's distance from the true sun) at the given moment. + t = the nakshatra-index , which gives the true moon's place in the heavens, or her apparent longitude. The value of t is ascertained by the ordinary calculation for a date. The value of has to be found. By the Arya-Siddhanta the formula for finding , c being the sun's mean anom. at the given moment, is : = (c x 10) + 7226 - eqn.c; where the factor 7226, which represents in 10,000ths of circle the long. of sun's perigee plus the sun's greatest equation, is a constant. By the Sarya-Siddhanta, as exemplified in the Indian Calendar Tables, the numerical factor is not 7226, but varies in the period A.D. 900 to 1900 from 7206-5077 to 72074035 being fixed for rough work at 7207. The variation is due to the postulated shift of the sun's perigee-point. By the Siddhanta-Siromari there is, for the same reason, & yariation in the numerical factor, vit. from 7252-6466 in A.D. 900 to 7259-0910 in A.D. 1700,- roughly from 7253 to 7259. By the Brahma-Siddhanta the numerical factor varies from 72245370 in A.D. 600 to 7225-2031 in A.D. 1200 (the limits of the general Table LXXXII below). For rough work therefore by this authority the formula is I = ( x 10) + 7225 - egn. a. For more accurate work the value of o should be calculated (by the Tables) with decimals and instead of multiplying o by 10 its value should be changed from thousandths of cirolo ( in the Table-result) to ten thousandths by moving the decimal point one place to the right; the value of egn. c can be obtained from Table LVI with great accuracy; and the numerical factor can be taken from the following summary. K.Y. centary A.D. century. Exact factor in formula. Rongbly. 8700 599-800 8800 8900 4000 699-700 799-800 899-900 999-1000 1099-1100 1199-1200 7224-6870 7224-648i 7824-7692 7224-8103 17226 7234-9814 7296-0828 7226-2081 4100 4200 1900 Examples. It is not necessary to give a number of examples of work by the present Tables. The system of calculation being exactly the same as that of the Indian Calendar and throughout theresent series of articles, the examples already published for computation by other authorities See Indian Culendar, $ 156, p. 97 ; article on the Siddhanta-siromasi, above, Vol. XV, $ 878," Note on . work for the nakshatra "; article va the Pirat Arya-Siddhanta, Vol. XV above, $ 802 ; and the several examples given in those papers. * Whole revolutions are not necessary for present par pons, and in our system when a 20,000 a whole synodio revolation of the mean moon has been completed.
Page #157
--------------------------------------------------------------------------
________________ 130 EPIGRAPHIA INDICA. [Vol. XVII. will suffice, the proper Tables being used, for work by the Brahma-Siddhanta. These Tables are specified in the following pages. Examples have been given in all my foregoing papers, but perhaps the fullest series is to be found in the article on the First Arya-Siddhanta (above, Vol. XVI). Tables for calculation by the Brahma-Siddhanta. The system of work for computation of an Indian date will be readily understood by perusal of examples 2 to 11 appended to my paper (above, Vol. XVI) on the First Arya-Siddhanta ; but the Tables used sre of course not all the same. The following list shews how accurate results by the Brahma-Siddhanta are to be obtained in calculation by the movements of true sun and trne moon. Table LXXXII below is the general working Table for the Brahma-Siddhanta for the period A.D. 599 to 1200 (K.Y. 3700 to 4300 expired). For names of months and of nakshatras in different parts of India, see Table LXII above (Vol. XVI, "The First Arya-Siddhanta"). For collective duration of mean lunar months see Table LXIIIA of the same article, or Table III, Part I, Indian Calendar. Table LXXXIIIA below gives, by the Brahma-Siddhanta, the length of the true solar months and their collective duration, with the corresponding increases of a, b, c. Table LXXXIIIB states the exact value of c and of "equation c" at the several true sankrantis, or moments of the true sun's centre reaching the several sigos. Table LXXXIIIO shews the value of c and of equation o" at the beginning of each century of the Kaliyaga. For the increase of a, b, rospectively in defective and common centuries, and in common years and Leap-years, Bee Table LIVA, heading ; but note that by the Brahma-Siddhanta the increase of c in a defective century of 36525 days is 997678896964 and in a common century of 36536 days is 0-416684507. Tables LIVA and B contain the necessary figures for days, hours, minutes and seconds. Table LXXXIV gives the values of "equation b," and Table LXXXV those of "equation c," for easy calculation by whole numbers, corresponding respectively to Tables VI and VII of the Indian Clendar," which stand for the Surya-Siddhanta. For the more detailed values of "equation b" and "equation c" of moon and sun use Tubles LV and LVI above, Vol. XV, as framed for the Siddhanta Siromani. For the indices of tithis (t), karanas, yogas (y) and nakshatras (n) see Table VIII, " Indian Calendar," or Table LXVIII (above, Vol. XVI," The First Arya-Siddhanta "). For serial numbers of days of a year reckoned from January 1st use Table IX, " Indian Calendar," or Table LXIX (above, Vol. XVI," The First Arya-Siddhan'a "). For conversion of tithi-indices and tithi-parts into time Table X, "Indian Calendar," is to be used, or Table LXX (above, Vol. XVI," The First Arya-Siddhanta"). For finding the week-day according to the European Calendar for any century from A.D. 0 to 2300 see Table LXXI (above, Vol. XIV, "The First Arya-Siddhanta "), or Tables XLIA and B (pp. 176, 177, "Indian Chronography"). Table LXXXVI gives the values of a, b, c at the beginning of each century of the Kaliyuga by the Brahma-Siddhanta. Table LXXXVII gives the same for odd years of those centuries. Table LXXXVIII states the daily sunrise values of a, b, c for a month previous to the day of Mosha-sam kranti. Table LXXXIX sets forth the 24 base-sines of angles of the quadrant according to Brahmagupta, and the corresponding equations of the sun's centre.
Page #158
--------------------------------------------------------------------------
________________ No. 11.] THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 131 TABLE LXXXII. CONSTRUCTION OF TABLE. The Table is constructed on the lines of Table I of the Indian Calendar and is to be used in the same way. The columns are numbered similarly. Col. 7. The samvatsara-name,-i.e. the name of the Jovian cycle-, of the year is given as determined by my previous calculations (above, Vol. XIII Table XLII). Entries in italics point to cases where this samvatsara-name differs from that given to the same year by SuryaSiddhanta reckoning. Col. 8. Months noted in roman characters are intercalated (adhika) lunar months. Those in italics are suppressed (kshaya) months. Cols. 13, 19. Figures in brackets give the serial number of the day measured from January 1st, Col. 23. a distance, at mean sunrise, of mean moon from mean sun, or phase of moon stated in 10,000ths of circle, and reduced by the sum of the greatest equations of sun and moon so that calculation of the equations of b and c may always be additive. Col. 24. b mean anomaly of moon or mean moon's distance from perigee-point of apsis stated in 1,000ths of circle. Col. 25. c mean anomaly of sun or mean sun's distance from perigee, stated in 1,000ths of circle. REMARKS A.D. 629-630, cols. 19, 20. A very close case. The moment of true new moon was less than half a minute after mean sunrise at Lanka ou Wednesday, 1st March. And the first sukla tithi of the year ended after mean sunrise on Thursday, 2nd March, which was therefore by rule the first civil day of the luni-solar year. If new moon had taken place more than half a minute earlier the first civil day of the year, "Chaitra sukla 1," would have been 1st March. At A.D. 968-69, col. 8. the Kumbha samkranti the true moon was waning. The moment of the next, the Mina, samkranti occurred about 2 minutes after the moment of true new moon, so that the true moon was waxing at the Mina samkrants. Hence the lunar month Phalguna was intercalated. According to the 19-year sequence we should have expected an intercalation of the lunar month Chaitra next following. The sequence shows similar irregularities when examined by other authorities, but only very rarely. A.D. 974-75, cols. 19, 20. Close case. The 1st true new moon after the Mina samkranti occurred 3 minutes before mean sunrise at Lanka on 25th February A.D. 974. That therefore was the day "Chaitra sukla 1." A.D. 963-64, 982-83, col. 8. In both these years an intercalation of the lunar month Sravana instead of Ashadha would have been more in accordance with the 19-year sequence, seeing that Bravana was the intercalated month in A.D. 1001 and 1020; but prior to A.D. 963 at intervals of 19 years there had been eight intercalations of Sravana, and towards the close of such a run a change of conditions generally becomes apparent. A.D. 1001-2, 1020-21, col. 8. See the previous note. If in these two years the conditions had made necessary an intercalation of Ashadha, the 19-year sequence would have been uninterrupted. A.D. 1128-29, col. 8. By the Brahma-Siddhanta the intercalation of Phalguna was clearly demanded. See Remarks preceding Table LX (above, Vol. XV), on the same year as worked by the Siddhanta-Siromani.
Page #159
--------------------------------------------------------------------------
________________ 132 EPIGRAPHIA INDICA. [VOL. XVII. TABLE GENERAL TABLE FOR CALCULATION Conforming to Table I" Indian Calendar" (See notes on CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Chaitradi Vikrama. Intercalated (adhika) and suppressed (keshaya) true lunar months. Meshadi solar year in Bengal. Kollam. A. D. Southern system. Northern system. 3701 599-600 3702 *600-01 3 Jyeshtha 3703 & & ggg 601-02 3704 s1 7 Asvins 11 Magha (kah.) 1 1 Chaitra . 3705 802-03 603-04 *804-05 605-06 3706 3707 . . . 5 Sravana . 3708 606-07 3709 607-08 *608-09 50 Anals . . 51 Pingala . 52 Kalayukta. & Siddharthin . 54 Raudra . . 55 Durmati . . 56 Dundubhi. . 57 Rudhirodgarin. 58 Raktaksha 59 Krodhans. . 60 Kshaya 1 Prabhavs . 2 Vibhavs. . 3 Sukla 5 Pramoda. . 6 Prajapati . . 6 Angirasa . 7 Srimukha. 4 Asbidha 3710 3711 . . 609-10 3712 610-11 3713 611-12 2 Vaisakbs . 3714 *612-13 3715 6 Bhadrapada 613-14 614-15 8716 3717 9 615-16 3718 *616-17 4 Ashadha . 3719 617-18 8 Bhva . . 3720 9 Yuvan 3721 618-19 619-20 *620-21 3 Jyoshitha 10 Dhatri 11 Isvara 3722 . . 9
Page #160
--------------------------------------------------------------------------
________________ No. 11.) THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 133 LXXXII. BY THE BRAHMA-SIDDIINTA. the columns being similarly numbered. preceding page.) COMMENCEMENT OF THE SOLAR YEAR. LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUELA I EXDS). Kali. Day and month A. D. Weekday. Time of true 1 Day and Mesha-sm-month A. D. kranti. Weekday. 20 23 24 26 3709 13 14 17 19 H. M. s. 19 Mar. (78) 5 Thur. 16 03 Mar. (62) 18 Mar. (78) 6 Fri.. 7 18 9 7 21 Feb. (52) 18 Mar. (77) Sat.. 30 18 11 Mar. (70) 1 Sun. 42 27 28 Feb. (59) 19 Mar. (78) 3 Tues. 64 36 18 Feb. (49) 18 Mar. (78) 4 Wed. 7 Mar. (67) 18 Mar. (77) 5 Thur. 54 24 Feb. (55) 18 Mar. (77) 6 Fri.. 20 31 3 15 Mar. (74) 19 Mar. (78) 1 Sun.. 2 43 4 Mar. (63) 18 Mar. (78) 2 Mon.. 21 22 Feb. (53) 18 Mar. (77) 3 Tues. 15 7 3012 Mar. (71) 18 Mar. (77) 4 Wod. 21 2 Mar. (61) 19 Mar. (78) 6 Fri.. 3 48 19 Feb. (60) 18 Mar. (78) Sat. . 943 57 9 Mar. (69) 18 Mar. (77) 26 Feb. (57) 18 Mar. (77) 15 16 Mar. (75) 19 Mar. (78) 4 20 24 6 Mar. (65) 18 Mar. (78) 5 Thur. 10 32 33 23 Feb. (54) 18 Mar. (77) 6 Fri.. 42 13 Mar. (72) 18 Mar. (77) O Sat.. 22 56 513 Mar. (62) 19 Mar. (78) 2 Mon. 5 9021 Feb. (52) 18 Mar. (78) 3 Tues. 11 21 9 11 Mar. (71) 3 Tues. 9932-8171 66-0032 233-7104 3701 1 Sun.. 147.1720 949-5390 205-8250 3702 O Sat.. 181-8544 885-5324 256-9354 3703 4 Wed. 57-5772 732-7766 226-1121 3704 2 Mon. 271-9320 616-3122 203-5023 3705 0 Sat.. 9967-9825 516-0140 246-5994 3708 4 Wed. 9843:7062 363-2681 215-77623707 3 Tues. 9878-3876 299-1816 267.0865 3708 O Sat.. 9754-1105 146-4956 236-2624 5 Thur. 9968-4663 30-0312 208-1780 3710 4 Wed. 3-1477 966-0247 259-4884 3711 2 Mon. 217-6026 849-5604 231-4029 3712 6 Fri.. 93-2264 896-8045 200-5797 3713 5 Thur. 127-9077 632-7980 251-8902 3714 2 Mon. 3-6306 480-0421221.0869 O Sat.. 9999-6810379-7440 269-6395 3716 5 Thus. 9914.0358 263-2795 241-65423717 2 Mon. 9789-7587 110-5236 210-73103718 1 Sun.. | 9824 4420 46-5171 262-0414 3719 6 Fri.. 38.7959 930-0528 233-9559 3720 4 Wed. 253.1507 813-5885 205-87053721 3 Tues. 287-8331 749-5820 267-1810 3722 3715 82
Page #161
--------------------------------------------------------------------------
________________ 134 EPIGRAPHIA INDICA. (VOL. XVII TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Keli. Saks. Chaitradi Vikrama. Intercalatod (adhika) and suppressed (kshaya) true lunar months. Moshadi solar year in Bengal. Kollam. A. D. Southern system. Northern system. 3723 7 Asvina 621-22 622-23 12 Bahudhanya 13 Pramathin . 14 Vikrama'. 15 Urisha 3724 3725 3728 3727 . . 623-24 *624-25 Bravapa 625-26 16 Chitrabhanu . . 3728 549 626-27 627-28 . . . . 4 Ashadha . *828-29 3729 550 3780 561 3731582 3734 653 629-30 630-31 . . 2 Vaibikha 138 .6 Bhadrapada 3784565 SPO 8786 558 6140 37386576024 3137558893 3738559 831-32 *632-83 633-34 634-35 635-38 *636-37 637-38 4 Ashadha 17 Subhanu . 18 Tarapa . 10 Pirthis 20 Vyaya . 21 Sarvajit . 22 Sarvadhirin 23 Virodbin . 24 Vikrita 25 Khara 28 Nandana . 27 Vijays . 28 Jaya . . 29 Manmatha. 30 Durmukha. 31 Femalambs 32 Vilambs . 33 Vikarin 34 Sarvarin 36 Plava . 36 Subhakrit . 3739560 638-39 . . 3 Jyeshths 7 Asvina 3740 581 3741 562 374256380847 3743564 899 48 374458670049 374556670150 3746567 10251 $147 368 708 639-40 *840-41 641-42 642-43 643-44 . . . . 5 Srivas *844-45 . . 648-16 .
Page #162
--------------------------------------------------------------------------
________________ No. 11.] THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 135 LXXXII-Contd. COMMENCEMENT OF THE SOLAR YEAR. LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Kall, Time of true Day and Day and month A.D. Weekday. Mesha-sam. kranti. month A. D. Weekday. 13 17 2023 25 Mar. (74) H. M. S. 18 Mar. (77) 4 Wed. 28 Feb. (59) 18 Mar. (77) 5 Thur. 23 45 27 18 Mar. (77) 10 Mar. (78) O Sat.. 6 57 36 8 Mar. (67) 18 Mar. (78) 1 Sun.. 12 945 25 Feb. (56) 18 Mar. (77) 2 Mon.. 18 19 Mar. (78) 4 Wed. 34 3 4 Mar. (63) 19 Mar. (78) 5 Thur. 46 12 22 Feb. (53) 18 Mar. (78) 8 Fri. . 12 58 21 12 Mar. (72) 18 Mar. (77) O Sat.. 19 10 30 2 Mar. (61) 19 Mar. (78) 2 Mon. 39 19 Feb. (50) 3 Tues. 34 47 9 Mar. (68) 1$ Mar. (78) 4 Wed 13 46 66 26 Feb. (57) 18 Mar. (77) 8 Thur. 19 69 6 16 Mar. (75) 19 Mar. (78) 0 Sa . 11 146 Mar. (65) 19 Mar. (78) i Sun.. 8 23 23 23 Feb. (64) 18 Mar. (78) 2 Mon. 35 32 13 Mar. (73) 18 Mar. (77) 3 Tues. 47 413 Mar. (62) 19 Mar. (78) 5 Thor. 59 60 20 Feb. (51) 19 Mar. (78) 6 Pri. 18 Mar. (78) Sat: 16 24 8 28 Feb. (69) 18 Mar. (77) Sun. . 21 17 18 Mar. (77) 19 Mar. (78) 3 48 26 7 Mar. (68) 19 Mar. (78) 4 Wed. 10 O 35 25 Feb. (56) 18 Mar. (78) 5 Thur. 16 12 4415 Mar. (75) 18 Mar. (77) 6 Fri 22 24 534 Mar. (63) O Sat.. 163-5560598-8261 226-3577 3728 5 Thur. 9859-6063 496-5279 274-0303 3794 3 Tues. 73-9612 380-0636 246-8449 3725 O Sat. . 9949-6840 227-3076 216-0218 3726 & Fri.. 9084 3664 163-3011267-33213727 3 Tucs. 9860-0892 10-5451 236-5089 8728 1 Sun. 74-4441 894.0800 208-4235 3729 O Sat.. 109-1265 830-0742 250-7340 3780 6 Thur.tt| 323-4813 713-6100 231-8486 | 8781 2 Mon. 199-2041 660-8540200-8262 3738 O Sat. . 9896-2045 461-5558 249-8979 3788 | 4 Wed. 9770-9774 | 307-7999218-8748 3734 3 Tries. 0805-6597 243-7934 269-8851 3736 1 Sun. 20-0146 127-3290 241-0922 8738 9896-7376 974-6731 210-97653737 4 Wed 9930-4199 910-5866 262-2870 3738 2 Mdo. 144.7746 794-1023 234-2015 3730 6 FH: 20-4975 641-3483 203-8783 3740 5 Thar. 55-1799 577-3398 254-68873741 2 Mon. 9930-9027 424-5838 223-8655 874 1 Sun.. 9965-5851 360-5774 276-1758748 207-8213 244-35273744 3 Taes. 55-6628 91-3571 216-2673 3745 2 Mon.. 90-3451 27-3506 267-5776 3746 6 Fri. . 9966-0680 873-8747 236-7546 | 3747 6 Thur. 3 Tudela = 11 See "Romarks," above, on page preceding the Table.
Page #163
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. ( Vol. XVII TABLE CONCURRENT YEAR. JOVIAN SAMVATBARA. Intercalated (adhika) and suppressed (kshaya) true lunar months. Kali. Saks. Moshadi solar year in Bengal Kollam. A. D. Southern system. Northern system. . 14 Ashadha 3748 1740 3750 646-47 647-48 . . . . *848-49 . . 3761 2 Vaisakha . 649-50 660-61 661-62 *852-63 3752 3753 8754 3786 3768 3757 . . . . . 6 Bhadrapada. . . 653-54 654-55 656-58 8768 *856-57 . . , 857-58 3 Jyoshtha 3750 8760 3761 658-59 37 Sobhada . 38 KrSdhin 39 Visvivasut . 41 Plananga . 42 Kilala 43 Saumya . 44 Sadharara . 46 Virodhakrit . 46 Paridhavin. 47 Pramadin . 48 Anands . 49 Rakshasa 50 Anala B1 Pingala . 52 Kalayukta. 53 Siddharthin. 54 Raudra . 55 Durmati . 56 Dundubbi . 57 Rudhirodgarin 58 Raktaksha. 59 Krodhana. 80 Kshaya . 1 Prabhavs . 2 Vibhaya . 659-60 . . 7 Asvina *660-61 3762 3763 3764 3766 661-62 662-63 663-64 Sravans . . . . . . . . 3766 .664-65 Ashadha 8767 8768 3700 886-86 666-67 687-68 . . . . 3770 *668-69 1 Chaitra 3771 . 689-70 670-71 . . 3772 Sravapa 40 Parabbays was suppressed.
Page #164
--------------------------------------------------------------------------
________________ No. 11.) THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 137 LXXXII-Contd. COMMENCEMENT OF THE SOLAR YEAR. LUKI-SOLAR YEAR (MEAN SUNRISE OP CIVIL DAY ON WHICH CHAITRA SUELA I EXDS). Kali. Day and month A. D. Week. day. Time of true Mesha-sath- kranti. Day and month A. D. Weekday. 13 14 20 23 24 25 1 19 Mar. (78) 1 Sun.. 19 Mar. (78) 2 Mon. 18 Mar. (78) 3 Tues. 18 Mar. (77) 4 Wed. 19 Mar. (78) 6 Fri.. 19 Mar. (78) 18 Mar. (78) 1 Sun.. 19 Mar. (78) 3 Tues. 19 Mar. (78) 4 Wed. 19 Mar. (78) 5 Thur. 18 Mar. (78) 6 FH.. 19 Mar. (78) 1 Sun: 19 Mar. (78) 2 Mon.. 19 Mar. (78) 3 Tues. 18 Mar. (78) 4 Wed. 19 Mar. (78) 6 Fri. . 19 Mar. (78) O Sat.. 19 Mar. (78) 1 Sun.. 18 Mar. (78) 2 Mon. 19 Mar. (78) 4 Wed.. 19 Mar. (78) 5 Thur. 19 Mar. (78) 6 Fri.. 18 Mar. (78) O Set.. 19 Mar. (78) 2 Mon. 19 Mar. (78) 3 Tues. 17 19 H. M. s. 4 37 2 22 Feb. (53) 10 49 11 13 Mar. (72) 201 Mar. (61) 23 13 29 18 Feb. (49) 25 38 9 Mar. (68) 11 37 47 26 Feb. (57) 17 49 66 18 Mar. (76) 0 2 5 6 Mar. (65) 6 14 14 23 Feb. (54) 12 26 23 14 Mar. (73) 18 38 32 3 Mar. (63) 20 Feb. (51) 5010 Mar. (69) 13 14 66 28 Feb. (69) 817 Mar. (77) 39 17 7 Mar. (66) 7 61 2626 Feb. (56) 14 3 35 16 Mar. (76) 20 15 44 4 Mar. (64) 21 Feb. (52) 8 40 2 12 Mar. (71) 1 Mar. (60) 18 Feb. (49) 3 16 29 8 Mar. (67) 9 28 38 26 Feb. (57) 4 Wed. 180-4229 758-1223 208-8691 3748 3 Tues. 215-1052 694-1237 250-9795 3749 O Sat.. 90-8281 541-3679 229-1662 3750 4 Wed. 9966-5509 388-6119 198-3330 3751 3 Tucs. 1-2333 324-6053 249.6435 3752 O Sat. . 9876-9661 171-8494 218-8203 3753 6 Fr. 9911-6385107-8429 270-1306 3764 4 Wod. 125.9934 991-3786 2420453 3755 1 Sun..! 1.7162 838-6227 211-2221 3756 0 Sat.. 36-3986 774-8161 262-5325 3757 6 Thur. 250-7534 658.1518 234-4470 3768 2 Mon. 126-5863 505-3958 203-6238 3759 O Sat.. 0822-5266 405-0977 252.1965 6 Thur. 36-8815 288-6334 224.11103761 3 Tues. 9732-9319 188-3353 272.6836 3702 1 Sun. 9947-2867 71.8709 244.5982 3763 6 Fri.. 161.6415 955-4066 216-5129 3764 6 Thur. 196-2239 891-4001 267-8232 3765 2 Mon. 72-0468 738-6441 237-00003766 6 Fri. . 9947-7696 585-8882 206-1768 3767 5 Thur. 9982-6410 521-8617 257-4873 3768 2 Mon. 9858-1749 369-1257 226-6640 3769 6 Fri. . 9733-8977 216-3699 195-8407 3770 6 Thur. 9768-5801 162-5632 | 247-16123771 8 Tues. 9982-9349 35-8889 210-06593772 3760 2 27 53
Page #165
--------------------------------------------------------------------------
________________ 138 EPIGRAPHIA INDICA. [Vol. XVII. TABLE CONCURRENT YEARS JOVIAN SAMVATSARA. Kali. Intercalated (adhika, and suppressed (l:shaya) true lunar months. Saka Chaitradi Vikrama. Meshadi solar year in Bengal. Kollam. A, D. Southern Vorthern uthern system. system. w 594 71. 72 3 Sukla. ta .W 4 Pramoda . . *672-73 873-74 671-75 . . 4 Ashadha 3773 3774 3775 3776 3777 3778 3779 . 1 5 Prajapati ** Angirasa *** 7Srimukha 675.76 2 Vaisakha . *876-77 097-78 678-79 3780 851 . 7 Asvina 8 Bhavs . 9 Yuvas 10 Dhatri 11 Isvara . 12 Bahudhanya 13 Pramathin. 3781 679-80 3752 *880-81 . 3783 681-82 5 Sravana 1 3784 682-83 14 Vikrama . . . . . 3785 16 Vrisha 683-84 *684-85 3786 bhanu 17 Subhanu . 3 Jyeshtha . 685-86 . . 3787 3788 688-87 . 1) 3789 610 687-88 Chaitra 3790 611 3791 612 3792 18 Turapia . 19 Parthiva . 20 Vijay 21 Sarvajit 22 Sarvadharin 23 Virodhin 24 Vikrta 25 Khard. 6 Nandina . 27. Vijaya . . *688-89 689-90 690-91 801-92 *822-93 693-94 604-95 1 605.98 5 Stavans . .. 4 Ashadba 3793 3794 616 3795 3798 3797 . . 2 617 618 ... 2 Vaibikha
Page #166
--------------------------------------------------------------------------
________________ No. 11.] LXXXI-Contd. THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. Day and month A. D. 13 SOLAB YEAR. Weekday. 14 19 Mar. (78) 4 Wed. 18 Mar. (78) 5 Thur.. 19 Mar. (78) 0 Sat. 19 Mar. (78) 1 8un. 19 Mar. (78) 2 Mon. 18 Mar. (78) 3 Tues. 19 Mar. (78) Thur. 19 Mar. (78) 19 Mar. (78) 18 Mar. (78) 19 Mar. (78) 3 Tues. 19 Mar. (78) 4 Wed. 19 Mar. (78) 5 Thur. 19 Mar. (79) 0.8at. 19 Mar. (78) 1 Sun. 6 Fri. 0 Sat. 1 Sun. 19 Mar. (78) 2 Mon. 19 Mar. (78) 3 Tues. 19 Mar. (79) 5 Thur. 19 Mar. (78) 6 Fri. 19 Mar. (78) 0 Bat. 19 Mar. (78) 1 Sun. 19 Mar. (79) 3 Tues. 19 Mar. (78) 4 Wed. 19 Mar. (78) 5 Thur. 19 Mar. (78) 6 Fri. . . . * Time of true Mosha-sahkrinti. 17 M. 8. 40 47 COMMENCEMENT OF THE LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA BUKLA 1 INDS). Day and month A. D. 19 Weekday. H. 16 17 Mar. (76) 21 52 56 6 Mar. (66) 23 Feb. (54) 14 Mar. (73) 3 Mar. (62) 4 5 5 10 17 14 16 29 23 22 41 31 20 Feb. (51) 4 53 40 10 Mar. (69) 27 Feb. (58) 18 Mar. (77) 7 Mar. (67) 542 16 25 Feb. (56) 11 5 49 17 17 58 23 30 7 11 54 25 16 Mar. (75) 18 6 34 5 Mar. (64) 0 18 43 22 Feb. (53) 12 Mar. (71) 1 Mar. (60) 6 30 52 18 Feb. (49) 8 Mar. (68) Sun. 6 Fri. 5 Thur. 2 Mon. 0 Sat. 5 Thur. 2 Mon. 0 Sat. 12 43 1 18 55 10 1 7 19 7 19 28 26 Feb. (57) 13 31 37 17 Mar. (76) 19 43 466 Mar. (65) 1 55 55 24 Feb. (55) 8 8 413 Mar. (72) 14 20 13 2 Mar. (61) 20 33 23 20 Feb. (51) 20 . . P * 23 0 24 . 25 2 Mon. 0 Sat.. 4 Wed. 3 Tues. 0 Bat.. 4 Wed. 3 Tues. 0 Sat. 17-6173 971-8924 270-3762 3778 231-9621 855-4281 242-2907 3774 107-6950 702-6722 211-4676 3775 142-3774 628-6656 262-7781 8776 18.1001 485-9097 231-9548 3777 9893-8230 333-1537 201-1315 3778 9928-5054 269-1472 252-4420 3779 9804-2283 116-3913 221-6188 3780 9838-9106 58-4848 272-9292 3781 53-2655 935-9205 244-8437 3783 267-6203 819-4561 216-7584 3783 6 Fri. 4 Wed. 2 Mon. 1 Sun. 5 Thur. 302-3027 755-4496 268-0688 3784 178-0255 602-6936 237-5456 3785 53-7384 449-9378 206-4223 3786 88-4308 385-9312 257-7328 3787 9964-1536 233-1752 227-1096 3788 2 Mon. 9839-8765 80-4194 196-0863 3789 2 Mon. 1 Sun.. 5 Thur. 9974-5589 16-4127 247-3967 3790 88-9137 899-9484 219-3114 3791 123-5960 835-9419 270-6218 3792 9999-3189 683-1860 239-7986 3793 213-6738 566-7217 211-7131 3794 9909-7241 466-4235 260-1858 3795 9785-4470 313-6675 229-4026 3796 201-3771 3797 9999-8018 197-2032 139 T Kall. 1
Page #167
--------------------------------------------------------------------------
________________ 140 Kali. Baka. 2 co Chaitradi Vikrama. Meshadi solar year in Bengal. 3a 3798 619 754 103 3799 620 755 104 3800 621 756 105 3801 622 757 106 3802 623 759 107 3803 624 759 108 3804 625 760 109 3805 626 761 110 3806 627 762 111 3807 628 763 112 3808 629 764 113 3809 630 765 114 3810 631 766 115 2811 632 767 116 3812 633 768 117 3813 634 769 118 3814 635 770 110 3815 638 771 120 3816 637 772 121 3817 638 773 122 3818 639 774 123 3819 640 775 124 8820 641 776 125 3821 642 777 126 3822 643 778 127 EPIGRAPHIA INDICA. CONCURRENT YEAR. Kollam. A. D. 5 *696-97 697-98 698-99 699-700 *700-70 701-02 -702-03 703-04 *704-06 705-06 706-07 707-08 *708-09 709-10 710-11 711-12 #712-13 713-14 714-15 715-16 716-17 717-18 718-W 719-20 *720-21 JOVIAN SAMVATSARA. Southern system. Northern system. 28 Jaya 29 Manmathra 30 Durmukha. 31 Hemalamba 32 Vilamba 33 Vikarin 34 Sarvarin * 35 Plava. 36 Subhakrit 37 Sobhana 38 Krodhin 39. Visvavasu 40 Parabhava. 41 Plavanga 42 Kilaka 43 Saumya 44 Sadharana 45 Virodhakrit. 46 Paridhavin . 47 Pramadin 48 Ananda 49 Rakshasa 50 Anala. 51 Pingala 52 Kalayukta. 7 * . [VOL. XVII. TABLE Intercalated (adhika) and suppressed (kahaya) true lunar months. 8 6 Bhadrapada 5 Sravapa 3 Jyeshtha 1 Chaitra 5 Sravana ... 4 Ashadha 2 Vaisakha 6 Bhadrapada 5 Sravana
Page #168
--------------------------------------------------------------------------
________________ No. 11.) THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 141 LXXXII-Contd. COMMENCEMENT OF THE SOLAR YEAR. LUNT-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA I EN Ds). Kal. Day and month A. D. Week. day. Time of true Mesha-sam. kranti. Day and month A. D. Weekday. 13 17 20 23 24 2011 O Sat. 19 Mar. (79) 1 Sun.. 19 Mar. (78) 2 Mon. 19 Mar. (78) 3 Tues. 19 Mar. (78) 4 Wed. 19 Mar. (79) 6 Fri.. 19 Mar. (78) 19 Mar. (78) 1 Sun.. 19 Mar. (78) 2 Mon. 19 Mar. (79) | 4 Wed. 19 Mar. (78) 5 Thur. 19 Mar. (78) 6 Fri.. 19 Mar. (78) O Sat.. 19 Mar. (79) 2 Mon. 19 Mar. (78) 3 Tues. 19 Mar. (78) 4 Wed. 19 Mar. (78) 6 Thur. 19 Mar. (79) O Sat.. 19 Mar. (78) 1 Sun.. 19 Mar. (78) 2 Mon. 20 Mar. (79) 4 Wod. 19 Mar. (79) 6 Thur. 19 Mar. (78) Fri.. 19 Mar. (78) Sat.. 20 Mar. (79) 2 Mon. 19 Mar. (79) 3 Tues. H. M. S. 44 31 10 Mar. (70) 40 27 Feb. (58) 49 18 Mar. (77) 8 Mar. (67) 7 25 Feb. (56) 16 15 Mar. (74) 4 Mar. (63) 22 9 34 21 Feb. (62) 43 11 Mar. (71) 1 Mar. (60) 48 118 Feb. (49) 22 9 Mar. (68) 19 27 Feb. (58) 22 28 17 Mar. (76) 6 Mar. (65) 46 29 Feb. (54) 58 68 13 Mar. (73) 2 Mar. (61) 18 23 13 20 Feb. (51) 0 35 22 11 Mar. (70) 47 31 28 Feb. (59) 12 69 40 18 Mar. (77) 19 11 49 8 Mar. (67) 123 58 25 Feh. (56) 7 36 7 14 Mar. (74) 6 Fri. . 34-4841 z Tues. 9910-2070 2 Mon. 9944-8894 O Sat.. 159-2443 4 Wed. 34-9671 3 Tues. 60-6496 O Sat.. 9945-3723 4 Wed. 9821-0862 3 Tues..9865-7776 1 Sun.. 70-1324 6 Thur. 9948-0956 4 Wed. 9980-5376 2 Mon. 194.8924 1 Sun.. 230-6748 Thur. 105-2977 2 Mon. 9981-0206 1 Sun.. 15-7029 8 Thur. 9891-4258 3 Tues. 106-7806 2 Mon. 140-4629 6 Fri.. 16-1858 6 Thur. 50-8682 3 Tues. 265-2231 O Sat.. 140-9458 5 Thur. 9836-9963 133-1967 252-6876 3798 980-4408 221-8643 3790 916-4343 273-1748 3800 799-9700 245-0871 3801 847-2140 214-2440 3802 683-2074 3803 430-4516 234-7311 3804 277-6958 203-9079 3805 213-6890 255-2184 3800 97-2248 |-227-13293807 944-4986 196-3098 9806 880-4623 247-6201 3809 778-9979 219-5348 3810 899-9914 270-8451 3811 547-2366 240-0219 3818 394-4796 209.1987 3813 330-4730 260-6092 3814 178-7171 229-8859 3815 61-2528 201-6004 3816 997-2462 262-9100 3817 844-4903 222-08773818 780-4838 273-89813819 664.0195 246-3126 3820 611-2635 214-4896 3821 410-9664 263-0822
Page #169
--------------------------------------------------------------------------
________________ 142 EPIGRAPHIA INDICA. (VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Meshadi solar year in Bengal. Intercalated (adhika) and suppressed (le haya) true lunar months. Kollam. A. D. Southern system. Northern system. 3823 B4 721-22 722-23 . 3 Jyoshtha 3824 3826 846 723-24 *724-25 . . s 8820 847 7 Asvina Margat : (kal) 1 Chaitra .8827 725-26 726-27 727-28 . Sravaga *728-29 729-30 730-31 4 Asbadha 3828 3829 3830 3831 3832 3833 8834 3836 3838 3837 63 Siddharthin. 54 Raudra . 56 Durmati . 56 Dundubhi. 57 Radhirddgarin 68 Rektaksha. 89 Krodhana. 60 Kshaya 1 Prabhava 2 Vibhava 8 Bukla Pramoda Prajapati . 6 Angiraat . & Bhava . . Yupan . 10 Dhupi . 11 Iluara . 12 Bohudhanya 13 Pramathin . 731-32 *732-33 733-34 2 Vaibakhs 6 Bhidrspada 3838 3839 3840 734-35 736-36 *736-37 737-38 738-39 739-40 *740-41 5 Britage 2: . 3 Jyoahtha 3841 3842 3843 3844 3845 1846 3847 861 682 663 884 868 888 687 888 742.13 . 800 401 802 160 . 15 Vrisha . 18 Chitrabhanu 17 Subhanu 18 Tirana 7 Akvins 111 Magha (kah) 1 Chaitra H *744-46 748-46 1 7 Srimukha, was suppressed.
Page #170
--------------------------------------------------------------------------
________________ .INC 11. THE BRAHMA-SIDDHANTA : TRUE, OR APPARENT, SYSTEM. 143 LXXXII-Contd. COMMENCEMENT OF THE SOLAR YEAR. LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY OF Wutom CHAITRA SUKLA 1 ENDS). Kali. Time of true Day and Day and month A. D. Weekday Week Mesha-sam. kranti. month A. D. day. 13 17 19 23 24 6 Thur. H. M. S. 19 Max: (78) 4 Wod. 13 48 15 4 Mar. (63) 19 Mar. (78) 2002421 Feb. (52) 20 Mar. (79) O Sat... 1 2 12:33 12 Mar. (71) 19 Mar. (79) 1 Sun.. 8.84 421 Mar. (61) 19 Mar. (78) 2 Mon, 14 36 51 18 Feb. (49) 19 Mar. (78) 3 Tues, 20 49.0 Mar. (68) 20 Mar. (79) 5 Thur. 3 1.9 26 Feb. (57) 19 Mar. (79) 6 Fri. .19 13 18 16 Mar. (76) 19 Mar. (78) O Sat.. 16 25 276 Mar. (64) 19 Mar. (78) 1 Sun.. 21 37 36 22 Feb. (53) 20 Mar. (79) 3 Tues. | 349 4513 Mar. (72) 10 Mars (79) 4 Wed. 10 1 54 2 Mar. (62) 19 Mar. 1420. Feb. (61) 19 Mar. (78) Fr. 22 281311 Mar. (70) 20 Man, (79) Sun...4 38.8 28. Feb. (59) 19 Mar. (79) 2 Mon. 50..30. 10. Mar. (78) 17 2,397 Mar. (68) 19 Mar. (78) 4 Wed. 23 41.48. 24 Feb. (56) 6 28 57 15 Mar. (74) 19 Mar (79) 11 390 3 Mar. (63) 19 Mar. (78) 17 61 15 21 Feb. (82) 20 Mar. (79) 3 Tues. 0 3 2412 Mar. (71) 20 Mar. (79) 4 Wed. 6 15 33 2 Mar. (61) Ad 19 Mar. (79) 5 Thur. | 12 27 42 19 Feb. (50) cal 19 Mar. (78) 6 Fri.. 18 39 519 Mar. (88) 3 Tues. 51-3511 294-5011234-9767 3828 08at . 992'7-0739 141:7452 204-1634 3824 6 Fri: 9961-7563 77-7385 256-4693 3825 4 Wed. 176-1112 961-2743 227-3785 9820 Sun. 51-8342 808-5184 196-5552 3827 O Sat.. 86-6163 744-5118 247-8658.3828 4 Wed. 0962-2392 591-7659 217-0425 3829 3 Tuen. 9998-9216 527:7498 268-35293830 0 Sat, 9872-6444 374-9934 237-52978831 4 Wed. 0748-38732222374 | 20670648832 * Tues 9783-0497 2168-2908258-01498833 1 Sun. 19897-4046 417868 229-92163834 211-74999253923203-84603836 248-4417861-2958253-18643886 12 Man.. 122.1646 708-5398 222-3382 3837 158-8460644:5333 274,6437 3838 32-5698 90147773 242.8204 3830 2 Mon 0908-2926339 0214211-9973 3840 1 Sun. 9942-97612760149 263-2077 3841 6 Thur. 9818-6978122-2688 232.4845 3842 3 Tues. 33.0527 5:7947 204-3990 3843 2 Mon. 67.7351 941-7880 255-71063844 O Sat. 282-0900 826-3238 227-62403845 4 Wed. 157-8121 672-6678 196-8007 3846 3 Tues. 192-4951 2481112 3847 . 1.8483 . . 3 1, 17 !
Page #171
--------------------------------------------------------------------------
________________ 144 EPIGRAPHIA INDICA. [VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Saka. Intercalated (adhika) and suppressed (tshaya) true lunar months. Meshadi solar year Kollam. Chaitradi Vikra A. D. Southern system. Northern system. 3848 746-47 . Sravana 747-48 3849 3850 3851 3852 *748-49 749-50 . . 3 Jyeshtha 3863 3854 . . . . . . . . . . . . 2 Vaisakha . g 750-51 751-62 *782-83 763-64 754-88 755-58 758-57 3855 . 3856 6 Bhadrapada 3857 8858 3869 757-58 4 Ashadha 8860 758-59 19 Parthiva . 20 Vyaya . 21 Sarvajit . 22 Sarvadharin 23 Virddhin . 24 Vikrita . 26 Khara . 28 Nandans . 27 Vijaya . 28 Jays. . 29 Manmaths. 30 Durmukha. 31 Hemalamba 32 Vilamba . 33 Vikarin . 34 Survarin 35 Plava . . 36 Subhakrit. 37 Sobhana . 38 Krodhin . 39 Visvivasu . 40 Parabbava. 41 Plavanga . 42 Kilaks 43 Saumya . 3861 759-60 3862 760-61 . . 3 Jyeshtha 3863 761-62 3864 762-63 . 7 Advins 3865 763-64 3866 *764-65 765-66 . . . . . 3867 . Sravans 3868 766-67 8869 767-68 *768-69 . . 3 Jyeshtha 8870 3871 3872 769-70 770-71 .
Page #172
--------------------------------------------------------------------------
________________ No. 11.] LXXXII-Contd. THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. Day and month A. D. 13 SOLAR YEAR. Weekday. 14 20 Mar. (79) 20 Mar. (79) 19 Mar. (79) 19 Mar. (78) 20 Mar. (79) 20 Mar. (79) 19 Mar. (79) 19 Mar. (78) 2 Mon. 20 Mar. (79) 4 Wed. 20 Mar. (79) 5 Thur. 6 Fri. 0 Sat. 2 Mon. 3 Tues. 4 Wed. 19 Mar. (79) 19 Mar. (78) 20 Mar. (79) 20 Mar. (79) 19 Mar. (79) 19 Mar. (78) 5 Thur. 20 Mar. (79) 0 Sat. 20 Mar. (79) 1 Sun. 19 Mar. (79) 2 Mon. 19 Mar. (78) 3 Tues. 20 Mar. (79) 5 Thur. 20 Mar. (79) 6 Fri. 19 Mar. (79) 0 Sat. 19 Mar. (78) 1 Sun. 20 Mar. (79) 3 Tues. 1 Sun. 2 Mon. 3 Tues. 4 Wed. 6 Fri. 0 Sat. 1 Sun. . . . . * Time of true Mesha-samkranti. HOT 3 2 4 2 H. M. S. 17 7 COMMENCEMENT OF THE 0 52 0 4 9 13 16 18 14 3 2 29 12 8 41 21 26 Feb. (57) 17 Mar. (76) 5 Mar. (65) 22 Feb. (53) 13 Mar. (72) 3 Mar. (62) 21 Feb. (52) 10 Mar. (69) 28 Feb. (59) 18 Mar. (77) 6 Mar. (66) 24 Feb. (55) 15 Mar. (74) 4 Mar. (63) 6 22 Feb. (53) 12 Mar. (71) 1 Mar. (60) 20 Mar. (79) 8 Mar. (68) 14 53 30 21 5 39 3 17 48 9 29 57 15 42 21 54 15 4 6 24 10 18 33 16 30 42 22 42 51 25 Feb. (56) 4 55 0 16 Mar. (75) 8 11 7 17 19 17 23 31 26 6 Mar. (65) 23 Feb. (54) 13 Mar. (72) 3 Mar. (62) 5 43 35 19 28 27 1 40 36 7 52 45 10 20 17 454 LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Day and month A. D. 19 Week day. 20 0 Sat. 6 Fri. 3 Tues. 0 Sat. 6 Fri. 4 Wed. 2 Mon. 0 Sat. 5 Thur. 3 Tues. 0 Sat. 5 Thur. 4 Wed. 1 Sun. 6 Fri. 5 Thur. 2 Mon. 1 Sun. 5 Thur. 2 Mon. 1 Sun. 6 Fri.. 3 Tues. 2 Mon. 0 Sat. . * . . p 23 6 24 o 25 145 Kali, 68-2180 455-8054 217-2881 3848 905-8161 230-1770 3853 102.9003 391-7988 268-4984 3849 9978-6232 239-0429 237-7752 3850 9854-3461 86-2869 206-9520 3851 9889-0285 22-2804 258-2625 3852 103-3833 317-7384 789-3518 202-0915 3854 13-7885 689-0537 250-6642 3855 228-1433 572-5894 222-5788 3856 9924-1937 472-2911 271-1514 3857 9799-9166 319-5352 240-3282 3858 14.2714 203-0709 212-2428 3859 48-9538 139-0644 263-5533 3860 9924-6766 986-3084 232-7300 3861 139-0315 869-8442 204-6445 3862 805-8377 255-9550 3863 653-0816 225-1318 3864 589-0751 276-4422 3865 9959-8420 436-3192 245-6189 3866 9835-5647 283-5633 214-7958 3867 9870-2472 219-5567 266-1062 3868 84-6020 103-0923 238-0208 3869 9960-3248 950-3365 207-1975 3870 9995-0072 886-3299 258-5080 3871 173-7138 49.4367 84.1191 209-3621 769-8656 230-4226 3872 X
Page #173
--------------------------------------------------------------------------
________________ 146 Kali. Saka. 1 2 Chaitradi Vikrama. Meshadi solar year in Bengal. 3 3a 3873 694 829 178 3874 695 830 179 3875 696 831 180 3876 697 832 181 3877 698 833 182 3878 699 834 183 3879 700 835 184 3880 701 836 185 3881 702 837 186 3882 703 838 187 3883 704 839 188 3884 705 840 189 707 842 191 3885 706 841 190 3886 3887 708 843 3888 709 844 193 3889 710 845 194 192 3890 711 846 195 3891 712 847 196 3892 713 848 197 3893 714 849 198 3894 715 850 199 3895 716 851 200 3896 717 852 201 3897 718 853 202 CONCURRENT YEAR. Kollam. EPIGRAPHIA INDICA. 4 A. D. 5 771-72 *772-73 773-74 774-75 775-76 *776-77 777-78 778-79 779-80 *780-81 781-82 782-83 783-84 *784-85 785-86 786-87 787-88 *788-89 789-90 790-91 791-02 *792-93 793-94 794-95 795-96 JOVIAN SAMVATSARA. Southern system. 6 44 Sadharana 45 Virodhakrit. 46 Paridhavin 47 Pramadin 48 Ananda 49 Rakshasa 50 Anala. 51 Pingala. 52 Kalayukta. 53 Siddharthin. 54 Raudra 55 Durmati 56 Dundubhi 57 Rudhirodgarin 58 Raktaksha 59 Krodhana 60 Kshaya 1 Prabhava Northern system. 2 Vibhava 3 Sukla. 4 Pramoda 5 Prajapati 6 Angiras 7 Srimukha 8 Bhava ... 7 . [VOL. XVII. TABLE Intercalated (adhika) and suppressed (kshaya) true. lunar months. 8 2 Vaisakha 6 Bhadrapada 4 Ashadha 3 Jyeshtha 7 Aevina 5 Sravana 3 Jyeshtha 2 Vaisakha 6 Bhadrapada 4 Ashadha
Page #174
--------------------------------------------------------------------------
________________ No. 11.) THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 147 LXXXII-Contd. COMMENCEMENT OF THE SOLAR YEAR. LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Kali. Day and month A. D. Weekday. Time of true Megha-san 1 Day and kranti. month A. D. Weekday. 1920 24 25 11 13 14 17 23 H. M. s. 20 Mar. (79) 4 Wed.. 11 55 44 20 Feb. (51) 14 Wed.. 75-0849 19 Mar. (79) 5 Thur.. 18 7 53 10 Mar. (70) 3 Tues.. 119.7672 20 Mar. (79) O Sat.. o 227 Feb. (58) O Sat. . 9995-4901 20 Mar. (79) 1 Sun.. 6 Mar. (77) 6 Fri. . 30-1725 20 Mar. (79) 2 Mon.. 12 7 Mac (66) 3 Tues. 9905-8953 19 Mar. (79) 3 Tues.. 18 56 29 25 Feb. (56) 1 Sun.. 120-2501 20 Mar. (79) 5 Thur. . 1 8 38 15 Mar. (74) O Sat. 154.9326 20 Mar. (79) 8 Fri. . 7 20 474 Mar. (63) 4 Wed..i 30-6554 20 Mar. (79) O Sat. . 13 32 66 22 Feb. (53) 2 Mon.. 1 245-0102 19 Mar. (79) 1 Sun.. 19 45 5 12 Mar. (72) 1 Sun.. 279-6926 20 Mar. (79) 3 Tues. . 1 57 14 1 Mar. (60) 5 Thur.. 155-4155 20 Mar. (79) 4 Wed.. 8 9 23 19 Mar. (78) 3 Tues.. 9851-4659 20 Mar. (79) 5 Thur. . 14 21 32 8 Mar. (67) O Sat. . 9727-1887 19 Mar. (79) Fri. . 20 33 41 26 Feb. (57) 5 Thur.. 9941-5435 20 Mar. (79) 1 Sun.. 2 16 Mar. (75) 4 Wed.. 9976-2260 20 Mar. (79) 2 Mon.. 8 596 Mar. (65) 2 Mon.. 190-5807 20 Mar. (79) 3 Tues.. 23 Feb. (54) 8 Fri.. 66-3036 19 Mar. (79) 4 Wed. . 21 22 17 13 Mar. (73) 5 Thur. . 100-9860 20 Mar. (79) 6 Fri. . 3 34 26 2 Mar. (61) 2 Mon.. 9976-7089 20 Mar. (79) O Sat.. 9 46 35 19 Feb. (50) 6 Fri. . 9882-4317 20 Mar. (79) 1 Sun.. 15 58 44 10 Mar. (69) 5 Thur. . 9887-1140 19 Mar. (79) 2 Mon.. 53 27 Feb. (58) 2 Mon.. 9762-8369 20 Mar. (79) 4 Wed.. 4 23 2 17 Mar. (76) 1 Sun.. 9797.5192 20 Mar. (79) 6 Thur. . 10 35 11 7 Mar. (66) 6 Fri.. 11.8741 20 Mar. (79) 6 Fri. . 16 47 20 25 Feb. (56) 4 Wed. 226-2289 617-1097 199-69933873 553-1032 250-9097 3874 400-3472 220-0866 3875 336-3306 271-39703876 183-5848 240-5738 3877 67-1204 212-4883 3878 3.1139 263-7988 3879 850-3579 232-9756 3880 733-8937 204-8901 3881 669-8872 256-2005 3882 517:1311 225-3773 3883 416-8330 273-9600 3884 264-0770 243-1167 3885 147-6128 216-0413 3886 83-6062266-35173887 967-1418 238-26643888 814-3852 207-4431 3889 750-3794 268-7635 3890 597-6235 227-9303 3891 444-8676 197-1071 3892 380-8610 248-4175 3893 228-1051 218-4943 3894 164.0986 268-9047 3895 47-6342 240-8194 3896 931-1699 212-7339 3897 X2
Page #175
--------------------------------------------------------------------------
________________ 148 CONCURRENT YEAR. THE Kollam. A. D. Kali. Saka. 2 3915 3 3 3898 719 854 203 3899 720 855 204 3900 721 856 205 3901 722 857 206 3902 723 858 207 3903 724 859 203 3904 725 860 209 3905 726 861 210 3906 727 862 211 3907 728 863 212 3908 729 864 213 3909 730 865 214 3910 731 866 215 3911 732 867 216 3912 733 868 217 3913 734 869 218 3914 735 870 219 736 871 220 3916 737 872 221 3917 738 873 222 3918 739 874 223 3919 740 875 224 3920 741 876 225 3921 742 877 226 3922 743 878 227 EPIGRAPHIA INDICA. 5 *796-97 797-98 798-99 799-800 *800-01 801-02 802-03 803-04 *804-05 805-06 806-07 807-08 *808-09 809-10 810-11 811-12 *812-13 813-14 814-15 815-16 *816-17 817-18 818-19 819-20 *820-21 JOVIAN SAMVATSARA. Southern system. 6 Northern system. 9 Yuvan 10 Dhatri 11 Ievara 12 Bahudhanya 3 Pramathin 14 Vikrama 15 Vrisha 16 Chitrabhanu 17 Subhanu 18 Tarana 19 Parthiva 20 Vyaya 21 Sarvajit 22 Sarvadharin 23 Virodhin 24 Vikrita 25 Khara 26 Nandana 27 Vijaya 28 Jaya 29 Manmatha 30 Durmukha 31 Hemalamba 32 Vilambat 34 Sarvarin 33 Vikarin was suppressed. 7 . . * [VOL. XVII. TABLE Intercalated (adhika) and suppressed (kshaya) true lunar months. 8 3 Jyeshtha 7 Aevina 5 Sravana ... 3 Jyeshtha 1 Chaitra 5 Sravana ... 4 Ashadha 3 Jyeshtha 7 Aevina
Page #176
--------------------------------------------------------------------------
________________ No. 11.] THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 149 LXXXII-Contd. COMMENCEMENT OF THE SOLAR YEAR LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA I EXDS). Kali Time of true Doy and Day and month A. D. Week day. Meshs-sen kranti. month A. D. I Weekday. 13 14 19 20 23 24 25 i 20 Mar. (79) 1 Sun.. 3900 19 Mar. (79) Sat. . 22 15 Mar. (75) 20 Mar. (79) 2 Mon.. 4 Mar. (63) 4721 Feb. (52) 20 Mar. (79) 4 Wed.. 56 12 Mar. (71) 19 Mar. (79) 5 Thur. 5 19 Feb. (60) 20 Mar. (79) O Sat.. 14 19 Mar. (78) 20 Mar. (79) 1 Sun. 23 8 Mar. (67) 20 Mar. (79) 2 Mon.. 26 Feb. (57) 20 Mar. (80) | 4 Wed. 41 16 Mar. (76) 20 Mar. (79) -5 Thur..! 6 Mar. (65) 20 Mar. (79) 6 Fri.. 59 23 Feb. (54) 20 Mar. (79) O Sat.. 19 8 | 14 Mar. (73) 20 Mar. (80) 2 Mon..1 172 Mar. (62) 20 Mar. (79) 3 Tues. 7 37 26 19 Feb. (50) 20 Mar. (79) 4 Wed. 10 Mar. (69) 20 Mar. (79) 5 Thur. 44 27 Feb. (58) 20 Mar. (80) Sat.. 5217 Mar. (77) 20 Mar. (79) 1 Sun.. 8 26 1 7 Mar. (66) 20 Mar. (79) 2 Mon. 14 38 10 24 Feb. (55) 20 Mar. (79) 3 Tues.. 20 50 19 15 Mar. (74) 20 Mar. (80) 5 Thur. . 3 Mar. (63) 20 Mar. (79) 6 Fri.. 37 21 Feb. (52) 20 Mar. (79) Sat.. 20 Mar. (79) 1 Sun.. 21 38 55 I Mar. (60) 20 Mar. (80) 3 Tues. . 3 51 4 19 Mar. (79) 3 Tues. . 260-9113 O Sat.. 136-6341 4 Wed.. 12-3570 3 Tues.. 47-0394 O Sat. . 9922-7623 6 Fri.. 9957-4347 3 Tues. 9833-1676 47:5223 0 Sat.. 82-2048 5 Thur.. 296-5595 2 Mon.. 172-2824 1 Sun.. 206-9648 5 Thur.. 82-6876 2 Mon.. 9958-4105 1 Sun.. 9993-0928 5 Thur. . 9868-8167 4 Wed.. 9903-4980 2 Mon. . 117-8529 6 Fri.. 9993-5768 5 Thur. 28-2581 2 Mon.. 9903-9810 O Sat. . 118-3358 5 Thur. . 9814-3862 3 Tues.. 28-7410 2 Mon.. 63-4234 867-1634 714-4074 561.6515 497-6449 344-8890 280-8825 128-1265 11-6622 947-6557 831-1914 678-4354 614-4289 461-6730 308-9171 244-9104 92.1645 28-1481 906-6837 768-9278 694-9212 642-1653 425-7009 325-4028 208-9389 144.9321 264-0442 3898 233-2211 3899 202-3979 3900 253-6621 3901 222-8629 3902 274.1733 3903 243-3500 3904 215-2647 3905 266-5751 3908 238-4897 3907 207-66643908 258-9769 228-1537 3910 197-3304 3911 248-6408 3912 217-8177 3918 269-1281 3914 251-0427 3915 210-2194 391B 264-6299 3917 230-70673918 202-6212 3919 251-1938 3920 223-10843921 274-3989 3922
Page #177
--------------------------------------------------------------------------
________________ 150 EPIGRAPHIA INDICA. [VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Intercalated (adhika) and suppressed (kshaya) true hunar months. Kali. Chaitradi Vikrams. Meghadi solar year in Bengal. m. A. D. Southern system. Northern system. 821-22 822-23 . . . Sravana . . 823-24 3923 3924 3925 3926 3927 3928 *824-25 825-26 3 Jyeshtha 826-27 827-28 . . . . 3929 3930 *828-29 1 Chaitra 3931 829-30 . . . . 3932 830-31 5 Sravana 3933 831-32 . 3934 7-8 3935 8-9 36 Plava . . 36 subhakpit . 37 Sychana . 38 Krodhin 39 Visvavasu . 40 Paribhava . 41 Plavanga . 42 Kilaka 43 Saumya . 44 Sadharana 45 Virodhakrit. 46 Paridhavin. 47 Pramadin 48 Ananda . 49 Rakshasa . 50 Anala . . 51 Pingala . 52 Kalayukta. 53 Siddharthin 54 Raudra . 55 Durmati . 56 Dundubhi 67 Rudhirodgarin 58 Raktakahs. 59 Krodhana . . . . . 14 . adha 3936 9-10 3937 *932-33 833-34 834-35 835-36 *936-37 837-38 838-39 3938 10-11 11-12 12-13 13-14 14-15 3939 . 2 Vaisakha . . 6 Bhadrapada 3940 % 3941 839-40 3942 15-16 *840-41 . . . . . . . . . . 3943 16-17 841-42 3944 17-18 842-43 8 . . 6 Sravana . I . 3 Jyeshtha . 3945 8 3946 3947 18-19 19-20 20-21 843-44 *944-45 846-46
Page #178
--------------------------------------------------------------------------
________________ No. 11.) THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 151 LXXXII-Contd. COMMENCEMENT OF THE SOLAR YEAR. LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Day and month A. D. Weekday. Time of trueDay and Mesha-sam month A. D. kranti. Weekday. 13 14 19 20 23 24 25 1 992-1760 875.7118 811-7052 243-5956 3923 215-51023924 266-8206 3925 235-9975 3926 205-1642 3927 658-9493 508-1933 442-1868 256-48463928 6 Fri..9939-1463 4 Wed.. 153-5010 3 Tues.. 188-1834 O Sat.. 63.9063 4 Wed.. 9939-6292 3 Tues.. $974-3115 O Sat. . 9850-0344 5 Thur. 64-6593 4 Wed.. 98-8015 1 Sun.. 9974-7944 O Sat.. 9-4768 5 Thur.. 223-8317 225-66143929 197-5760 3930 289-4309 172-9666 108-9590 956-2040 H. M. S. 20 Mar. (79) 4 Wod. 10 3 13 8 Mar. (67) 20 Mar. (79) 5 Thur.. 10 15 22 22 26 Feb. (57) 20 Mar. (79) 22 27 31 31 17 Mar. (76) 20 Mar. (80) 1 Sun.. 40 5 Mar. (65) 20 Mar (79) 49 22 Feb. (53) 20 Mar. (79) 3 Tues. . 17 3 68 13 Mar. (72) 20 Mar. (79) 4 Wod. . 23 16 7 2 Mar. (61) 20 Mar. (80) 6 Fri.. 5 28 16 20 Feb. (51) 20 Mar. (79) Sat. .11 40 25 10 Mar. (69) 20 Mar. (79) 1 Sun. 17 52 34 27 Feb. (58) 21 Mar. (80) 3 Tucs.. 4 43 18 Mar. (77) 20 Mar. (80) 4 Wed. 6 16 527 Mar. (67) 20 Mar. (79) 5 Thur. 12 29 1 24 Feb. (55) 20 Mar. (79) 6 Fri. . 18 41 2015 Mar. (74) 21 Mar. (80) 1 Sun. 10 53 19 4 Mar. (63) 20 Mar. (80) 2 Mon. . 7 5 28 21 Feb. (52) 20 Mar. (79) 3 Tues. 13 17 37 11 Mar. (70) 20 Mar. (79) 4 Wed. 19 29 46 28 Feb. (59) 21 Mar. (80) 6 Fri.. 1 41 55 20 Mar. (79) 20 Mar. (80) Sat.. 7 54 4 8 Mar. (68) 20 Mar. (79) 1 Sun. 14 6 13 26 Feb. (57) 20 Mar. (79) $ Mon. 18 22 17 Mar. (76) 21 Mar. (80) 4 Wed. 6 Mar. (65) 20 Mar. (80) 5 Thur.. 8 42 40 23 Feb. (54) 20 Mar. (79) 6 Fri.. 14 64 49 12 Mar. (71) 248-8864 3931 3932 269-37363933 241-28833934 210-4650 3935 2 Mon.. 99-5545 892.1976 775-7333 622.9773 558-9708 406-2148 253-4589 1 Sun.. 134-2369 261-77543936 230-9522 3937 5 Thur.. 9.9598 2 Mon.. 9885-6826 200-1290 3938 189-4523 3939 36-6964 8.9816 2 Mon.. 856-2255 1 Sun.. 9920-3649 6 Thur. . 9796-0878 5 Thur. 169-4022 45-1250 0 Sat., 259-4798 6 Fri.. 294.1622 3 Tues. 169.8851 O Sat. 45-5979 5 Thur. . 9741.6583 739-7613 252-4294 220-6162 274-6644 243.8412 215-7558 267-0662 236-0990 205-4197 253-9924 3940 3941 3942 3943 3944 3945 3946 3947 675-7547 522-9988 370-2428 269-9446
Page #179
--------------------------------------------------------------------------
________________ 152 Kal. Saka. 2 Chaitradi Vikrama. Meshadi solar Bengal. 3954 775 906 year 907 21-22 22-23 3948 769 904 253 3949 770 905 254 3950 771 3951 772 256 3952 773 908 257 25-26 255 23-24 24-25 3953 774 909 258 26-27 27-28 28-29 910 259 3955 776 260 3956 777 912 261 29-30 3957 778 913 262 3958 779 914 263 31-32 3959 780 915 264 32-33 3960 781 916 265 33-34 34-35 35-36 36-37 37-38 38-39 39-40 3961 782 917 266 3962 783 918 267 3963 784 919 268 3964 785 920 269 3965 786 921 270 3966 787 922 271 3967 788 923 272 40-41 3968 789 924 273 41-42 3969 790 925 274 3970 791 926 275 3971 792 927 276 3972 793 928 277 911 3a CONCURRENT YEAR. Kollam. A. D. EPIGRAPHIA INDICA. 30-31 45-46 5 846-47 847-48 *848-49 849-50 850-51 851-52 *852-53 853-54 854-55 855-56 #856-57 857-58 858-59 859-60 *860-61 861-62 862-63 863-64 *864-65 865-66 866-67 42-43 867-68 43-44 *868-69 44-45 869-70 870-71 JOVIAN SAMVATSARA. Southern system. 6 60 Kshaya 1 Prabhava 2 Vibhava 3 Sukla. 4 Pramoda Northern system. 5 Prajapati 6 Angiras 7 Srimukha 8 Bhava 9 Yuvan 10 Dhatri 11 Isvara 12 Bahudhanya 13 Pramathin 14 Vikrama 15 Vrisha 16 Chitrabhanu 17 Subhanu 18 Tarana 19 Parthiva 20 Vyaya 21 Sarvajit 22 Sarvadharin 23 Virodhin 24 Vikrita 7 VOL. XVII TABLE Intercalated (adhika) and suppressed (kshaya) true lunar months. 8 1 Chaitra 5 Sravana 4 Ashadha 2 Vaisakha 6 Bhadrapada 5 Sravana 3 Jyeshtha 7 Aevina 9 Margas: (ksh) 1 Chaitra 5 Sravana
Page #180
--------------------------------------------------------------------------
________________ No. 11.] THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 163 LXXXII-Contd. COMMENCEMENT OF THE SOLAB YEAR LUNI-SOLAR YEAR (MEAN BUNRISE OF CIVIL DAY ON WHICH CHAITRA BUKLA 1 ENDS). Kali. Week Time of true Mosha-san kranti. Day and month A.D. Day and month A. D. Week day. day. 13 17 19 20 23 24 25 i H. M. S. 20 Mar. (79)0 Sat. 21 6 682 Mar. (61) 21 Mar. (80) 2 Mon. . 3 19 7 19 Feb. (50) 20 Mar. (80) 3 Tues. 16 10 Mar. (70) 20 Mar. (79) 4 Wed.. 26 | 27 Feb. (58) 20 Mar. (79) 5 Thur.. 68 34 18 Mar. (77) 21 Mar. (80) O Sat.. 7-Mar. (66) 20 Mar. (80) 1 Sun.. 24 Feb. (56) 20 Mar. (79) 2 Mon. 16 32 114 Mar. (73) 20 Mar. (79) 3 Tues 10 3 Mar. (62) 21 Mar. (80) 5 Thur.. 21 Feb. (52) 20 Mar. (80) 6 Fri.. 28 11 Mar. (71) 20 Mar. (79) O Sat . 1 Mar. (60) 20 Mar. (79) 1 Sun.. 20 Mar. (79) 21 Mar. (80) 8 Tues. . 549 Mar. (68) 20 Mar. (80) 4 Wed.. 3 26 Feb. (67) 20 Mar. (79) 6 Thur. 12 16 Mar. (75) 21 Mar. (80) O Sat.. 0 21 21 5 Mar. (64) 21 Mar. (80) 1 San.. 6 33 30 22 Feb. (63) 20 Mar. (80) 2 Mon. . 12 45 39 12 Mar. (72) 20 Mar. (79) 3 Tues.. 18 67 48 2 Mar. (61) 21 Mar. (80) 5 Thur.. 1957 19 Feb. (50) 21 Mar. (80) 6 Fri. . 7 22 6 11 Mar. (70) 20 Mar. (80) Sat . 13 34 15 28 Feb. (59) 20 Mar. (79) 1 Sun.. 19 46 24 18 Mar. (77) 21 Mar. (80) 3 Tues. . 1 58 33 7 Mar. (66) 3 Tues.. 9966-0132 O Set. 9832-2167 O Sat. 205-0503 4 Wed.. 80-7732 3 Tues. . 116-4566 O Sat. 9991-1784 4 Wed.. 9866-9013 3 Tuer. 9900-5837 O Sat . 9777-3065 5 Thur. 9991-8613 4 Wed.. 28-3437 2 Mon.. 240-4285 1 Sun..! 275-3809 5 Thur.. 151.1038 2 Mon.. 28-8286 1 Sun. 61-5090 5 Thur. 9937-2318 2 Mon. . 9812-9847 1 Sun.. 9847-6371 6 Fri. . 61-9919 3 Tues. . 9937-7149 3 Tues. . 311-0291 O Sat. 186-7519 221-4343 3 Tuos. 97-1872 163-4804228-0070 3948 0-7839 195-0837 3949 973-0098 249-2319 3950 820-2535 218-4088 3951 756-2470 269-6192 3952 603-4911238-79603953 450-7353 207-9727 3964 386-7286 259-2832 3956 233-9727 228-4600 3956 117-5084 200-37453957 63-5018 261-6849 3968 937-0375 223-5995 8959 873-0310 274 9100 3960 720-2751 244-0867 3961 567-5191 219-2636 396 503-6128 264-5739 3963 350-7566 233-5708 3964 198-0007 202-9275 3906 132-9941 254-2379 3966 17-5209 226-1625 3967 864-7741 3968 837-0690 249-3775 3969 884-3031 218-6643 3970 620-2965 269-86473971 467.6406 239-0416 3972
Page #181
--------------------------------------------------------------------------
________________ 154 Kali. Saka. 1 2 3 3a 3973 794 929 278 3974 795 930 279 3975 796 931 280 3976 797 932 281 3977 798 933 282 799 934 283 800 935 284 936 285 286 938 287 3978 3979 3980 801 3981 802 937 3982 803 3983 804 939 288 289 3984 940 805 3985 806 941 290 807 3986 942 291 3987 808 943 292 3988 800 944 293 3989 810 945 294 3990 946 3991 812 947 3992 813 948 3993 814 949 298 3994 815 950 299 3995 816 951 300 3996 817 952 301 3997 953 302 818 295 296 297 CONCURRENT YEAR. Kollam. A. D. 46-47 47-48 48-49 49-50 EPIGRAPHIA INDICA. 50-51 51-52 52-53 53-54 54-55 55-56 56-57 57-58 58-59 59-60 60-61 61-62 62-63 63-64 64-65 65-66 66-67 67-68 68-69 69-70 70-71 871-72 *872-73 873-74 874-75 875-76 *876-77 877-78 878-79 879-80 #880-81 881-82 882-83 PS83-84 *884-85 885-86 886-87 887-88 *888-89 889-90 890-91 891-92 *892-93 893-94 894-95 895-96 JOVIAN SAMVATSARA. Southern system. 6 Northern system. 7 25 Khara 26 Nandana 27 Vijaya 28 Jaya 29 Manmatha 30 Durmukha 31 Hemalamba 32 Vilamba 33 Vikarin 34 Sarvarin * + 35 Plava 36 Subhakrit. 37 Sobhana 38 Krodhin 39 Visvavasu 40 Parabhava 41 Plavanga 42 Kilaka . . 43 Saumya 44 Sadharapa 45 Virodhakrit 46 Paridhavin 47 Pramadin. 48 Ananda 49 Rakshasa. . [VOL. XVII. TABLE Intercalated (adhika) and suppressed (Kahaya) true lunar months. 8 4 Ashadha 2 Vaisakha 6 Bhadrapada *** 5 Sravana 3 Jyeshtha 7 Aevina 10 Pausha (ksh.)) 1 Chaitra 5 Sravana 3 Jyeshtha 2 Vaisakha " 6 Bhadrapada
Page #182
--------------------------------------------------------------------------
________________ No. 11.] THE BRAHMA-SIDDHANATA : TRUE, OR APPARENT, SYSTEM. 155 LXXXII-Contd. COMMENCEMENT OF THE SOLAR YEAR. LUNI-BOLAB YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA BUKLA 1 ENDS). Kali. Time of true Day and Day and month A. D. Woek. day. Megha-sam kranti. month A. D. Weekday. 20 231 24 26 1 14 17 19 H.M.S. 21 Mar. (80) 4 Wed. . 8 10 4224 Feb. (55) 20 Mar. (80) 5 Thur.. 14 22 61 14 Mar. (74) 20 Mar. (79) 8 Fri.. 0 3 Mar. (62) 21 Mar. (80) 1 Sun... 9 21 Feb. (52) 21 Mar. (80) 2 Mon.. 18 12 Mar. (71) 20 Mar. (80) 3 Tues.. 27 29 Feb. (60) 20 Mar. (79) 4 Wed. . 2123 36 19 Mar. (78) 21 Mar. (80) 8 Mar. (67) 21 Mar. (80) 0 Sat.. 26 Feb. (57) 20 Mar. (80) 1 Sun.. 0 3 15 Mar. (75) 20 Mar. (79) 2 Mon. - 22 12 12 5 Mar. (64) 21 Mar. (80) 4 Wed.. 24 21 22 Feb. (53) 21 Mar. (80) 5 Thur. 3013 Mar. (72) 20 Mar. (80) 6 Fri. . 16 2 Mar. (62) 20 Mar. (79) Sat.. 48 19 Feb. (50) 21 Mar. (80) 2 Mon.. 57 10 Mar. (69) 21 Mar. (80) 3 Tues.. 11 26 6 27 Feb. (58) 20 Mar. (80) 4 Wed.. 17 37 16 | 17 Mar. (77) 20 Mar. (79) 5 Thur.. 2349 24 6 Mar. (65) 21 Mar. (80) 0 Sat.. 6 23 Feb. (54) 21 Mar. (80) 1 Sun.. 12 13 42 14 Mar. (73) 20 Mar. (80) 2 Mon.. 18 26 61 3 Mar. (63) 21 Mar. (80) 4 Wed.. 0 38 021 Feb. (62) 21 Mar (80) 5 Thur.. 6 60 9 12 Mar. (71) 21 Mar. (80) 6 Fri. . 31 2 18 1 Mar. (60) O Sat. . 9972-8801 313-7848 208-2183 3973 6 Fri.. 7-5624250-7781 259-50873974 3 Tues. . 9883-2853 98-0222 228-7055 3975 1 Sun.. 981-5679 200-6101 3976 O Sat. . 132-3224 917-5514 251-93053977 Wed.. 8-0453764-7954 221.1072 3978 3 Tues.. 42-7277 700-7889272-41773979 O Sat. . 9918-4506 648-0330 241.51463980 5 Thur.. 132-8053 431-6686 213-6091 3981 3 Tues. . 9828-8558 331-2705 262.0817 3982 1 Sun.. 43.2106 214-8061 234-0013 3983 5 Thur. . 9918-9335 62-0602 203-1731 3984 4 Wed. . 9953-6168998-0436 254-48353985 2 Mon.. 187-9707 881-5794 226-3980 3986 6 Fri. . 43-6936 728-9236 195-6748 3987 5 Thur.. 78-3759 664-8169 246-7165 3988 2 Mon.. 9954-0987 512-0610 216-0621 3989 1 Sun.. 9988-7811 448-0544 267-37243990 5 Thur.. 9884-6040 294-2984 236-5493 3991 2 Mon.. 9740-2268 142.5426 205-7261 3992 1 Sun.. 9774-9092 78-5360 257.0366 3993 8 Fri. . 9989-2641 962.0717 228-95103994 4 Wed.. 203-6198 845-6075 200-6968 3995 | 3 Tues. . 238-3012 781.6000 252-0073 3996 O Sat.. 114-0241 628-8449 221-3528 3997 Y 2
Page #183
--------------------------------------------------------------------------
________________ 156 EPIGRAPHIA INDICA. [VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Saks. Chaitradi Vikrama. Intercalated (adhika) and suppressed (kshaya) true lunar months. Meshadi solar year in Bengal. Kollam. A. D. Southern system. Northern system. 12 5 3998 819 203 3999 71-72 72-73 73-74 74-75 4000 4001 4002 75-76 4003 76-77 4004 77-78 78-79 4003 4006 79-80 4007 80-81 4008 81-82 4009 82-83 . 4010 83-84 84-85 *896-97 50 Anals . . 897-98 51 Pingals . . 898-99 52 Kaluyukta. . . 4 Ashadha 899.900 53 Siddharthin. *900-01 54 Raudra . . 901-02 55 Durmati . . . 3 Jyeshtha 902-03 56 Dundubhi. . 903-04 57 Rudhirodgarin . 7 Akvina *904-05 58 Raktakshat. 905-06 59 Krodhans . 60 Kshaya. . 906-07 60 Kshaya 1 Prabhava 5 Sravana 907-08 1 Prabhava . 2 Vibhava *908-09 2 Vibhava . 3 Sukla. . 909-10 3 Sukla. . 4 Pramoda . 3 Jyeshtha 910-11 4 Pramoda 5 Prajapati 911-12 5 Prajapati 6 Angiras *912-13 8 Angiras 7 Srimukha . 2 Vaisakha 913-14 7 Srimukha . 8 Bhava. 914-16 8 Bhava . . 9 Yuvan. 6 Bhadrapada 915-16 9 Yuvan. . 10 Dhatri. *916-17 10 Dhatri. 11 Isvars . . 917-18 11 Isvara. 12 Bahudhanya . | 4 Ashisha 918-1912 Bahudhanya . 13 Pramathin . 919-20 13 Pramathin 14 Vikrama *920-21 14 Vikrama 15 Vrisha. 3 Jyeshtha 4011 4012 4013 85-86 86-87 87-88 88-89 4014 4015 4016 4017 SS SS 89-90 90-91 91-92 4018 4019 92-93 4020 93-94 4021 94-95 4022 843 327 95-98 + 59 Krodhana was suppressed in the North. By Southern reckoning there was no supprersion, por has there been any such since.
Page #184
--------------------------------------------------------------------------
________________ No. 11.] THE BRAHMA-SIDDHANTA: TRUE OR APPARENT, SYSTEM. 157 LXXXII-Contd. COMMENCEMENT OF THE SOLAR YEAR. LUNI-SOLAR YEAR (MEAN SUNRISE OB CIVIL DAY ON WHICH CHAITRA SUKLA I ENDS). Kali. Day and month A. D. Weekday. Time of true Mesha-sam kranti. Day and month A. D. Weekday. b 13 14 17 19 20 23 24 25 i 148-7064 6 Fri. 3 Tues.. 272-66323998 241-84013999 24-4293 564-8384 412-0825 259-3266 195-3200 O Sat. . 9900-1522 13 50 42-5640 H.M.S. 20 Mar. (80) O Sat.. 19 14 27 19 Mar. (79) 21 Mar. (80) 2 Mon.. 1 26 36 8 Mar. (67) 21 Mar. (80) 3 Tues.. 7 38 45 25 Feb. (56) 21 Mar. (80) 4 Wed.. 54 16 Mar. (75) 20 Mar. (80) 5 Thur.. | 20 34 Mar. (64) 21 Mar. (80) O Sat.. 12 22 Feb. (53) 21 Mar. (80) 1 Sun.. 8 21 13 Mar. (72) 21 Mar. (80) 2 Mon.. 14 3 Mar. (62) 30 Mar. (80) 3 Tues. . 20 51 38 20 Mar. (80) 21 Mar. (80) 5 Thur.. 47 10 Mar. (69) 21 Mar. (80) 6 Fri. 56 27 Feb. (58) 21 Mar. (80) O Sat.. 5 17 Mar. (76) 20 Mar. (80) 1 Sun.. 40 146 Mar. (66) 21 Mar. (80) 3 Tues.. 21 Mar. (80) | 4 Wed.. 14 Mar. (73) 21 Mar. (80) 5 Thur.. 20 Mar. (80) 6 Fri.. 22 Feb. (53) 21 Mar. (80) 1 Sun.. 40 69 11 Mar. (70) 21 Mar. (80) 2 Mon.. 10 538 28 Feb. (59) 21 Mar. (80) 3 Tues. . 17 17 19 Mar. (78) 20 Mar. (80) 4 Wed. 1 26 7 Mar. (67) 21 Mar. (80) 6 Fri.. 35 25 Feb. (56) 21 Mar. (80) O Sat.. 41 44 16 Mar. (75) 21 Mar. (80) 1 Sun. . 17 63 63 5 Mar. (64) 21 Mar. (81) 3 Tues.. 6 2 23 Feb. (54) 23 Feb. (64) 6 Fri..9934-8345 3 Tues. . 9810-5573 1 Sun.. 24.9122 O Sat.. 59-5945 5 Thur.. 273-9494 3 Tues. . 9969-9998 1 Sun.. 184-3546 5 Thur.. 60-0774 3 Tues. . 9756-1279 1 Sun.. 9970-4827 5 Thur. . 9846-2055 4 Wed.. 9880-8879 2 Mon.. 95-2428 O Sat.. 309-5976 5 Thur.. 5-6479 2 Mon.. 9881-3708 1 Sun.. 9916-0531 5 Thur.. 9791-7760 3 Tues.. 6-1309 2 Mon. . 40-8133 6 Fri. . 9916-5360 4 Wed. . 130-8909 926-0997 862-0930 745-6289 645-3307 528-8666 376-1105 275-8123 159-3479 6-5921 942-5855 826-1212 709-6569 609-3587 456-6028 392-5962 239-8403 123-3760 59-3695 906-6135 790-1493 211.0169 4000 262-3050 4001 231-4818 4002 203-3963 4003 254-7067 4004 226-6213 4005 275-1940 4006 247.1085 216-2853 4008 264-8579 4009 4010 205.9493 4011 257-2597 4012 229-1743 4013 201.0889 4014 249-6615 4015 218-8383 4016 4017 239-3256 4018 211-2401 4019 262-55054020 231.6273 4021 203-6419 4022 4 Mar. (63)
Page #185
--------------------------------------------------------------------------
________________ 158 EPIGRAPHIA INDICA. [VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Intercalated (adhika) and suppressed (kshaya) true lunar months. Kali. Saks. Meshadi solar year in Bengal. Kollam. A. D. Southern system. Northern system. 4023 4024 4025 4026 4027 4028 4029 4030 4031 4032 96-97 97-98 98-99 99-100 100-01 101-02 102-03 103-04 104-05 105-06 106-07 107-08 108-09 109-10 110-11 111-12 112-13 113-14 114-15 115-16 4033 4034 4035 4036 4037 921-22 15 Vpisha. 16 Chitrabhanu . 922-23 16 Chitrabhanu . 17 Subhanu . 7 Asvina 923-24 17 Subhanu . 18 Tarana *924-25 18 Tarana. 19 Parthiva 925-28 19 Parthiva . 20 Vyaya . 5 Sravana 926-27 20 Vyaya . . 21 Sarvajit . 927-28 21 Sarvajit .22 Sarvadharin. *928-29 22 Sarvadharin. 23 Virddhin . 3 Jyeshtha . 929-30-23 Virodhin 24 Vikrita 930-31 24 Vikrita . 25 Khara . 931-32 25 Khara . . 26 Nandana 2 Vaisakhs . *932-33 26 Nandana 27 Vijaya . . 933-34 27 Vijaya . 28 Jaya . . 6 Bhadrapada 934-35 28 Jaya . . 29 Manmatha 935-36 29 Manmaths 30 Durmukha. -936-37 30 Durmukha . 31 Hemalamba . 4 Ashidha 937-38 31 Hemalambs. 32 Vilamba 938-39 32 Vilamba 33 Vikarin 939-40 33 Vikarin 34 Sarvarin . 3 Jyeshtha *940-41 34 Sarvarin 35 Plava . . 941-42 35 Plave. 36 Subhakrit . 7 Asvina 942-43 36 Subhakrit . 37 Sobhana 943-44 37 Sobhana . 38 Krodhin *944-45 38 Krodhin 39 Visvavasu . Sravapa 945-46 39 Visvavasu 40 Parabhava . 4038 343 4039 4040 4041 4042 4043 116-17 4044 349 4045 117-18 118-19 119-20 120-21 4046 351 352 4047
Page #186
--------------------------------------------------------------------------
________________ No. 11.] THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 159 LXXXII-Contd. COMMENCEMENT OF THE SOLAR YEAR LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Kali. Day and month A. D. I Weekday. Time of true Mesha-sam kranti. Day and month A. D. Weekday. 20 23 24 25 1 4027 76-9443 13 17 19 H. M. S. 21 Mar. (80) 4 Wed.. 6 18 11 13 Mar. (72) 21 Mar. (80) 5 Thur. . 12 30 20 2 Mar. (61) 21 Mar. (80) 8 Fri. . 18 21 Mar. (80) 21 Mar. (81) 1 Sun.. o 38 9 Mar. (69) 21 Mar. (80) 2 Mon. . 7 647 26 Feb. (57) 21 Mar. (80) 3 Tues. . 13 18 56 17 Mar. (76) 21 Mar. (80) 4 Wed. . 19 31 5 7 Mar. (66) 21 Mar. (81) 6 Fri. . 1 43 14 24 Feb. (55) 21 Mar. (80) O Sat. 14 Mar (73) 21 Mar. (80) 1 Sun.. 324 Mar. (63) 21 Mar. (80) 2 Mon.. 41 21 Feb. (52) 21 Mar. (81) 4 Wed.. 5011 Mar. (71) 21 Mar. (80) 5 Thur. 1 43 59 28 Feb. (59) 21 Mar. (80) 6 Fri.. 819 Mar. (78) 21 Mar. (80) 0 Sat.. 8 Mar. (67) 21 Mar. (81) 2 Mon.. 26 26 Feb. (57) 21 Mar. (80) 3 Tues. . 1 3516 Mar. (75) 21 Mar. (80) | 4 Wed.. 5 Mar. (64) 21 Mar. (80) 21 56 53 23 Feb. (54) 21 Mar. (81) Sat.. 4 9 2 12 Mar. (72) 21 Mar. (80) 1 Sun.. 11 1 Mar. (60) 21 Mar. (80) 2 Mon.. 20 Mar. (79) 21 Mar. (80) 3 Tues.. 9 Mar. (68) 21 Mar. (81) 5 Thur.. 38 27 Feb. (58) 21 Mar. (80) 6 Fri. .11 947 17 Mar. (76) 47 17 Mar. (76) 165-5733 726-1427 254-9523 573-3868 224.1290 4024 6 Fri.. 75-9785 509-3802 275-4395 2025 3 Tues. 9951-7014 356-6243 244-61634026 O Sat. . 9827-4242 203-8683 213-7931 6 Fri. 9862-0966 139-8618 265-10344028 4 Wed. . 76-4614 23-3975 237-0181 4029 1 Sun.. 9952-1843 870-6416 206-1949 4030 0 Sat.. 9986-8666 806-6351 257-5053 4031 5 Thur.. 201-2215 690-1707229-4198 4032 2 Mon. 537-4148 198-5966 4033 1 Sun. 111-6267 473-4083 249.9071 4034 5 Thur. . 9987-3495 320-6523 219-0839 4035 4 Wed. 22-0319 256-6458 270-3942 4036 1 Sun.. 9897-7548 103-8898 239-5711 4037 6 Fri.. 112.1097 987-4256 211-48574038 5 Thur..! 146-7920923-4190 262-7961 4039 2 Mon.. 22-5148 770-6630 231-9729 4040 O Sat. 236-8697 654.1988 203-8874 4041 5 Thur. 9932-9200 553-9006 252-4601 4042 2 Mon. - 9808-6429 401-1447 221-6368 4043 1 Sun.. 9843-3253 337.1381 272.9473 4044 5 Thur. . 9719-0482 184-3821 242-1240 4045 3 Tues.. 9933-4029 67-9178 214-0386 4046 2 Mon.. 9968-0854 3-9113 265-3490 4047
Page #187
--------------------------------------------------------------------------
________________ 160 EPIGRAPHIA INDICA. [Vol. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Saka. Chaitradi Vikrama. Intercalated (adhika) and suppressed (kshaya) truo lunar months. Meshadi solar year in Bengal. Kollam. A. D. Southern system. Northern system. 4048 1004 946-47 40 Paribbe 353 354 4049 1005 4050 4051 1007 4052 4053 4054 4055 4056 360 361 362 4057 4058 363 4059 4060 365 121-22 122.23 123-24 124-25 125.26 126-27 127.28 128-29 129-30 130-31 131-32 132-33 133-34 134-35 135-36 136-37 137-38 138-39 139-40 140-41 141-42 142-43 143-44 144-46 145-46 40 Parabhava . 41 Plavanga 947-48 41 Plavanga 42 Kilaks. 3 Jyeshths *948-49 42 Kilaka. 43 Saumya . 949-50 43 Saumya 44 Sadharana 950-51 44 Sadharana . 45 Virodhakrit. 1 Chaitra 951-5245 Virodhakrit 46 Paridhavin *952-53 46 Paridhavin . 47 Pramadin 5 Sravana 953-54 47 Pramadin 48 Ananda 954-55 48 Ananda 49 Rakshasa I 955-56 49 Rakshasa 50 Anala. 4 Ashadha . *956-57 50 Anala. 51 Pingala 957-58 51 Pingala . 52 Kalayukta 958-69 52 Kalayukta 53 Siddharthin. 3 Jyeshtha . 959-60 63 Siddharthin. 54 Raudra *960-61 54 Raudra 55 Durmati 7 Asvins 961-6255 Durmati 56 Dundubhi . 962-63 56 Dundubhi 57 Rudhirddgarin 963-64 57 Rudhirodgarin 58 Raktaksha 58 Raktakshs . . Ashadhat *964-65 58 Raktaksha .59 Krodhana . 965-66 59 Krodhana 60 Kshaya 966-67 60 Kshaya 1 Prabhava 3 Jyeshtha 967-68 1 Prabhava 2 Vibhava *968-69 2 Vibhava 3 Sukla. 12 Phalgunat. 969-70 3 Sukla. . 4 Pramoda 970-71 4 Pramoda 5 Prajapati 4061 366 1018 4062 4063 367 368 4064 4065 4066 1020 1021 1022 1023 1024 370 371 372 373 4067 4068 4069 4070 1025 1026 1027 4071 4072 + See "Remarks" above, on the page preceding the Tablo.
Page #188
--------------------------------------------------------------------------
________________ No. 11.] LXXXII-Contd. Day and month A. D. THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 13 SOLAR YEAR. Weekday. 14 21 Mar. (80) 0 Sat. 1 Sun. 3 Tues. 21 Mar. (80) 21 Mar. (81) 21 Mar. (80) 21 Mar. (80) 22 Mar. (81) 4 Wed. 5 Thur.. 0 Sat. 1 Sun. 21 Mar. (81) 21 Mar. (80) 2 Mon. 21 Mar. (80) 3 Tues.. 5 Thur.. 6 Fri. 0 Sat. 22 Mar. (81) 21 Mar. (81) 21 Mar. (80) 21 Mar. (80) 1 Sun. 22 Mar. (81) 3 Tues. 21 Mar. (81) 4 Wed.. 21 Mar. (80) 5 Thur.. 21 Mar. (80) 6 Fri. 22 Mar. 1 Sun. 21 Mar. (81) 2 Mon. 21 Mar. (80) 3 Tues. 21 Mar. (80) 4 Wed. 22 Mar. (81) 6 Fri. 21 Mar. (81) 0 Sat. 21 Mar. (80) 1 Sun. F 21 Mar. (80) 2 Mon. . * " * Time of true Mesha-samkranti. COMMENCEMENT OF THE 17 16 7 LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA BUELA 1 ENDS). H. M. S. 17 21 56 7 Mar. (66) 23 34 5 24 Feb. (55) 5 46 13 11 58 22 18 10 31 14 Mar. (74) 3 Mar. (62) 20 Feb. (51) 11 Mar. (70) 28 Feb. (59) 18 Mar. (77) 0 22 40 6 34 49 12 46 58 18 59 1 11 16 7 23 25 8 Mar. (67) 26 Feb. (57) 16 Mar. (76) 5 Mar. (64) 22 Feb. (53) 13 Mar. (72) 13 35 34 19 47 43 1 59 52 1 1 Mar. (61) 8 12 14 24 10 20 Mar. (79) 20 36 19 9 Mar. (68) 2 48 28 27 Feb. (56) 9 0 37 15 12 46 21 24 55 4 3 37 9 49 13 Day and month, A. D. 22 13 31 19 17 Mar. (77) 7 Mar. (66) 24 Feb. (55) 15 Mar. (74) 3 Mar. (63) 1 22 21 Mar. (80) 11 Mar. (70) Weekday. 20 * .. 5 Thur.. 8 Tues.. 0 Sat. 6 Fri. 3 Tues.. 1 Sun. 6 Fri. . . . . . 0 Sat. 182-4402 887-4470 4 Wed.. 237-2637 4048 206-4404 4049 92-8454 670-6846 257-7508 4050 58-1630 734-6910 3 Tues.. 0 Sat. 9968-5683 517-9286 226-9276 4051 4 Wed. 9844-3112 365-1727 196-1044 4052 3 Tues.. 9878-9735 301-1662 247-4148 4053 0 Sat. 9754-6963 148-4102 216-5916 4054 9789-3787 84-4037 267-9020 4055 967-9394 239-8167 4056 6 Fri. 4 Wed.. 2 Mon.. 1 Sun. 5 Thur.. 218.0884 851-4750 211-7312 4057 252.7708 787-4685 263-0416 4058 128-4936 634-7125 232-2184 4059 4-2164 481-9566 201-3952 4060 38-8988 417-9502 252-7056 4061 2 Mon. 1 Sun.. 5 Thur. 9914-6217 265-1942 221-8823 4062 4 Wed.. 9949-3040 201-1877 273-1828 4063 9825-0269 48-5316 242-3696 4064 1 Sun. 6 Fri. 39-3817 931-9674 214-2842 4065 74-0642 867-9608 265-5946 4066 288-4189 751-4956 237-5093 4067 164-1418 598-7406 206-6860 4068 198-8042 534-7341 257-9964 4069 74-5470 381-9782 227-1731 4070 9770-5974 281-6799 275-7458 4071 9984-9522 616-2156 247-6604 4073 . a 23 9 3-7335 24 C 25 161 Kali.
Page #189
--------------------------------------------------------------------------
________________ 162 Kali. Saka. 2 Chaitradi Vikrama. Meshadi solar year in Bengal. 3 3a 917 1032 918 1053 CONCURRENT YEAR. Kollam. 4073 894 1029 378 146-47 379 147-48 380 148-49 381 149-50 382 150-51 4082 4074 895 1030 4075 896 1031 4076 897 1032 4077 898 1033 4078 899 1034 383 151-52 4079 900 1035 384 152-53 4080 901 1036 385 -153-54 4081 902 1037 386 154-55 903 1038 387 155-56 4083 901 1039 388 156-57 4084 905 1040 389 157-58 4085 906 1041 390 158-89 4086 907 1042 391 159-60 4087 908 1043 392 160-61 909 1044 393 161-62 4089 910 1045 394 162-63 4090 911 1046 395 163-64 4091 912 1047 396 164-65 4092 913 1048 397 165-66 4088 4093 914 1049 398 166-67 399 167-68 409+ 915 1050 4095 916 1051 400 168-69 4096 401 169-70 402 170-71 4097 EPIGRAPHIA INDICA. A. D. JOVIAN SAMVATSARA. Southern system. Northern system. * 971-72 5 Prajapati *972-73 6 Angiras 973-74 7 Srimukha 974-75 8 Bhava. 975-76 9 Yuvan. *976-77 10 Dhatri. 977-78 11 levara. 978-79 12 Bahudhanya. 979-80 13 Pramathin *980-81 14 Vikrama 981-82 15 Vrisha. 982-83 18 Chitrabhanu 983-84 17 Subhanu *984-85 18 Tirana. 985-86 19 Parthiva 986-87 20 Vyaya. 987-88 21 Sarvajit 22 Sarvadharin. 988-89 22 Sarvadharin. 23 Virodhin 989-90 23 Virodhin 24 Vikritat 26 Nandana 27 Vijaya. 28 Jaya 18 Tarana. 19 Parthiva 20 Vyaya. 21 Sarvajit 990-91 24 Vikrita. 991-92 25 Khara 992-93 26 Nandana 993-94 27 Vijaya. 994-95 28 Jaya. 995-96 29 Manmatha 29 Manmatha 30 Durmukha 31 Hemalamba 7 6 Angiras 7 Srimukha 8 Bhava. 9 Yuvan. 10 Dhatri. 11 Ievara. + 25 Khara was suppressed in the north. tt See "Remarks" on page preceding the Table. . * . * [VOL. XVII. 12 Bahudhanya. 2 Vaisakha 13 Pramathin 14 Vikrama 15 Vrisha . 16 Chitrabhanu. 17 Subhanu * TABLE Intercalated (adhika) and suppressed (kahaya) true lunar months. 5 Sravana 4 Ashadha 6 Bhadrapada 4 Ashadhatt :: 3 Jyeshtha 1 Chaitra 5 Sravana 4 Ashadha
Page #190
--------------------------------------------------------------------------
________________ No. 11.) THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 163 LXXXII-Contd. COMMENCEMENT OF THE SOLAR YEAR LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Kali, Week Day and month A. D. Weekday. Time of true Megha-san. kranti. Day and month A. D. day. 13 14 1 17 19 20 23 24 25 l M. S. 22 Mar. (81) 28 Feb. (60) 9860-8761 12-45 21 Mar. (81) 5 Thur. . 10 18 Mar. (78) 2 Mon. - 9896-8574 948-4632 21 Mar. (80) 8 Fri. . 16 8 Mar. (67) O Set.. 109-7128 831-9889 21 Mar. (80) O Sat.. 23 25 Feb. (56)71 4 Wod.. 9985-4362 879-2329 22 Mar. (81) 2 Mon..jo 14 16 16 Mar. (75) 3 Tues.. 20-1175 618-2264 21 Mar. (81) 3 Tues. 11 26 254 Mar. (64) Sat. . 9895-8404 462-4704 21 Mar. (80) 4 Wed. 17 38 34 21 Feb. (62) 4 Wed. 9771-5832 309-7145 21 Mar. (80) 5 Thur.. 23 50 43 12 Mar. (71) 3 Tues. . 9806-2468 245-7080 22 Mar. (81) O Sat. 6 2 52 2 Mar. (61) I Sun.. 20-6004 129-2437 21 Mar. (81) 1 Sun.. 12 15 120 Mar. (80) O Sat. 58-2828 88-2372 21 Mar. (80) 2 Mon. . 18 27 10 9 Mar. (68) 4 Wed. 9931-0007 912-4811 22 Mar. (81) 4 Wed..JO 39 19 27 Feb. (58) 2 Mon.. 145-3605 796-0169 22 Mar. (81) 5 Thur. 6 51 28 18 Mar. (77) 1 Sun. 180-0429 739.0103 21 Mar. (81) 6 Fri. . 13 3 37 6 Mar. (66) 6 Thur, . 55-7657 579-2544 21 Mar. (80) O Sat. 19 15 46 23 Feb. (54) 2 Mon. 9931-4886 426-4986 22 Mar. (81) 2 Mon.. 1 27 65 11 Mar. (73) 1 Sun.. 9966-1709 382-4919 22 Mar. (81) 3 Tues. . 1 7 40 4 3 Mar. (62) 9841-8938 209-7360 21 Mar, (81) 4 Wed.. 13 52 1321 Feb. (52) 3 Tues.. 66-2487 93-2717 21 Mar. (80) 5 Thur... 20 4 22 11 Mar. (70) 2 Mon. 90-8310 29-2851 22 Mar. (81) 28 Feb. (59) 6 Fri.. 9966-6638 878-5093 22 Mar. (81) 1 Sun. . 8 28 40 19 Mar. (78) 5 Thur. . 1-3372 812-5027 21 Mar. (81) 2 Mon.. 14 40 49 8 Mar. (68) 3 Tues. 1 215-6911 006-0384 21 Mar. (80) 3 Tues. . 20 52 68 25 Feb. (66) 0 Sat.. 91-4139 643-2825 22 Mar. (81) 6 Thur. . 38 616 Mar. (75) 6 Fri. . 1260963 479-2769 22 Mar. (81) 8 Fri.. 17 15 5 Mar (64) 8 Tues. 1.8192 326-5199 217-8372 4073 268-0475 4074 240-0622 4076 209-2390 4076 260-6494 4077 229-7261 4078 198-9029 4079 250-2134 4080 222-1279 4081 273-43834082 242-6161 4083 214-5298 4084 265-8401 4085 235-0169 4086 204-1937 4087 255-5042 4088 224-6809 4089 196-5954 4090 247-9069 217.0828 4092 268-3931 4093 240-3077 4004 209.4845 4095 260-7950 4096 229-9717 4097 5 Thur. tt See "Remarks" on page preceding the Teble. z 2
Page #191
--------------------------------------------------------------------------
________________ 164 EPIGRAPHIA INDICA. [VOL. XVII TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Chaitradi Vikrama. Intercalated (adhika) and suppressed (kshaya) true lunar months. Meshadi solar year in Bengal. Kollam. A. D. Southern system. Northern system. 4098 1054 1033 4099 4100 1056 1067 4101 403 171-72 404 172-73 406 173-74 406174-75 407 175-76 408 176-77 409 177-78 410 178-79 4102 1058 4103 1059 4104 1060 1061 4105 4106 1062 411 179-80 4107 180-81 1063 1064 4108 4109 1065 412 413 414 415 416 4110 1066 1067 *996-97 30 Durmukha . 32 Vilamba . 2 Vaisakha . 997-98 31 Hemalambs. 33 Vikarin 998-99 32 Vilamba . 34 Sarvarin .6 Bhadrapada 999-1000 33 Vikarin 35 Plavs . . *1000-01 34 Sarvarin 36 Subhakrit . 1001-02 36 Plava 37 Sobhana .6 Sravanat . 1002-03 36 Subhakrit . 38 Krodhin 1003-04 37 Sobhana 39 Visvavasu *1004-05 38 Krodhin 40 Parabhava . 3 Jyeshtha . 1005-06 39 Visvivasu .41 Plavanga 2006-07 40 Parabhava 42 Kilaka. S8 Karttika 9 Masgas:(ksk.) 1007-08 41 Plavanga 43 Saumya | 1 Chaitra *1008-09 42 Kilaka. . 44 Sidhirapa . 1009-10 43 Saumya 45 Virodhakrit . 6 Sravana . 1010-11 44 Sadharana | 46 Paridhavin . 1011-12 45 Virodhakrit. 47 Pramadin *1012-13 46 Paridhavin . 48 Ananda 4 Ashadha . 1013-14 47 Pramadin 49 Rakshasa 1014-15 48 Ananda 60 Anala . . 1015-1649 Rakshasa 51 Pingala 2 Vaibakha *1016-17 50 Anala. . ! 52 Kalayukta 1017-18 61 Pingala 63 Siddharthin. Bhadra pada 1018-19 62 Kalayukta . 54 Raudra 1019-20 63 Siddharthin. 55 Durmati *1020-21 54 Raudra 56 Dundubhi . Bravanat 4111 4112 1068 417 4113 418 181-82 182-83 183-84 184-85 185-86 186-87 187-88 188-89 189-90 190-91 191-92 192-93 1069 1070 1071 1072 4115 421 4116 4117 4119 4120 SSSSSS 193-94 4121 194-95 195-96 4122 + See "Remarks" on page preceding the Tablo.
Page #192
--------------------------------------------------------------------------
________________ No. 11.] LXXXII-Contd. Day and month A. D. THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 13 SOLAR YEAR. Weekday. 14 0 Sat. 1 Sun. 3 Tues.. 4 Wed.. 5 Thur.. . . 21 Mar. (81) 21 Mar. (80) 22 Mar. (81) 22 Mar. (81) 21 Mar. (81) 22 Mar. (81) 22 Mar. (81) 22 Mar. (81) 21 Mar. (81) 22 Mar. (81) 1 Sun. 22 Mar. (81) 22 Mar. (81) 21 Mar. (81) 22 Mar. (81) 2 Mon. 3 Tues.. 4 Wed. 6 Fri. 0 Sat. 22 Mar. (81) 22 Mar. (81) 1 Sun. 21 Mar. (81) 2 Mon. . * * . Time of true Mesha-samkranti. 17 21 Mar. (81) 21 Mar. (80) 22 Mar. (81) 22 Mar. (81) 21 Mar. (81) 21 Mar. (80) 6 Fri. 22 Mar. (81) 1 Sun. 22 Mar. (81) 2 Mon.. 17 Mar. (76) 10 54 27 3 Tues.. 17 6 36 6 Mar. (65) 24 Feb. (55) 4 Wed. 23 18 45 13 Mar. (72) 6 Fri. 0 Sat. 5 30 54 11 43 3 17 55. 1 Sun. 12 3 Mar. (62) 21 Feb. (52) 11 Mar. (71) 28 Feb. (59) 19 Mar. (78) 8 Mar. (67) 7 21 3 Tues. 4 Wed.. 6 19 30 12 31 39 5 Thur.. 6 Fri. 18 43 48 25 Feb. (56) 0 55 57 7 8 6 13 20 15 19 32 24 15 Mar. (74) 4 Mar. (63) 22 Feb. (53) 12 Mar. (72) 2 Mar (61) 21 Mar. (80) 10 Mar (69) 1 44 33 7 56 42 14 8 51 20 21 0 27 Feb. (58) COMMENCEMENT OF THE H. M. S. 15 29 24 [tsh aaau p0 . , 21 41 33 3 53 42 10 16 18 22 30 0 5 51 4 42 18 LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Day and month A. D. 19 22 Feb. (53) 12 Mar. (71) 2 Mar. (61) 21 Mar. (80) 9 Mar. (69) Feb. (58) 27 Weekday. 20 . 5 Thur.. a 3 Tues. 2 Mon. 0 Sat. 6 Fri. . 3 Tues.. 0 Sat. 23 19 24 s 25 165 0 Sat. 6 Fri. 9877-5419 173.7640 199-1484 4098 9912-2243 109-7575 251-4589 4099 126-5792 993-2933 222-3735 4100 4 Wed.. 3 Tues.. 0 Sat. 161-2616 929-2867 273-6618 4101 776-5307 242-8385 4102 36-9845 5 Thur.. 3 Tues. 0 Sat. 5 Thur.. 3 Tues. 9733-5177 251-3393 660-0664 214-7531 4103 9947-3897 559-7683 263-3257 4104 9823-1125 407-0122 232-5025 4105 37.4674 290-5480 204-4171 4106 190-2498 253-9897 4107 9947-8726 73-7855 224-9042 4108 162-2275 957-3273 196-8189 4109 196-9097 893-3146 248-1293 4110 72-6326 740-5588 217-3061 4111 107-3140 676-5522 268-6164 4112 1 Sun. 6 Fri.. 5 Thur.. 2 Mon. 1 Sun.. 5 Thur. 9983-0379 523-7962 237-7933 4113 2 Mon. 9858-7607 371-0403 206-9701 4114 1 Sun.. 258-2805 4116 9893-4431 307-0338 9769-1660 154-2779 .9983-5207 18-2031 232-5580 227-4572 4116 37-8125 199-3718 4117 973-8070 250-6823 4118 857-3427 222-5968 4110 793-3362 273-9072 4120 142-9632 640-5802 243-0840 4121 18-6860 487-8243 212-2609 4122 267-2404 Kali. 1
Page #193
--------------------------------------------------------------------------
________________ 166 EPIGRAPHIA INDICA. {VOL- XVII TABLE CONCURRENT YEAR. JovtSAMVATSARA Kali. Saka. Chaitradi Vikrama. Intercalated (adhika) and suppressed (tshaya) true lunar months. Meshidi solar year in Bengal. Kollam. A. D. Southern system. Northern system. 4123 044 428 1079 1080 4124 4125 946 1081 4126 4127 4128 4129 4130 1082 1083 1084 1085 1086 4131 4132 1088 1089 4133 4134 4135 198-97 1021-22 65 Durmati 197-98 1022-23 56 Dundubhi . 198-99 1023-2467 Rudhirodgarin 199-2001024-25 68 Raktakshs 200-01 1025-26 69 Kodhana 201-02 1026-27 60 Kshaya 202-03 1027-28 1 Prabhava . 203-04 1028-29 2 Vibhava 204-05 1029-30 3 Sukla . . 205-06 1030-31 4 Pramoda 206-07 1031-32 6 Prajapati 207-08 *1032-33 6 Angiras 208-09 1033-34 7 Srimukha 209-10 1034-35 8 Bhava. . 210-11 1035-36 9 Yuvan. 211-12 *1036-37 10 Dhatri . . 212-13 1037-38 11 Isvars . . 213-14! 1038-39 12 Bahudhanya . 214-15 13 Pramathin 215-16 1040-41 14 Vikrams 216-17 1041-42 15 Vriahs . 217-18 1012-43 16 Chitrabhanu . 218-19 1043-44 17 Subhanu 219-20 1044-46 18 Tarapa . 1045-46 12 Parthiva 57 Rudhirddgarin 68 Raktaksha . 69 Krodhana 3 Jyoahtha 60 Kshaya 1 Prabhava 10 Pausha (kah) 2 Vibhava 1 Chaitra . 3 Sukla . 1 4 Pramoda Sravana 5 Prajapati 6 Angiras 7 Srimukba 3 Jyeshtha . 8 Bhava. 9 Yuvan. . 10 Dhatri . 2 Vaibikha 11 Isvats . . 12 Behudhanya . 6 Bhadrapada 13 Pramathin . 14 Vikrams . 16 Vpisha. . 4 Ashisha 16 Chitrabbanu. 17 Subhanu 18 Tarana. 3 Jyoshtha 19 Pirthiva . 20 Vyaya. 7 Alvina 21 Sarvajit 4136 4137 4138 1094 4139 4140 1095 1096 1097 1098 4142 1090 1100 4145 1101 4146 967 1102 4147 ! 968 1103
Page #194
--------------------------------------------------------------------------
________________ No. 11.) THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM 167 LXXXII-Contd. COMMENCEMENT OF THE SOLAR YEAR. LUNI-SOLAR YRAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). KA 1 Day and month A. D. Weekday. Time of true 1 Day and Mesha-sah month A. D. kranti. Weekday. 19 20 23 24 | 25 18 13 14 H.M.S. 22 Mar. (81) 4 Wod. . 2 33 9 17 Mar. (76) 22 Mar. (81) 5 Thur.. 8 6 Mar. (65) 22 Mar. (81) Fri. 14 23 Feb. (54) 21 Mar. (81) Sat.. 21 13 Mar. (73) 22 Mar. (81) 2 Mon.. 3 3 Mar. (62) 22 Mar. (81) 3 Tues.. 33 54 21 Feb. (52) 22 Mar. (81) 4 Wed.. 46 3 12 Mar. (71) 21 Mar. (81) 6 Thur. 68 12 29 Feb. (60) 22 Mar. (81) O Sat.. 10 21 19 Mar. (78) 22 Mar. (81) 1 Sun. . 10 22 30 8 Mar. (67) 22 Mar. (81) 2 Mon.. 16 34 39 25 Feb. (56) 21 Mar. (81) 3 Tucs. 22 46 48 15 Mar. (75) 22 Mar. (81) 5 Thur.. 58 57 4 Mar. (63) 22 Mar. (81) 6 Fri.. .6 22 Feb. (53) 22 Mar. (81) O Set.. 17 23 5 13 Mar. (72) 21 Mer. (81) 1 Sun. . 23 35 24 1 Mar. (61) 22 Mar. (81) 3 Tues. 647 33 20 Mar. (79) 22 Mar. (81) 4 Wed.. 11 Mar. (88) 22 Mar. (81) 5 Thur.. 18 11 60 26 Feb. (57) 22 Mar. (82) Sat.. o 23 69 16. Mar. (76) 22 Mar. (81) 1 Sun.. 6 Mar. (65) 22 Mar. (81) 2 Mon.. 12 17 23 Feb. (54) 22 Mar. (81) 3 Tues.. 19 0 26 14 Mar. (73) 22 Mar. (82) 6 Thur. 1 12 35 3 Mar. (63) 22 Mar. (81) . 7 24 44 22 Mar. 181) 6 Fri.. 53-3685423-8178 263-3090 4:23 3 Tues. 9929-0902 271-0618 232-7480 4124 O Sat. 9804-8141 118-3068 201-9238 4125 6 Fri.. 9839-4965 54-2993 253-2353 4126 | 4 Wed. 53-8514 937-8350 225-0498 4:27 2 Mon. 268-2062 821-3708 197.0643 4128 1 Sun. : 302.8885 757-3642 248-3748 4129 5 Thur. 178-6114 604.6082 217.5517 4130 4 Wed. 1 213-2937 540-6018 268-8620 4131 1 Sun.. 89-0166 387.8457 238-0388 4132 5 Thur. 9964.7398 235-0898 207-2156 4133 4 Wed. 9999-4219 171-0833 258-5271 4134 1 Sun. 9875-1447 17-3274 227-7028 4135 6 Fri.. 89-4995 901.8631 199-6173 4136 5 Thur. . 124-1819 837-8565 250-4278 4137 2 Mon.. 9999-9048686-1006 219-6046 4133 1 Sun. . 34-5871 621-0940 271-4150 4139 5 Thur. - 9910-3100 468-3381 239-5919 4140 2 Mon.. 9786-0329 315-5822 209-7686 4141 1 Sun. 9820-7152251-5756 261.0791 4142 6 Fri.. 35-0700 785-1113 232-99364143 3 Tues. 9910-7929 982-3553 202-1704 4144 2 Mon.. 9915-4753 918-3478 253-4808 4145 O Sat. . 159-8301 801-8845 225-3953 4146 8 Fri. 194-5125 737-8780 276-7068 6 Fri.
Page #195
--------------------------------------------------------------------------
________________ 168 Kali. Saka. 2 co Chaitradi Vikrama. Meshadi solar year in Bengal. Za EPIGRAPHIA INDICA. CONCURRENT YEAR Kollam. A. D. 5 JOVIAN SAMVATSARA. Southern system. 6 . 22 Sarvadharin 1046-47 20 Vyays. 1047-48 21 Sarvajit 23 Virodhin 25 Khara 26 Nandana 27 Vijaya. 28 Jaya 29 Manmatha 30 Durmukha 4148 969 1104 453 221-22 4149 970 1105 454 222-23 4150 971 1106 455 223-24 1048-49 22 Sarvadharin. 24 Vikrita. 4151 972 1107 456 224-25 4152 973 1108 457 225-26 4153 974 1109 458 226-27 4154 975 1110 459 227-28 4155 976 1111 460 228-29 4156 977 1112 461 229-30 4157 978 1113 462 230-31 4158 979 1114 463 231-32 4159 980 1115 464 232-33 4160 981 1116 465 233-34 4161 982 1117 466 234-35 4162 983 1118 467 235-36 4163 984 1119 468 236-37 4164 985 1120 469 237-38 4165 986 1121 470 238-39 4166 987 1122 471 239-40 1064-65 38 Krodhin 4167 988 1123 472 240-41 1065-66 39 Visvavasu 4168 989 1124 473 241-42 1066-67 40 Parabhava 4169 990 1125 474 242-43 1067-68 41 Plavanga 4170 991 1126 476 243-44 *1068-69 42 Kilaka. 4171 992 1127 476 244-45 4172 993 1128 477 245-46 1049-50 23 Virodhin 1050-51 24 Vikrita. 1051-52 25 Khara. 1052-53 26 Nandana 1053-54 27 Vijaya. 1054-55 28 Jaya. 1055-56 29 Manmatha 31 Hemalamba 1056-57 30 Durmukha. 32 Vilamba 1057-58 31 Hemalamba 33 Vikarin 1058-59 32 Vilamba 34 Sarvarin 1059-60 33 Vikarin 1060-61 34 Sarvarin 1061-62 35 Plava . 1062-63 36 Subhakrit 1063-64 37 Sobhana 1069-70 43 Saumya 1070-71 44 Sadharana * .. * Northern system. * 7 35 Plava. 36 Subhakrit 37 Sobhana 38 Krodhin 39 Visvavasu 40 Parabhava 41 Plavanga 42 Kilaka. 43 Saumya 44 Sadharana 45 Virodhakrit 46 Paridhavin . . . [VOL. XVII. TABLE Intercalated (adhika) and suppressed (kshaya) true lunar months. 8 5 Sravana 3 Jyeshtha 2 Vaisakha 6 Bhadrapada :: 4 Ashadha 3 Jyeshtha 7 Asvina 5 Sravana ... 3 Jyeshtha
Page #196
--------------------------------------------------------------------------
________________ No. 11.) THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 169 LXXXII-Contd. COMMENCEMENT OF THE SOLAB YEAR. LUNI-SOLAR YEAR (MEAN SUNRISE OP CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Kali. Week Day and month A. D. Time of true Mesha-sam " kranti. Day and month, A. D. Week. day. 13 14 17 19 20 23 24 i 251 H. M. S. 4157 22 Mar. (81) O Sat.. 13 36 53 11 Mar. (70) 22 Mar. (81) 1 Sun.. 19 49 2 28 Feb. (59) 22 Mar. (82) 3 Tues.. 11 18 Mar. (78) 22 Mar. (81) 4 Wed.. 20 7 Mar. (66) 22 Mar. (81) 6 Thur.. 29 25 Feb. (56) 22 Mar. (81) 6 Fri.. 38 16 Mar. (75) 22 Mar. (82) 1 Sun.. 4 Mar. (64) 22 Mar. (81) 2 Mon.. 9 1 66 22 Feb. (63) 22 Mar. (81) 3 Tues. . 15 5 13 Mar. (72) 22 Mar. (81) 4 Wed.. 14 2 Mar. (61) 22 Mar. (82) 6 Fri.. 20 Mar. (80) 22 Mar. (81) O Sat.. 32 9 Mar. (68) 22 Mar. (81) 1 Sun.. 41 26 Feb. (57) 22 Mar. (81) 2 Mon.. 17 Mar. (76) 22 Mar. (82) 4 Wed. 8 Mar. (66) 22 Mar. (81) 8 23 Feb. (54) 22 Mar. (81) 6 Fri.. 1714 Mar. (73) 22 Mar. (81) O Sat.. 4 Mar. (63) 22 Mar. (82) 2 Mon. . 8 16 35 21 Mar. (81) 22 Mar. (81) 3 Tues. . 11 27 44 10 Mar. (69) 22 Mar. (81) 4 Wod. 17 39 63 28 Feb. (69) 22 Mar. (81) 8 Thur. 218 Mar. (77) 22 Mar. (82) O Sat.. 117 Mar. (67) 22 Mar (81) 1 Sun.. 12 16 20 28 Feb. (56) 22 Mar. (81) 2 Mon. 18 28 29 16 Mar. (75) 3 Tues. . 70-2354 585-1221 245-8826 4148 O Sat. . 9945-9581 432-3681 215-0594 4149 6 Fri. . 9980-6406 368-3596 266-3697 4150 3 Tues. . 9856-3634 215-6036 235-5466 4151 1 Sun.. 70-7183 99-1393 4152 O Sat. 105-4006 35-1328 258-7716 4153 4 Wed.. 9981-1235 882-3769 227.9483 4154 2 Mon.. 195-4783 767-9126 199-8629 4165 1 Sun.. 230-1606 -701-9061 1734 4156 5 Thur.. 105-8835 549-1501 4 Wed.. 140-5859 485-1435 1 Sun.. 16-2888 333-3876 240-8375 4159 5 Thur. . 8892-0118 179-6317 210-0142 4160 4 Wed.. 9926,6940 116-8452261-3246 4161 2 Mon.. 141-0488 999-1608 233-2391 4162 6 Fri. . 16-7716 856-4049202-4159 4163 6 Thur.. 51.45401 782-3983 253-7264 4164 3 Tues.. 265-8089 665-9341 225-6409 4168 1 Sun.. 9961-8593 565-6363 274-2135 4166 8 Thur. . 9837-6821 412-8799243-3903 4167 3 Tues. 519369 296-4157 215-3050 4168 1 Sun.. 9747-9874 198-1174 263-8776 4169 8 Fri. . 9962-3421 79-6632 235-7921 4170 4 Wod.. 176-6970 963-1888 3 Tues.. 311-3794 899-1823 209-0172 | 4172 5 Thur.
Page #197
--------------------------------------------------------------------------
________________ 170 EPIGRAPHIA INDICA. (VOL Xyn. CIRC TABLE CONCURRENT YEAR. JOVIAX SAMVATSARA. Kali. Saka. Chaitradi Vikrama. Intercalated (adhika) and suppressed (kshaya) true lunar monthe. Meshadi solar year in Bengal. Kollam. A. D. Southern system. Northern system. 478 479 1131 4178 999 1135 485 4173 994 1129 4174 995 1130 4175 4176 1132 4177 1133 1134 4179 1000 4180 1001 1136 41811002 1137 4182 1003 1138 4183 1004 1139 4184 1005 1140 4185 1006 1141 4186 1007 1142 4187 1008 1143 4188 1009 1144 4189 1010 4190 1011 1146 4191 1012 1147 4192 1148 1014 1149 4194 1015 1159 1078 1101 4196 1017 1152 4197 1018 1158 246-47 247-48 248-49 249-50 250-51 251-52 252-53 253-54 254-55 255-56 256-57 257-58 258-59 269-60 260-61 261-62 262-63 263-64 264-06 266-66 266-67 281-68 288.49 269-70 270-71 1071-72 45 Virodhakrit. 47 Pramadin 8 Karttiks. din 9 Margal: (kah) } *1072-73 46 Paridhavin . 48 Ananda 2 Vaibakha . 1073-74 47 Pramadin 49 Rakshasa 1074-75 48 Ananda 50 Analat. 6 Bhadrapada 1075-76 49 Rakshasa 52 Kalayukla 1 *1076-77 50 Anals. . 63 Siddharthin 1077-78 51 Pingala 64 Raudra. 4 Asbadha 1078-79 52 Kalayukts 65 Dymati 1079-80 63 Siddharthin. 58 Dundubhi . *1080-81 54 Raudra 57 Rudhirddgarin 3 Jydahtha 1081-82 55 Durmati 58 Raktaksha . 1082-83 56 Dundubhi . 69 Krddhana . 7 Advina. 1083-84 87 Radhirddgarin 60 Kshaya *1084-86 58 Raktaksha 1 Prabhava . 1086-86 69 Krodhana 2 Vibhava o Srivada 1086-87 60 Kshaya 3 Sukla . 1087-88 1 Prabhan 4 Pramoda . *1088-89 2 Vibhava . 0 Prajapati . Jydebtha . 1089-90 3 Bukla 6 Angiras 1090-92 4 Pramoda . 7 Srimukhe {1 8 Karttiks ( 10. Pausha (kok) 1991-92 8 Prajapati 8 Bhawe. 1 Chaitra *1092-93 6 Angira 9 Yuvan. 1993-94 7 Srimukh . 10 Dhitri. 6 admode 1094-96 8 Phiva . 11 levan. 1095-96 * Ywa. 12 Bakudhanya . 1145 496 1013 4193 498 4195 501 882 t 51 Pingala was rapprossed in tho sorth.
Page #198
--------------------------------------------------------------------------
________________ No. 11.) THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 171 LXXXII-Contd. COMMENCEMENT OF THE BOLAR YRAR. LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Wook Day and month A. D. Time of true Mesha-sam. kranti. Day and month A. D. day. Week. day. 17 19 20 23 24 28 H.M.S. 23 Mar. (82) 4 Wed. 1040 38 Mar. (64) 22 Mar. (82) 8 Thur. 16 52 47 22 Feb. (53) 22 Mar. (81) 6 Fri. :13 4 68 12 Mar. (71) 22 Mar. (81) Sat.. 19 17 8 Mar. (60) 23 Mar. (82) 2 Mon. 1 99 14 20 Mar. (79) 22 Mar. (82) 3 Tues. 174123 8 Mar. (68) 22 Mar. (81) 4 Wed. 13 63 32 26 Feb. (57) 22 Mar. (81) 6 Thur. 20 41 17 Mar. (76) 7 Mar. (66) 22 Mar. (82) 1 Sun..839 59 24 Feb. (56) 22 Mar. 2 Mon. 14 12 8 14 Mar. (73) 22 Mar. (81) 3 Tuos. 17 3 Mar. (62) 23 Mar. (82) 8 Thur. 26 22 Mar (81) 22 Mar. (82) 8 Fri.. 9 18 35 10 Me (70) 22 Mar. (81) O Sat. . 15 30 43 27 Feb. (58) 22 Mar. (81) 1 San.. 21 42 62 18 Mar. (77) 23 Mar. (82) 3 Tuce. 355 1 8 Mar. (67) 22 Mar. (82) 4 Wed. 10 7 10 26 Feb (57) 22 Mar. (81) 6 Thur. 16 19 19 16 Mar. (75) 22 Mar. (81) 6 Fri. .22 31 28 5 Mar. (64) 23 Mar. (82) 1 Sun.. . 37 | 22 Feb. (63) 22 Mar. (82) 2 Mon.. 10 48 12 Mar. (79) 22 Mar. (81) 3 Tuco. 17 7 15 1 Mar. (60) 22 Mar. (81) 4 Wod. 23 30 20 Mar. (79) 23 Mar. (89) Fri.. 8 * 13 9 Mar (68) O Sat. . 87-1093 748-4264 228-1986 4173 4 Wed. 9962-8251 593-6705 197-87064194 3 Tue 9997-5074 630-6639 248-68114176 O Set. . 9878-2309 876-9079 217-85804176 6 Fri.. 9907-9126 312-9016269-1683 4177 3 Tues. 9788-6366 160-1484238-3451 4178 1 Sun.. 9997-9904 43-6812 210-2697 4179 0 Sat.. 39-6728 079-8747 261.8702 4180 6 Thur. 247-0276 863-2103 233 4847 4181 2 Mon. 122-7604 710-4844 202-6614 1 Son.. 167-4328 646-4478 263-9719 4183 6 Thur. 33-1557 499-6919 223-1487 4184 4 Wed. 67-8380 129-6864 274-4691 1 Sun.. 9943-5609 276-9294 245-83594186 245-8358 Thur. 9819-2837 194-1735 212-8127 4 Wod. 9863-9661 60-1669 264-19314188 2 MOD. 68-3209 043-8027 | 238-0377 4189 O Sat.. 282-8768 827-2383 207-9822 4190 8 Fri. . 317-3682 768-2318 269-98274191 3 Toet. 198-0810 610-4769 228-4395 4192 0 Sat.. 68-8089 467-7200 197-8162 4193 6 Fri. . 103-4862 398-7134 248-92664194 3 Fuen. 9979-2090 840-9877 218-1035 4195 2 Mon. . 18-8914176-9509 269-4139 4196 P. . 9489-6143 14-1949 238-59074197 4185 2.2
Page #199
--------------------------------------------------------------------------
________________ 112 EPIGRAPHIA INDICA, [VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Intercalated (adhika) and suppressed (kshaya) true lunar months. Saks. Chaitradi Vikrama. Meshadi solar year in Bengal. Kollam. A. D. Southern system. Northern system. 60 4198 1019 1154 1155 4199 1020 1156 4200 4201 4202 1021 1022 271-72 272-73 273-74 274-75 275-76 1023 1157 1158 1159 4203 1024 276-77 1160 4204 4205 1025 1026 1027 1161 1162 4206 4207 1028 1163 4208 1029 1164 277-78 278-79 279-80 280-81 281-82 282-83 283-84 284-85 285-86 1096-97 10 Dhatri . . 13 Pramathin 4 Ashadha 1097-98 11 Ivars 14 Vikrama . 1098-99 12 Bahudhanya . 18 Vrisha . 1099-1100 13 Pramathin 16 Chitrabhanu . 3 Jyeshtha . *1100-01 14 Vikrama . 17 Subhanu 1101-02 15 Vrisha. . 18 Tarana . . 7 Asvina 1102-03 16 Chitrabhanu. 19 Parthiva 1103-04 17 Subhanu 20 Vyaya . . *1104-05 18 Tara a . . 21 Sarvajit 4 Ashadha . 1105-06 19 Parthiva . 22 Sarvadharin. 1106-07 20 Vyaya . . 23 Virodhin 1107-08 21 Sarvajit 24 Vikrita . 3 Jyeshtha . *1108-09 22 Sarvadharin. 25 Khara . 8 Karttika 1109-10 23 Virodhin 26 Nandana 10 Pausha (kah) 112 Phalguna 1110-11 24 Vikrita . . 27 Vijaya : 1111-12 25 Khara . 28 Jaya *1112-13 26 Nandana 29 Manmatha Sravana : 1113-14 27 Vijaya. 30 Durmukha . 1114-15 28 Jaya . . 31 Hemalamba 1115-16 29 Manmatha 32 Vilamba 4 Ashadha *1116-17 30 Durmukha . 33 Vikarin 1117-18 31 Hemalamba . 34 Barvarin 1118-19 32 Vilamba 35 Plava . 2 Vaisakha . 1119-20 33 Vikarin . 36 Subhaksit *1120-21 84 Sarvarin 37 Sobhana 6 Bhadrapada 286-87 4214 4209 1030 1165 4210 1031 1166 4211 1032 1167 4212 1033 1168 4213 1034 1169 1035 1170 4215 1036 1037 1172 1038 1173 4218 1039 4219 1040 1175 4220 1041 1176 4221 1042 1177 4222 1043 1178 1171 4216 4217 1174 287-88 288-89 289-90 290-91 291-92 292-93 293-94 294-95 295-96
Page #200
--------------------------------------------------------------------------
________________ No. 11.) THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 178 LXXXII-Contd. COMMENCEMENT OF THE SOLAR YEAR. LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA I ENDS). Kali. Day and month A. D. Weekday. Time of true Mesha-sam-1 Day and krinti. month A. D. Weekday. 13 17 19 20 23 24 25 1 907-7307 210-50524198 843-7242 261-81574199 690-9683 574-5038 474-2057 321-4497 230-9925 4200 202-8848 4201 251-4575 | 4202 20-6342 4203 257-4432 271-9446 4204 140-9788243-85924205 988-2229 213-0361 4206 924-2154 264-3464 4207 807-7521 236-2010 4208 22 Mar. (82) 22 Mar. (81) 23 Mar. (82) 23 Mar. (82) 22 Mar. (82) 22 Mar. (81) 23 Mar. (82) 23 Mar. (82) 22 Mar. (82) 22 Mar. (81) 23 Mar. (82) 23 Mar. (82) 22 Mar. (82) 22 Mar. (81) 23 Mar. (82) 23 Mar. (82) 22 Mar. (82) 22 Mar. (81) 23 Mar. (82) 23 Mar. (82) 22 Mar. (82) 22 Mar. (81) 23 Mar. (82) 23 Mar. (82) 22 Mar. (82) H. M. s. Sat. 11 44 22 27 Feb. (58) 1 Sun.. 17 56 31 17 Mar. (76) 3 Tues. 6 Mar. (65) 4 Wed. 49 | 24 Feb. (55) 5 Thur. 12 32 58 13 Mar. (73) 6 Fri.. 18 45 7 2 Mar. (61) 1 Sun..10 57 16 21 Mar. (80) 2 Mon.. 7 9 25 11 Mar. (70) 3 Tues. 28 Feb. (59) 4 Wed. 19 33 43 18 Mar. (77) 6 Fri.. 45 52 8 Mar. (67) O Sat.. 7 58 123 Feb. (56) 1 Sun.. 14 10 10 15 Mar. (75) 2 Mon.. 20 22 19 4 Mar. (63) 4 Wed. 34 28 23 Mar. (82) 5 Thur. 8 46 37 12 Mar. (71) 6 Fri.. 14 58 46 1 Mar. (61) O Sat.. 21 10 55 20 Mar. (79) 2 Mon. . 3 23 4 Mar. (68) 3 Tues. 35 13 27 Feb. (58) 4 Wed. 15 22 17 Mar. (77) 5 Thur. 6 Mar. (65) O Sat.. 11 40 23 Feb. (54) 1 Sun.. 10 23 49 14 Mar. (73) 2 Mon. . 16 35 58 2 Mar. (62) 4 Wed. 103-9691 3 Tues. 138-6515 0 Sat. . 14-3744 5 Thur. 228.7291 3 Tues. 9924-7795 O Sat.. 9800-5024 6 Fri. . 9835-1847 4 Wed. 49-5396 1 Sun.. 9925-2624 O Sat. . 9959-9448 5 Thur. 174-2996 2 Mon.. 50-0225 1 Sun.. 84.7048 5 Thur. 9960-4277 4 Wed. 9993-1101 1 Sun.. 9870-8330 6 Fri.. 185-1877 5 Thur. 119-8701 2 Mon.. 9995-5930 O Sat.. 209-9478 6 Fri. 244-6302 3 Tues. 120-3530 O Sat. . 9996-0759 6 Fri. . 30-7582 3 Tues. 9906-4811 205-43874209 256-7483 4210 225-9250 4211 Ved. 2 654-9962 590-9896. 438-2337 374-2271 221.4712 105.0069 41-0004 888-3444 771-7891 707-7736 555-0176 402-2617 338-2552 185-4993 277 2334 4212 246-4122 4213 218-3269 4214 269-6373 4215 238-8140 4216 210-7286 | 4217 202-0301 4218 231-2158 4219 200-3925 | 4220 251-7030421 220-8798 4222
Page #201
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [VOL XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Saka Chaitradi Vikrams. Intercalated (adhika) and suppressed (kahaya) true Lunar months. Meshadi solar year in Bengal. Kollam. A. D. Southern bystem. Northern system. 528 1044 1045 1179 1180 296-97 297-99 298-99 299-300 1046 1181 1047 1182 1048 1049 1183 1184 1185 4223 4224 4225 4226 4227 4228 4229 4230 4231 4232 1233 4234 4235 4236 4237 1050 1061 1186 1187 636 1052 1063 1188 1189 1054 1056 1190 1056 1191 1121-22 38 Plays . . 38 Krodhin 1122-23 36 Subhakpit 39 Visvavama 1123-24 37 88bbana 40 Parabhava | Ashadha 1124-25 38 Krodhin 41 Plavanga 1125-26 39 Visvavas 42 Kilaks. 11 6-27 40 Parabhava 43 Saumys | 3 Jyeshtha l 1127-28 41 Plavanga . Sadharapa . 1128-29 2 Klaks . . 45 Virodhakrh. 12 Phalgunat. 1129-30 43 Saumya 46 Paridhavin . 1130-31 44 Sadharapa . 47 Pramidin . 1131-32 45 Virodhakrit. 48 Ananda 5 Brivasa *1132-33 46 Paridhivin . 49 Raksasa 1133-34 47 Pramadin 50 Anala. . 1134-35 48 Ananda 51 Ptogals 4 Ashadhs 1135-36 49 Rakshas 52 Kalayukta *1136-37 50 Anale. . 58 Siddharthin. 1187-38 51 Pingala 04 Raudra 2 Vaibakha , 1138-39 52 Kalayukta 68 Durmati 1139-40 63 Siddharthin 56 Dundubhi Bhadrapada 1140-41 54 Raudrs 57 Rudhirddgarin 1141-4285 Durmati 56 Raktaksha 1142-48 56 Dundubhi . 19 Krodhana | Ashadha 1143-44 67 Rudhirddgarin 60 Kshays 1144-45 68 Raktakata . 1 Prabhas 1148-48 59 Kiddhane . 2 Vibhavs . 3 Jytatha . 1057 1192 1058 301-02 302-03 303-04 304-05 305-06 306-07 307-08 308-09 309-10 310-11 311-12 312-13 813-14 314-15 315-18 816-17 817-18 818-19 319-20 380-81 1193 4238 1059 1195 4239 1240 4241 1060 1061 1082 1196 1063 1107 1198 1199 1200 1084 1065 1066 4244 4245 4246 1847 1087 2018 Seo "Remarks" on page prooeding the Table.
Page #202
--------------------------------------------------------------------------
________________ No, 11.) THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. LXXXII-Conech COMMENCEMENT OF THE BOLAB YEAR. LUNI-BOLAR YMAR (MRAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA I ENDS) Kell. Day and month A. D. Weekday. Time of true Meshs-sam kranti. Day and month A. D. Week day. 20 23 24 26 1 13 14 17 1 19 H. M. 8. 22 Mar. (81) 3 Tues. 22 48 7 21 Mar. (80) 23 Mar. (82) 8 Thur. 16 | 11 Mar. (70) 23 Mar. (82) 6 Fri. 25 28 Feb. (69) 22 Mar. (82) Sat.. 17 34 18 Mar. (78) 22 Mar. (81) 1 Sun., 23 36 43 8 Mar. (67) 23 Mar. (82) 3 Tues. 548 62 25 Feb. (56) 23 Mar. (82) 4 Wed. 12 11 16 Mar. (74) 22 Mar. (82) B Thur. 18 13 10 3 Mar. (63) 23 Mar. (82) O Sat.. o 19 22 Mar. (81) 28 Mar. (82) 1 Sun.. 6 37 27 12 Mar. (71) 23 Mar. (82) 2 Mon.. 12 2 Mar. (61) 22 Mar. (82) 3 Tues. 19 45 20 Mar. (80) 23 Mar. (82) 5 Thur. 1 84 9 Mar. (68) 23 Mar. (82) 6 Fri.. 7 26 3 26 Feb. (67) 23 Mar. (82) 0 Sat.. 13 12 17 Mar. (76) 22 Mar. (82) 1 Sun.. 19 21 6 Nar. (65) 23 Mar. (82) Tues. 30 22 Feb. (53) 23 Mar. (82) | 4 Wed. 14 39 13 Mar. (72) 23 Mar. (82) 6 Thur. . 14 26 48 3 Mar. (62) 22 Mar. (82) 6 Fri. . 20 28 57 21 Mar. (81) 23 Mar. (82) 1 Sun.. 2 61 8 11 Mar. (70) 13 Mar. (82) 2 Mon.. 9 3 15 28 Feb. (59) 23 Mar. (8 3 Tues. 15 16 24 19 Mar. (78) 22 Mar. (82) 4 Wed. 21 27 33 7 Mar. (67) 23 Mar. (82) Fri. . 3 39 24 Yob. (56) 2 Mon.. 99411636 O Sat.. 155-6183 4 Wod. 31-2411 3 Tues. 65-9236 1 Sun.. 280-2784 5 Thur. 156-0012 3 Tues. 98620616 0 Sat.. 9727-7745 6 Fri. .9762-4568 4 Wed. 9976-8117 2 Mon.. 191.1666 1 Sun. 225-8489 5 Thur. 101-5717 2 Mon.. 9977-2946 1 Sun.. 11.9770 5 Thur. 9887-8999 2 Mon. 9763-4226 1 Sun.. 9798-1060 8 Fri.. 12-4599 6 Thur. 47.1422 3 Tues. 261.4971 O Sat.. 137-2199 8 Pui.. 171.9024 3 Puer. 47.6261 O Sat. . 9923-3480 121-4928 272-1902 4223 5-0284 244-1047 4224 852-2724 213-2826 4225 788-2660 264.5920 4226 871-8016 236-5066 4227 519-0457 206-6833 4228 418-7476 254-2560 4229 265-9916 223-4328 4230 201-9851 274-7482 4231 85-6207246-6677 4232 969-0564 218-6724 4233 905-0499 269-8828 4234 752-2989 239-06981235 599-6380 208-2363 4230 585-8314 269-5468 1987 389-7755 228-7238 1238 280-1095 197-9004 166-0130 249-9108 40-8488 221-1263 1241 986-5422 272-4868 860-0770 244-3603 716-3219 214-6272 1944 662-3154 264-8375 5945 490-5895 234-0143 846-9035 203-1911 1947 239
Page #203
--------------------------------------------------------------------------
________________ 176 EPIGRAPHIA INDICA. (VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Saka. Chaitradi Vikrama, Intercalated (adhika) and suppressed (kshaya) true lunar months. Meshadi solar year Kollam. A. D. in Bengal. Southern system. Northern system. 18 553 554 557 1075 1078 1211 561 4248 1069 1204 4249 10701205 4250 | 1071 1206 4251 1072 1207 4252 1073 1208 4253 1209 4254 1210 4255 4256 4257 4258 1214 4259 1080 4260 1081 1216 4261 1082 1217 4262 1083 1218 4263 1219 4264 1085 1220 4265 1086 1221 1078 1079 1215 321-22 1146-47 60 Kshaya 3 Sukla. 8 Karttika 322-23 1147-48 1 Prabhava . ,4 Pramoda 39 Margas: (kah) 112 Phalguna 323-24 *1148-49 2 Vibhava 5 Prajapati 324-25 1149-50 3 Sukla . 6 Angiras - . 325-26 1150-51 4 Pramoda 7 Srimukha 5 Sravana 326-27 1151-52 5 Prajapati 8 Bhiva . . 327-28 *1152-53 6 Angiras 9 Yuvan. . 328-29 1153-54 7 Srimukha 10 Dhatri. 4 Ashadha 329-30 1154-65 8 Bhiva. . 11 Isvara. . 330-31 1155-56 9 Yuvan. . 12 Bahudhanya . 331-32 *1156-57 10 Dhatri . 13 Pramathin 2 Vaisakha 332-33 1157-58 11 Tavara. O 14 Vikrama l 333-34 1158-59 12 Bahudhanys. 15 Vrisha . . 8 Bhadrapada 334-35 1159-60 13 Pramathin 16 Chitrabhanut 335-36 *1160-61 14 Vikrama 18 Tarana. 336-37 1161-62 | 15 Vrisha . . 19 Parthiva . 4 Ashadha 337-38 1162-63 16 Chitrabham . 20 Vyaya. 338-39 1163-64 17 Subhanu 21 Sarvajit 339-40 ! *1164-65 18 Tarana. . 22 Sarvadharin. 3 Jyeshtha 340-41 1165-66 19 Parthi . 23 Virddhin | 7 Asvina 341-42 1166-67 20 Vyaya . . 24 Vikrita . (10 Pauska (kah) 112 Phalguna 342-43 1167-68 21 Satvajit 25 Khara . 343-44 *1168-69 | 22 Sarvadhirin. 28 Nandana 344-45 1109-70 23 Virodhin | 27 Vijaya . . 5 Sravana 345-46 1170-71 24 Vikrita . . 28 Jaya . . 567 1084 568 1087 1222 4266 4267 1088 4268 1089 1224 4269 4270 4271 4272 1090 1091 1092 1225 1226 1633 1 17 Subhanu was rappressed in the arth.
Page #204
--------------------------------------------------------------------------
________________ No. 11.1 THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 177 LXXXII-Contd. COMMENCEMENT OF THE BOLAB YEAB. LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA BUELA I ENDS). Kali Day and month A. D. Time of true Mesha-sam kranti. Weekday. Week Day and month A. D. day. 20 23 24 25 254-5016 4248 223-6783 4249 274-9887 4250 246-9033 218-61804252 4231 270 1283 4253 1 Sun.. 239-3051 208-4819 4254 42.35 4258 257-0546 13 14 17 19 H.M.S. 9 51 51 15 Mar. (74) 23 Mar. (82) 1 Sun.. 16 4 0 4 Mar. (63) 22 Mar. (82) 22 Mar. (82) 23 Mar. (82) 4 Wed. 4 28 18 12 Mar. (71) 23 Mar. (82) 6 Thur. 10 40 27 2 Mar. (61) 23 Mar. (82) 8 Fri. . 16 62 36 21 Mar. (80) 22 Mar. (82) Sat.. 23 9 Mar. (69) 23 Mar. (82) 2 Mon. . 5 16 54 26 Feb. (57) 23 Mar. (82) 3 Tues. 11 29 3 16 Mar. (75) 23 Mar. (82) 4 Wed. 17 41 12 6 Mar. (65) 22 Mar. (82) 6 Thur. 23 63 21 23 Feb. (54) 23 Mar. (82) O Sat.. 6 30 13 Mar. (72) 23 Mar. (82) 1 Sun.. 3 Mar. (62) 2 Mon. 48 22 Mar. (81) 4 Wed. 41 57 10 Mar. (70) 23 Mar. (82) 0 Thur. 6 27 Feb. (58) 23 Mar. (82) 6 Fri.. 13 6 15 18 Mar. (77) 23 Mar. (82) O Sat.. 247 Mar. (66) 23 Mar. (83) 2 Mon. 1 30 33 25 Feb. (56) 23 Mar. (82) 3 Tues 7 42 42 15 Mar. (74) 23 Mar. (82) 4 Wed. 13 54 514 Mar. (63) 23 Mar. (82) 5 Thur. 20 7 0 23 Mar. (82) 23 Mar. (83) O Sat.. | 2 19 9 12 Mar. (72) 23 Mar. (82) 1 Sun. 8 31 18 1 Mar. (60) 23 Mar. (82) 2 Mon. 14 43 27 20 Mar. (79) 4 Wed. 8 Fri.. 9958-0304 282-7970 3 Tues. 9833-7532 129-0410 2 Mon.. 9868-4356 66-0346 O Sat... 82.7905 949-6702 5 Thur. 297-1453 833-1059 4 Wed. 331.8276 769-0994 207-5505 616-3435 5 Thur. 83-2734 463-5875 3 Tues. 9779-3237 363-2894 1 Sun. 9993-6786 246-8250 5 Thur. 9869-4024 94-0691 9904.0838 30-0625 2 Mon. 118.4386 913-5983 1 Sun. 153-1210849-5918 5 Thur. 28-8139 696-8358 2 Mon.. 9904-5667 544-0799 1 Sun. 9939-2491 480-0733 5 Thur. 9814-9719 327-3173 3 Tues. 29-3268 210-8530 2 Mon. 64-0091 146-8465 6 Fri.. 9939.7320 994-0906 6 Thur. 9974-4144 930-0840 3 Tues. 188-7692 813-6198 O Sat.. 64-4920 660-8638 8 Fri. 99-1744 696-8673 23 Mar. (82) 23 Mar. 228-9691 4257 198-1458 4253 249-4563 4239 221-3709 4260 272-68134261 241-85814262 211-03494253 262-3454 4264 2315221 | 4265 203-43664206 255-7471 4267 223.239 4268 275-23434269 247.1488 4270 216-3257 4271 267-6361 1273 2 v
Page #205
--------------------------------------------------------------------------
________________ 178 EPIGRAPHIA INDICA. [VOL. XVII TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Saka. Chaitradi Vikrama. Intercalated (adhika) and suppressed (kshaya) true lunar months. Moshadi solar year in Bengal. Kollam. A. D. Southern systom. Northern system. 60 4273 1004 1229 578 1095 1230 g 4274 4275 1096 1231 4276 1097 1232 1098 1233 o 4277 4278 1099 1234 1235 4279 | 1100 42801101 1236 1237 1238 1103 587 4283 1239 1240 1106 1241 4281 1102 4282 1104 4284 1105 4285 4286 1107 4237 1108 4288 1109 4289! 1110 4290 m 4291 1112 346-47 347.48 348-49 340-50 350-51 351-52 352-53 353-54 354-55 355-56 356-57 357.58 358-59 359-60 360-61 361-62 362-63 363-64 364-65 366-66 386-67 367-68 368 69 369-90 370-71 1171-72 25 Khara, 29 Manmatha . *1172-73 26 Nandans 30 Durmukha . 4 Ashadha . 1173-74 27 Vijaya . . 31 Hemalamba 1174-75 28 Jaya 32 Vilamba 1176-76 29 Manmatba. 33 Vikarin 2 Vaibakha . *1176-77 30 Durmukha 34 Sarvarin 1177-78 31 Hemalamba. 6 Bhadrapada 1178.79 32 Vilamba . 36 Subhaksit 1179-80 33 Vikarin 37 Sobbana *1180-81 34 Sarvarin . 38 Krodhin 4 Anhadha 1181-82 35 Plava : 39 Visvivasu 1182-83 36 Subbakrit . 40 Parabhava . 1183-84 37 Sobhana 41 Plavanga 2 Vaikakha . *1184-85 38 Krodhin 42 Kilaks . . 1183-86 39 Vilvavasu . 43 Saumya 6 Bhadrapada 1186-87 40 Parabhava . 44 Sadharana . 1187-88 41 Plavanga 45 Virddbakpit. . 1188-8942 Kilaka 46 Paridhavin . Sravans 1189-90 33 Saumys .47 Pramadin . 1190-91 44 Sadharana 48 Amanda 1191-92 45 Virddhakrit . 49 Rakabaus | 3 Uyeshtha *1192-93 46 Paridhavin . 30 Anale, . 1193-94 47 Pramadin . 01 Plogela 1194-96 48 Ananda 52 Kalayakta . 2 Vaisakha 1195-96 40 Rakahan 33 Siddhartbla. 1242 1243 1244 1245 1246 1247 4292 1113 1248 4293 1249 1250 1994 1115 1116 1251 4298 4297 1263 602
Page #206
--------------------------------------------------------------------------
________________ No. 11.) THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 179 LXXXII-Contd. COMMENCEMENT OF THE SOLAR YEAR. LUNI-SOLAR YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA ECKLA 1 ENDS). kali, Day and month A. D. Weekday. Time of true Mesha-sam 1 Day and kranti. " month A. D. Week 1 day. 13 20 23 24 25 444.1013 291-3454 227-3389 236-8129 4273 205.9896 4274 257-3001 4273 229-2147 4275 198-1914 4277 249-7018 221-61644279 272-9269 4280 242 1036 4281 211-2801 4282 4278 110-8745 958-1187 894-1120 777-6478 713-6413 560-8853 408-1294 344.1228 191-3668 38-6109 262-5909 4283 231-7677 23 Mar. (82) 3 Tues. 20 55 36 9 Mar. (68) 23 Mar. (83) 5 Thur. 45 26 Feb. (57) 23 Mar. (82) 6 Fri.. 54 16 Mar. (75) 23 Mar. (82) O Sat.. 15 6 Mar. (66) 23 Mar. (82) 1 San.. 21 11 23 Feb. (54) 23 Mar. (83) 3 Tues. 13 Mar. (73) 23 Mar. (82) 4 Wed. 3 Mar. (62) 23 Mar. (82) 5 Thur. 20 38 22 Mar. (81) 23 Mar. (82) 6 Fri. . 32 47 11 Mar. (70) 23 Mar. (83) | 1 Sun. 56 28 Feb. (59) 23 Mar. (82) 2 Mon. 5 18 Mar. (77) 23 Mar. (82) 3 Tues. 17 9 14 7 Mar. (66) 23 Mar. (82) 4 Wed. 23 24 Feb. (55) 23 Mar. (83) 6 Fri.. 32 15 Mar. (75) 23 Mar. (82) Sat. . 11 45 41 4 Mar. (63) 23 Mar. (82) 1 Sun.. 17 67 50 23 Mar. (82) 24 Mar. (83) 3 Tues. 59 13 Mar. (72) 23 Mar. (83) 4 Wed. 8 1 Mar. (61) 23 Mar. (82) 5 Thur. 12 34 17 19 Mar. (78) 23 Mar. (82) 6 Fri.. 18 46 26 8 Mar. (67) 24 Mar. (83) 1 Sun.. 58 35 26 Feb. (57) 23 Mar (83) 2 Mon. 44 16 Mar. (76) 23 Mar. (82) 3 Tues. 13 22 53 6 Mar. (65) 23 Mar. (82) 4 Wed. 19 35 223 Feb. (54) 24 Mar. (83) 6 Fri.. 1 47 11 14 Mar. (73) 4284 z Tiev. 9974-8973 0 Sat. 9860-6201 6 Fri. . 9886-3025 4 Wed.. 99-6574 1 Sun.. 9975-3801 O Sat.. 10-0625 5 Thur. 224-4174 4 Wed. 259-0998 1 Sun.. 134-8226 5 Thur. 10-5455 4 Wod. 45-2279 1 Sun.. 9920-9307 5 Thur. 9796-6735 5 Thur. 169.9879 2 Mon. 45-7108 1 Sun . 80-3931 6 Fri.. 294-7480 170-4708 9866-5213 5 Thur. 9742-2440 3 Tues. 9056-5989 2 Mon. 9991-2813 O Sat.. 205-6364 4 Wed. 81-3589 10-8960 858-1401 794.1335 3 Tuca. 1 Sun.. 677.6693 524-9133 424-6151 271-8592 155-3949 91-3884 974-9241 822-1741 758-1608 200-9444 | 4285 254-9926 4286 224.1694 4287 275-47994289 247-3944 4283 216-57124290 265-1438 4291 234-32074292 206-2352 4293 257-5456 4294 229-4602 4293 198-6370 4296 249-9474 4297 3 Tues. 116.0413 2 B2
Page #207
--------------------------------------------------------------------------
________________ 180 EPIGRAPHIA INDICA. [Vol. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Intercalated (adhika) and suppressed (kshaya) true lunar months. Saka. Chaitradi Vikrama. Meshudi solar year Kollam. A. D. in Bengal. Southern system. Northern system. 1 los 1 Bhadrapada 4298 1119 4299 1120 4300 1121 4301 43021123 1254 1266 1256 1257 1258 371-72 372-73 373-74 374-75 375-76 1196-97 50 Anals. 64 Raudrs . 1197-98 01 Pingala 55 Durmati 1198-99 82 Kalayukta 56 Dandubhi . 1199-1200 53 Siddharthin. 57 Radhirodgarin *1200-01 64 Raudra .68 Raktaksha 1122 4 Aahadha
Page #208
--------------------------------------------------------------------------
________________ No. 11.] LXXXII-Concld. Day and month A. D. THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 13 SOLAR YEAR. Weekday. 14 23 Mar. (83) 0 Sat. 23 Mar. (82) 23 Mar. (82) 1 Sun. 2 Mon. 24 Mar. (83) 4 Wed. 23 Mar. (83) 5 Thur. . COMMENCEMENT OF THE Time of true Mesha-samkranti, 17 LUNI-SOLAB YEAR (MEAN SUNRISE OF CIVIL DAY ON WHICH CHAITRA SUKLA I ENDS). Day and month A. D. 19 H. M. S. 7 59 20 14 11 29 2 Mar. (62) 21 Mar. (80) 10 Mar. (69) 20 23 38 2 35 47 27 Feb. (58) 8 47 56 17 Mar. (77) Weekday. 20 0 Sat. 6 Fri. 3 Tues. 0 Sat. 6 Fri. . * a 23 24 0 25 181 Kali. 9991-7641 605-4056 219-1242 4298 26-4465 541-3991 270-4346 4299 9902-1094 388-6432 239-6115 4300 9777-8923 235-8872 208-7660 4301 9812-5747 171-8807 260-0765 430
Page #209
--------------------------------------------------------------------------
________________ 182 TABLE LXXXIII A. DURATION AND COLLECTIVE DURATION OF TRUE SCLAR MONTHS, WITH INCREASE OF a, b, C AT EACH TRUE SANKRINTI. By the Brahma-Siddhanta. Calculated for the year K. Y. 4500, (expired), A. D. 899-900. a in 10,000 ths of circle; b and c in 1,000 ths; "savi"-solar sainkranti. Luni-solar month (ending at the seconl of the two solar e krunts connec ted with it). Collective duration in days, hours, etc., and collectivo increase of a, b, c from true Mosha-sankranti to each true sariakranti. Length of solar month preceding onch true sankranti, and increase of a, b, c botweon cach such samkranti. At true solar satikrinti. At true solar samkranti. Day. H.M.S. Week day: H. M. S. 16 Doy. al 13 | 14 | Minn eum. (of 3 prerions year). Mosha-sam. . o 0 O 0 0 84-6833 @ 86-0023 EPIGRAPHIA INDICA. @@ @@@@ (Vrishabha-sam Mithuna sam. Karkasah.. Simha sarn.. (Kanya ram.. Tula sam. . (Vrischika-sam. 86-5754 @ 86-1842 84-9821 156 @ 1. Chaitra 2. Vaibakha 3. Jyeshtha. 4. Ashadha 5. Sravapa. 6. Bhadra pada 7. Advina ( 8. Karttika . 9. Margasira .. 10- Pausha . 11. Maghal 12. Phalguna 1. Chnitra (of following year). 58 15 00000 21 474-3381 122-5490 15 57 11117956 262.5752 15 1820-1580 410-2010 42 48 2480-1360 552-6492 41 2 2991-4178679-1575 29 3304-2747 28 50 3433-4472 869-9574 0 47 3416-4906 939-8537 16 6 58 3351-2241 4.5725 2 49 93322-564473-2145 22 4 253414-5580 154.7871 6 12 9 3688-2056 255-8315 Moha-sarh. Vrishabha sath. Mithuna sam.. Karka-aam. . Simba-kath. . Kanya-sam. . Tula sam. . Vriechika-sam. Dhanus sath.. Makara sath.. Kumbha sam.. Mina-mth . Moshn-anh. (of following year). 84-6833 170-6856 257-2610 343-4452 428-4273 511-8051 593-6979 674-4092 754.7299 835-3466 918-9397 1000-0 83-3778 0 0 1 21 9 474-3881 122.6490 54 48 637-4575 140-0262 708-3624 147-6297 659-9780 142-4443 511-2818 126-6083 54 27 312-8509 105-2428 21 53 21 129. 1725 85-5571 31 67 9983-0434 69-8963 8 6 11 9934.7335 64.7188 42 11 9971-3403 68-6420 19 15 16 91.0936 81.5726 8 7 44 273-6476 101.0407 @ 81-8928 Dhanus-sam.. 80-7113 80-3207 Makara-sath.. @eeeee a @ 80-6167 Kumbha-sam. Mina-san. . Mesha-sam. (of following year). 81.5921 89-0608 (VOL. XVII. @
Page #210
--------------------------------------------------------------------------
________________ No. 11.1 THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT. SYSTEM. 183 TABLE LXXXIII B. VALUE OF C AND OF "EQUATION C" AT THE SEVERAL TRUB SAMKRINTE. Correct for K. Y. 4000, A. D. 899-900. c in 1,000cks of circle," equation c" in 10,000ths. Samkranti. "Equation c." 277-6064 Mesha-san. . Vrishabha-sat.. Mithuna-san.. 0-9037 14-4355 362-2899 448-2921 41.1356 Karks-sam. 534-8676 73-6542 102-0578 Simha-sam. Kanya-sazh. 621-0519 708-0241 . 118-5381 Tula-sath. . 789-4020 118-9561 Vrischika-san.. 871.2948 104.1144 Dhanus-car. 952-0062 78-3666 Makara-san. Kumbhs-san.. Mins-sami 32-3264 112-9432 48-2336 21-0624 3-6404 194-5358 TABLE LXXXIII C. EXACT VALUE OF C AND OP" EQUATION c" AT THE MOMENT OF TRUE MESHA-SAMKRINTI AT BEGINNING OF EACH CENTURY K. Y. o in 1,000ths of circle. "Equation o" in 10,000ths. K. Y. A. D. "Eqn.c." 3700 3800 3000 4000 4100 4200 4300 599-600 277-6399 699-700 277-6287 799-800277-6175 899-900 277-6064 999-1000 277-5952 1099-1100 277.5840 1199-1200 277-5728 0-9347 0-9340 0-9333 0-9326 0.9319 0-9312 0-9306
Page #211
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA, [VOL. XVII. TABLES LXXXIV, LXXXV. " EQUATION 6" AND "EQUATION " IN WHOLE NUMBERS BY THE BRAHMA-SIDDHANTA AND SIDDHANTA-SIROMANI. Corresponding to Tables VI, VII, "Indian Calendar." For close detail Tables LV, LVI, (Vol. XV above) are to be used. *Arg."=moon's (6) or sun's (c) mean anom. in 1000ths of circle. TABLE LXXXIV. TABLE LXXXV. LUNAR" EQUATION 6." SOLAR" EQUATION C." Eqn. Arg. Arg. Egn. Arg. Eqn. Arg. Arg. Eqn. Arg. 1401 500 490 480 500 510 520 140 131 149 1000 990 980 630 970 960 1000 990 980 970 960 950 940 930 920 910 900 890 880 870 860 850 360 850 350 340 660 670 840 920 830 680 310 300 690 700 117 116 810 800 710 810 800 790 780 770 760 760 290 280 270 790 7201 730 740 750 740 750 AUXILIARY TABLE. 1 8 | Difference in Equs. tion. 7 Last figure of argument 6 5 4 Add or substract 3 2 1 1000 NN NN WA: NN NN 69 PO 100 -- OOOO O
Page #212
--------------------------------------------------------------------------
________________ No. 11.] Year. TABLE LXXXVI. VALUE OF a, b, c AT BEGINNING OF CENTURIES OF THE KALIYUGA, BY THE BRAHMA-SIDDHANTA. 0 *2 3 8 *10 11 12 *13 14 20 #21 22 23 *25 Week day. 28 *29 0 2 4. 15 16 6 17 0 18 2 19 3 0 2 5 4 5 0 1 THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 3 5 6 K.Y. Begin-Week Cen- ning in tury. A.D. day. 37 38 39 599 699 799 899 999 42 1099 43 1199 40 41 0 3600-6747 7201-3494 1140-6560 4741-3307 8342-0054 1942-6800 5881-9867 9482-6614 3083-3360 6684-0107 623-3174 4223-9921 7824-6667 1763-9734 5364-6481 8965-3227 2565-9974 6505-3041 105-9788 3706-6534 7307-3281 1246-6348 4847-3094 8447-9841 0 246-4522 492-9043 775-6482 22-1003 9588-6401 3189-3148 6789-9895 268-5525 515-0047 797-7485 44.2007 290-6528 537-1050 819-8488 66.3010 312-7532 595-4970 841-9492 88-4013 334-8535 617-5973 864-0495 110-5017 356-9539 639-6977 886-1499 132-6020 2048-6588 379-0542 5987-9655 661-7980 908-2502 154-7024 401-1545 OUUUU 0 TABLE LXXXVII. INCREASE OF a, b, c FOR YEARS OF KALIYUGA CENTURY. year of 366 days. Year. 6 6 6 0 a 6028-1929 4900-0921 3433-3593 2305-2584 1177-1576 49-0567 8920-9559 0 30 999-2925 31 32 998-5849 0-6151 #33 999-9076 34 998-4001 0-4303 999-7228 999-0153 1-0455 0-3379 999-6304 998-9229 45 46 47 0-9531 *48 0-2455 49 40 #41 42 43 #44 999-5380 998-8305 0-8607 0-1531 999-4456 b 999-2001 998-4925 35 2 36 3 0-5227 *37 38 999-8152 999-1077 39 719 2529 308-0530 860-5614 449-3615 38-1616 626-9616 215-7617 998-7381 55 0-7683 #56 0-0607 57 999-3532 58 998-6457 59 Weekday. 3 4 5 0 2 6 1 2 50 0 1 51 *52 53 54 282-9906 283-3962 281-0640 281-4695 6 0 2 3 281-8751 282-2807 282-6863 a 9071-3015 2671-9762 6272-6509 211-9575 3812-6322 729-2961 683-8984 0.6759 4329-9708 930-3505 999-9683 176-8027 999-2608 7930-6455 423-2549 998-5533 1531-3202 5470-6268 705-9987 0-5835 221-0034 7413-3069 1013-9815 467-4555 4953-2882 750-1994 8553-9629 2154-6376 3295-2936 6895-9682 835-2749 6093-9442 525-8475 9694-6189 772-2997 18-7519 265-2040 547-9479 952-4509 999-8759 198-9030 999-1684 445-3552 998-4609 728-0990 0-4911 974-5512 999-7836 2777-9549 6378-6296 317-9363 3918-6110 7519-2856 C 4435-9496 794-4000 8036-6243 40-8522 287-3044 1637-2989 5576-6056 570-0482 9177-2803 816-5004 185 996-6515 999-6912 243-1037 998-9836 62-9526 309-4047 592-1485 838-6007 85-0529 999-0760 998-3685 0-3987 1-0138 0-3063 999-5988 998-8912 0-9214 0-2139 999-5064 998-7988 0-8290 0-1215 999-4140 998-7064 0-7366 0-0291 999-3216 2 c
Page #213
--------------------------------------------------------------------------
________________ 186 EPIGRAPHIA INDICA. [Vol. XVII. TABLE LXXXVIII. TABLE LXXXVII-Contd.. VALUES OF a, b, O PER DAY FROM MINA I TO MESHA 2, THE DAY OF MEAN MESIA-SAKRANTI. Weekday. No. of days 1 interval from O Mesha. Month Week. and day.day. 1 2 11119-9603 331-5051 5059-2670 614.2489 8659-9416860-7011 2260-6163 107-1532 5861-2910353-6054 998-6140 0-6442 999-9367 999-2292 998-5216 9800-5977 636-3492 0-5518 3401-2723 882-8014999-8443 7001-9470 129-2536 999.1368 602-6217375-7057 998-4292 45419283 658-4496 0-4594 Mins 1 4 9502-4085 874-9589 2 6 . 9841.0404 911.2506 361 179-6724947-5422 410 518-3044 983-8339 611 856-9364 20-1255 915-1286 917-8664 920-6042 923.3419 926-0797 3 8142-6030 1743-2777 5682-5844 9283-2590 2883-9337 904.9017999-7519 151-3539 999.0444 434-0977 1.0746 680-5499 0-3670 927.0021 999-6595 2 3 Eva 1195.5684 1534.2004 1872-8324 2211-4843 2550-1983 56-4172 928-8175 92.7088931.5853 129.0005934.2931 165-2921937.0309 201-5838 939-7687 3 6484.6084 173-4542 998-9520 5 423-9150 456-1981 0-9822 61 4024-5897 702-6502 0-2746 7625-2644 949-1024 999-5671 1225-9391195-5546998-8596 110 2888-7283 3227-3603 3565-9923 3904-6243 4243-2563 237-8764 942.5065 274-1671 945-2442 310-4587 947-9820 346-7504 950-7198 383-04201 953-4576 5165-2457 478-2984 8765-9204724.7506 2366-5951 971-2027 5967-2698217-6549 9906-5764 500-3987 0-8898 0-1822 999.4747 998-7672 0-7974 165 161109. 18 19 0 1 4581-8882419-3336956-1954 4920-6202 455-6263 958-9332 5259-1522491-9169 961-6710 5697-7842528-2086964-4088 6936-4162664-5002 9671466 3507-2511746-8509 7107-9258993-3031 708-6004 239-7552 4647.9071522-4991 8248-5818 768-9512 0-0898 999-3823 998-6748 0-7050 999.9974 6275-0482 6613-6801 6952-3121 7290-9441 7629-5761 600-7919 969-8843 637-0835 972-6221 673-3752 975-3599 709-6668 978-0977 745-9585980-8365 1849-2565 16-4034999-2899 6449-93112618556998-5824 9389-2378 644-5994 0-6126 2989-91257910516999-9050 6590-5871 37-5038 999-1975 0 7968-2081 782.2501 983-6733 8306-8401818-5418986-3111 8645-4721 854-8334 989-0488 8984.1040 891.1251 991.7866 1912618 283-9559 4130-5685566-6997 7731-2431813-1519 1331-9178 59-6041 4932-5925 306-0563 998-4900 0-5202 999-8126 999.1051 998-3976 Mosha 0 5 8 9322.7360927-4167 9661-3680 963.7084 994.5244 997-2622 1 0 || 8871-8992 588-8001 0-4278
Page #214
--------------------------------------------------------------------------
________________ No. 11.) THE BRAHMA-SIDDHANTA: TRUE, OR APPARENT, SYSTEM. 187 TABLE LXXXIX. SUN'S EQUATION OF THE CENTRE AND SINE-VALUES ACCORDING TO THE BRAHMA-SIDDHINTA. SINE OF ANOM. ANGLE. EQUATION. Serial Serial No. of sine. Sun's MEAN ANOM. Value Sun's MEAN ANOM Diff. Equation. Difference per minute of anom. sine, minutes. 2.2760 2.2458 2.2128 2.1822 1051 1261 2.1287 0 0 0 08 32-50 0 17 2-61 25 27-92 46-05 0 41 57-02 049 66-97 067 42-97 5 15-60 1 12 31-46 1 19 28-17 3-32 16-92 8-98 32-27 2.0756 2-0117 1636 1-9372 1.8520 1.7562 1.6604 2312 1.5646 1-4869 2459 2594 2719 1-3305 31-62 1.2028 1-0760 2933 0-9367 3021 0-7982 3096 0-6706 3189 1 63 2-24 57 4-12 9 034-87 2 3 34-49 26 6-36 2 8 1.99 % 24.14 2 10 14-43 2 10 31-19 0-5184 3207 3242 0-3651 0-2236 3283 0-0745 3270
Page #215
--------------------------------------------------------------------------
________________ 188 EPIGRAPHIA INDICA. [VOL. XVII. No. 12. THE KEDARPUR PLATE OF SRI-CHANDRA-DEVA. BY NALINI KANTA BHATTASALI, M.A., CURATOR, DACCA MUSEUM. In the October number of the Dacca Review, for 1912, Mr. J. T. Rankin, I.C.S., published a note given him by the late lamented scholar Babu Gangamohan Laskar, M.A., on a copperplate inscription of Sri-Chandra-Deva found at Idilpur in the Faridpur District of Bengal. This note for the first time established the fact that a Buddhist line of kings with the suffix "Chandra" at the end of their names had ruled in East Bengal with Vikramapura as their capital about the 10th or 11th century of the Christian Era and votaries of antiquarian studies in Bengal have been busy thenceforth, discussing the position of the Chandra kings of Vikramapura in the chronology of their country. The discovery of a second copper-plate of SriChandra-Deva at Rampal in the Munshiganj sub-division of the Dacca District in April, 1913, by Prof. Radha-Govinda Basak, M.A., ga e a further impetus to the discussion. Prof. Basak published this plate first in the Sravanu and Bhadra number of the vernacular magazine Sahitya for 1320 B.S. and finally in the Epigraphia Indica, above, Vol. XII, page 136. The present plate is the third of Sri-Chandra-Deva. It was found in April, 1919, in excavating earth from a ditch at Kedarpur in the Madaripur sub-division of the Faridpur District of Bengal. It was preserved in the custody of the second teacher of the Kedarpur Middle English School. I came to know of the find from a friend and it has been obtained for the Dacca Museum by the Hon'ble Mr. T. Emerson, C.I.E., I.C.S., through the kind efforts of Mr. J. N. Roy, I.C.S., Magistrate of Faridpur, and Mr. N. Sen, Sub-Divisional Officer of Madaripur. The plate measures 8" x 7", and is therefore slightly smaller than the plate published by Mr. Basak, which measures 94" x 8". The Royal Seal of the Chandras is attached to the middle of the top of the plate. It displays the Wheel of the Law with two couchant deer on the two sides, symbolical of the first "Turning of the Wheel of the Law" at the Deer Park,-the present Sarnath near Benares. It is noteworthy that the Palas of Bengal who preceded the Chandras, and who were Buddhists as well, had similar devices on their seals. The name of Sri SriChandra-Deva[b] is written in relief below the Wheel in the present seal. The plate is incomplete and appears to be no grant at all, but only a plate kept ready, with the stereotyped portion of the grant inscribed in the office of issue, to be filled in with the necessary remaining portions as occasion arose. The plate is full of engraver's mistakes of a serious nature. It may be noted that Kadarpur, where this plate was found, contains the ruins of a royal settlement surrounded by a broad ditch as well as a big silted up tank, commonly associated with the memory of Kedar Ray, one of the famous twelve chieftains who ruled Bengal before the country was completely dominated by the Mughals. Kedar Ray had his capital at Sripur, which, from the description of Ralph Fitch, appears to have been a flourishing town in 1585; and the reasonableness of having a second capital, only a few miles off, is not very apparent. Of course a thousand and one contingencies might have taken the present plate to Kedarpur, where it has now been found, but the find of this unfinished plate also makes it possible that the ruins at Kedarpur may be those of the Chandras who preceded Kedar Ray by no less than five hundred years. The plate is inscribed on one side only and there is a vacant space of about two inches at the bottom. The inscription contains 18 lines of writing. The letters are 24 to 30 inch in height and are in most places well inscribed. Mistakes of engraver or scribe are, however,
Page #216
--------------------------------------------------------------------------
________________ No. 12.] THE KEDARPUR PLATE OF SRI-CHANDRA-DEVA. 189 numerous and they have rendered the preparation of a correct text an undertaking of exceptional difficulty. The inscription refers to the reign of Sri-Chandra-Deva of the Chandra family of Kings who held sovereignty in East Bengal for some decades before the rise of the Varmans and the Senas in that part of the country, towards the end of the Pala role in North Bengal. It is written in what may be called the Bengali Script of the 10th-11th century A.D. The language of the inscription is correct Sanskrit verse, except in the portions spoiled by engraver's mistakes. The last three lines are in prose. There is nothing very special as regards orthography. The use of va for ba is almost the rule in the later East Indian epigraphs, there being no discrimination between them, as in the modern Bengali language. The avagraha is once used and once omitted. The spelling of the word nistringa with ri is remarkable. Superimposed has doubled almost all consonants. From a comparison of the abstract of the Idilpar plate of Sri-Chandra published in the Dacca Review, referred to above, with the contents of the present plate, it is evident that the two plates are copies of the same draft, The Idilpur plate seems to have an extra Sloka towards the end, borrowed from Sri-Chandra's Rampal plate, which is otherwise the copy of a draft different from that of the Idilpar and the Kedarpur plutes. It should be noted, however, that the opening invocatory Sloka is identical in all the three plates. Sri-Chandra seems to have been the only king of the Chandra family who was powerful enough to issue copper-plate grants, as the three plates hitherto discovered are all in his name. In order, therefore, to bring together all the epigraphical material available for his history. I quote below the necessary portions from Babu Gangamohan Laskar's abstract of the Idilpur plate, as published in the Dacca Review. The plate is reported to exist still; but it is in the custody of people who are unwilling to show it to anybody again. "The inscription gives the names of three kings :-(1) Suvarnna-Chandra. (2) His son Trailokya-Chandra. (3) Trailokya-Chandra's son (Sri)-Chandra.Devs. The last of these kings issues & command from his victorious camp at Vikrampur making a gift of certain lands at the village called Leliya in the Kumaratala ka sub-division (mandala) of the Satata-Padm.vati district (vishaya). The name Satata-Pad mavati literally means 'with-bank-Padma-house and was most probably the name of a district on the banks of the Padma river. The names of some of the donees are still legible and the measures of the area of the granted lands are called dronas and patakas, as in the Asrafpur plates. Paramount titles such as Parametvura, Paramabhattaraka and Maharajadhviraja are attached to the names of (fri)-Chandra-Deva. The title Parama-Saugata (the devout worshipper of Sugata, s.e. Buddha) is prefixed to the name of the donor. The characters ased are probably of the 12th century type of the Bengali alphabet. The seal attached to the top of the plate resembles the seals found on the plates of the Pala king of Bengal. The inscription under notice is very important, as it, like the Asrafpur plates of Devakhadga, shows the existence of Buddhist kingdoms in East Bengal in the period not much anterior to the conquest of Bengal by the Mussalmans. ".. . .. The plate is inscribed on one side fully and on another side partly. The writing on the second side has become almost defaced. This defaced portion contains the names of the donee and the particulars of the lands granted. There are altogether 36 lines of writing. An analysis is given below: Lines 1-4. Contain a verse in honour of Buddha, probably. II should gratefully acknowledge here the help that I have received in this respect from Prof. Abbnyi Charan Chakravarti, M.A., of the Jagannath College, Dacca, without whose help I could hardly have made any headway, especially with the passages that are marred by the engraver's mistakes. I also owe some improvemonts in the reading of the text to the suggestions of ny friend Prof. Basak, in whose company I had the opportunity of revising my first transcription. [In this extract, the discritical inarks, aceording to the latest emendation, have been adopted.-H. K. S.]
Page #217
--------------------------------------------------------------------------
________________ 190 EPIGRAPHIA INDICA. [VOL. XVII. Lines 4-5. State that there was a king named Suvarnna-Chandra who was neither purified in fire nor measured on the scales (like gold) but was by nature endowed with greatness (heaviness) and whose deeds were good. Lines 5-6. State in a verse why the king was called Suvarnna-Chandra. Lines 6-9. The above king got a son named Trailokya-Chandra, whose look was sacred, who was afraid of the next world, by whom the living world was consoled, whose meritorious deeds were well known throughout the three worlds. Lines 9-10. Some further epithets of the same king who satisfied his desire of conquering the whole world and who extinguished the fire of his enemies. Lines 11-13. More enlogistic epithets of Trailokya-Chandra-Deva). Lines 14-15. The above king had a son named (Srt)-Chandra who was like Indrs and whose prowess was like Indra and who was born at the auspicious moment and the signs at whose birth were indicative of royal fortune. Lines 15-18. Some eulogistic epithets of (Svi)-Chandra-Deva. Lines-18-19. From the victorious camp pitched at Vikramapura, Line 20, the devout worshipper of Sagata (Buddha), the meditator of the feet of i.e. the son of) Maharajadhiraja Trailokya-Chandra-Deva, the Parametvara, the Paramabhattaraka, Line 21, the Maharajadhiraja, the Sriman, Sri-Chandra-Dava, being in good health and having done honour to all the following royal officers and villagers assembled at the village of Leliya, Line 22, in the Kumaratalaka-mandala of Satata-Padmava(ti) district, Line 28, thus commands the above officers .. Lines 29-30. Contain the names of the donees." The following is an abstract of the present Kodarpur plate: The inscription opens with a salutation to the Buddha, the Dharmma, and the Sangha,--the three jewels of the Buddhist faith. It then goes on to say that there was one Parnna-Chandra by name who was the possessor of large forces. He was neither of royal birth nor of pare caste, but he obtained a son Buvarnna-Chandra by name, resplendent as gold (v. 3). Suvarna Chandra was a famous man of religious character, and his son was Trailolya Chandra (v.4). Trailokya's conquests extended far and wide and he was a terror to his foes (v. 5). Trailokya's son was dri.Chandra who was extremely virtuous (v. 6). He was a great conqueror whose fame at arms had reached the heavens (v.7). With this last king Sri-Chandra-Deva who was to have issued this plate from his victorions capital at Sri-Vikramapura the inscription stops. I edit the inscription from the original plate, now in the Dacca Museum, Seal. * Tereza[:] TEXT. 1 mihirastu' svasti / vanyo jina: sa bhagavAn karaNekapAvaM 2 wait farga mereta: [1] AUT 1 Kuprewed by a symbol. This symbol is generally taken for oth, but the writer be put forward argumento in his article "Some Image Inscriptions from East Bengal published below in favour of this symbol being road Suddhiragatu.'-Ed.] Bend mat. * Read at.
Page #218
--------------------------------------------------------------------------
________________ No. 12.] THE KEDARPUR PLATE OF SRI-CHANDRA-DEVA. 191 3 sakala eva mahAnubhAvaH saMsArapAramupagacchati bhikSusa / [1] pUrNa4 candra iti zrImAnAsauvAsIra rajaH / yasyoSaSa yoSatva[sa]mAtapanamapatra 5 pA [2] nAmnI viNDo na tulAdhikar3haH kintu prakRtyaiva yuto rimNA / tathApi ka6 lyANasuvaraNaMkalpaH suvarNacandramuktI satIbhUt [*] puNyAvalokaH paralo7 kabhIrorlokyaH samAzAsitajoksokaH [1] vailokyasaMkIrtitapuNyakItaH vai8 lokyacandro'sya va(ba)bhUva punaH [4] catu:payorAzisamAptapRthvIjayAbhilASo vi. 9 SayeSvalubdhaH [1] yureSa nistriMzalatAvalena yo vairivarSi samayAca kAra' [5] 10 zrImAn zrIcandradevaH samajani tanayastasva sahamava(ba)ndhoH krUrArambha sayAluH 11 paraguNamukharo doSavAdakamUkaH [*] preyaH pInI guNAnAM nidhiriti 12 viSayAsalipacAripace yasminA(bA)vatta vaidhA0 zriyamatirabhasAdarthato nA13. matacca" [] sRSTaH pArthivapAMsudIharasannadhAghanadiggaja netrANAmanime14 Sata: parihato dUreNa vRndArakaH [1] kezavAsarasAmapUrvapalitadhAntaM 15 samAropayan santAgo rajasA raNesuSu jayino yasya dyumAgne gata:" / [1] 16 sa khalu zrIvikramapurasamAvAsitazrImannayaskandhAvArAt paramasaugato 17 mahArAjAdhirAja: zrIbailokyacandradevapAdAnudhyAta: paramezvara: pa18 ramabhaTTArako mahArAjAdhirAjaH zrImAn zrIcandradevaH kucalI / TRANSLATION. (Line 1.) May success attend! May welfare accrue ! (Verse 1.) Adorable is the Lord Jina, the only receptacle of mercy. Victorious also is the Law, the only light of the world. By worshipping them, all the high-minded Congregation of Bhikshus cross to the other side of the world. 1 Metre : Vasantatilaki. ? Read a. Kend fu. [This corrupt pada bas not been properly interpreted. The letter after () is not seen on the impression. A plausible emendation which I would offer, with much hesitation thongh, is yu[af]*[:* [1][kha] and translate the passage thus: 'afraid of which (int. dust) the enemy (kings) sought refuge under his parasol giving up (all) shame.'-H. K. 8.) * Read paM. Metre: Anushtubb. - Metre: Upajati. * Metre: Indravajra. - Read . Motre : Upajati. . Read da. 10 Read aut: 11 Metre : Sragdhara. 1. Thia line is proposed to be thus restored:-sara: pArthivAMsadIdarasamadhAdhanerdinA: 11 Delete su. " Metre: Sirdalarikridita.
Page #219
--------------------------------------------------------------------------
________________ 192 EPIGRAPHIA INDICA. [VOL. XVII. (Verse 2.) There was one Parnna-Chandra by name, favoured of the Goddess of fortune, the bold canopy of dust raised by whose vanguard (in battle) was welcomed by the wives of the Bun-God. (Verse 3.) By nature endowed with majesty, he was neither purified in fire (like gold or kings) nor weighed in balance (like gold or like kings); yet from him came forth the meritorious Suvarnna-Chandra resplendent as gold. (Verse 4.) Of him, who was afraid of sinning against the other world and whose sacred fame was sung throughout the three worlds, was born the son Trailokya-Chandra, the (mere) right of whom was meritorious, who was beautiful to look at, and who was a solace to mankind. (Verse 5.) Not fond of the possession of) vishayas (districts (or, devoid of covetousness), but bent on conquering the (whole) earth limited by the four oceans, he put out in battles the fire, viz. bis foes, by water, viz. bis creeper-like sword. (Verse 6.) To him, who was a friend of the right path, was born & son, the prosperous Sri-Chandra-Devs who was kind (even) towards mischievous endeavours, full of praise for others' good qualities, (but) absolutely dumb to the exposition of others') faults ; & well-built figure, pleasant to the sight and a repository of all virtues. Him, who was averse to all worldly attractions (vishay-dsakti), the Disposer forcibly endowed with sri (fortune) both in name and in reality. (Verse 7.) The multitude of dust particles raised by the victorious (king) in battles, met by the Elephants, the lord of the (ten) quarters completely engrossed by the proud desire of coming in contact with the aforesaid) kingly dust,' anil avoided from a distance by the gods whose eyes could not close (against it), proceeded towards heaven, causing on the hair of the heavenly nymphs the unprecedented illusion of whiteness of old age. (Lines 16 to 18.) From his prosperous and victorious capital established at srt-Vikramapura, he, the devout worshipper of Sugata, the Paramesvara (great lord) Paramabhattaraka, (the great protector) Maharajadhiraja (the paramount sovereign), the illustrious Sri-ChandraDeva, who meditates on the feet of the Maharajadhiraja Sri-Trailokya-Chandra-Deya, in good health [See above. Page 191, note 3.-E.] . arflegte is the dust of the Earth. I dust.-Ed.) * [The so-called Agnikula Kshatriyas.---K.] well towe fact that elephants are foud of playiug with
Page #220
--------------------------------------------------------------------------
________________ No. 13.) A NOTE ON THE GUPTA COPPER PLATES FROM DAMODARPUR. 193 No. 13.-A NOTE ON THE DATES OF THE GUPTA COPPER PLATES FROM DAMODARPUR. BY K. N. DIESUIT, M.A. The discovery of the Damodarpur plates has thrown new light on the fortunes of the Gupta dynasty in Eastern India. The plates have been edited by Mr. Radha Govinda Basak above. Vol. xv., pages 113-145. I wish here to point out certain inaccuracies in the readings of the dates as read by Mr. Basak, which I first noticed when I read his paper and subsequently verified by reference to the original plates, now preserved in the Varendra Research Society's Museum at Rajshahi. The date of the second plate which has been read by Mr. Basak as 129 is to be read as 128. The unit figure which is a vertical line with a slight bend, and a seriph or small horizontal line at the top end, must be taken as the symbol for 8, while the symbol for 9 has a loop at the top. The fifth plate has lost the name of the reigning Gupta sovereign, but the date has been fairly well preserved. It has been read as 214; but I see no trace of a' ten' in the second figure, but a clear tha ' denoting 20, the date thus being 224. That some Gupta sovereign held sway over North Bengal as late as 224 G.E. or 543 A.D., that is eleven years after the date of the Mandasor pillar inscription of Yasodharman (532 A.D.) is an important result. It is no longer possible to assume with Mr. Basak that the Gupta Emperor who made the grant was Bhanugupta, as the difference between the date of the plate and the only known date for Bhinngupta (vir., 191 Gupta Era) is now 33 years. The fourth and fifth plates seem to be separated by a wider margin than that existing between any other two plates of the Damodarpur find. The intervening period of sixty years, roughly 164-224 Gupta Era (=483-543 A.D.) witnessed the gradual diminution of the Gupta dominion and the slow shifting of the centre of their power to the east. It also witnessed the rise and fall in succession of the Huna chieftains Toramana and Mihirakula, and the transitory success of the Malava chief Vishnuvardhana Yasodharman. Other dynasties like the Vardhana' kings of Thanesvar and the Mankhari rulers of Kosala were coming into power on the western outskirts of the Gupta Empire, the latter dynasty in particular having carried on an incessant warfare in Oudh and adjacent regions with the Guptas. It was probably the ascendancy of the Maukhari rulers in Ayodhya that drove the noble born 'Amritadeva (the donor of the fifth Damodarpur plate) from his native place Ayodhya to the distant Paundravardhana province, which may seem to have been one of the last retreats of the Imperial Guptas. The Jaunpur inscription of the time of the Maukhari Isvaravarman, though not dated, must belong to the same period as the fifth Damodarpur plate, as we know from the Haraha inscription that Isvaravarman's son Innavarman had fully established himself in Oudh by 555 A.D. No. 14.-SOMALAPURAM GRANT OF VIRUPAKSHA: SAKA 1389. BY K. V. SUBRAHMANYA AIYAR, B.A., M.R.A.S., OOTACAMUND. This set of three copper-platos, marked No. 2 in Appendix A of Rao Bahadur H. Krishna Sastri's Annual Report on Epigraphy for 1913-14,9 is edited below for the first time with the help of one set of impressions kindly placed at my disposal by him. The plates are reported to belong to Kuruba ryot of Somalipura in the Bellary taluka of the Bellary District. They were unearthed years ago while digging foundations for a house ; but were secured in 1913, for the examination of the Assistant Archeological Superintendent, [The reading at the end of 1. 1 in Plate V of the Damodarpar Plater is probably Kamara.-Ed.] See also p. 95, paragraph 26, of the same report,
Page #221
--------------------------------------------------------------------------
________________ 196 EPIGRAPHIA INDICA. (VOL. XVII. Southern Circle, through the kind offices of the Tahsildar of the taluka, by the then Kanarese Epigraphical Student, Mr. K. Rama Sastri. Regarding the description of the plates Mr. Krishna Sastri has made the following note on the cover of the ink-impressions he sent to me: "Three plates with rounded tops of which the first and last are written on the inner sides only. They are held together by a ring which passes through a round hole bored at the top of each plate. On the ring, which is nearly 24' in diameter and in thickness, slides a circular seal shaped like a signet ring. The seal measures 14" in diameter and bears in relief on its surface at the top the sun and the crescent and a standing boar facing the proper left. Below it is what looks like a floral device. The plates measure 4 by 6". The circular top measures 11' from the base to the middle of the aro." The plates are written in the Nandi-Nagari characters throughout excepting the syllables "Sri-Virapaksha" at the end which are in Kannada. The inscription is in a good state of preservation: the only places where the letters appear slightly damaged are at the commencement of lines 20 and 68. The language of the inscription is Sanskrit verse from beginning to end. The description of the boundaries in desabhasha, promised by verse 46 (11, 71, 72), is left blank for reasons which cannot be guessed at this distance of time. As is usual in the copper-plate grants of Vijayanagara kings, this record contains evident mistakes of spelling such as the frequent substitution of sa for sa (II. 1, 4) and vice versd (11. 1, 3); tha for ta (11.5, 16); dha for tha (1. 43); omission of visarga (11. 5, 8, 13) and its retention in places where it has been changed into (1.42); unnecessary insertion of anusuara (II. 37 and 38), etc. Conjunct consonants are sometimes written side by side as in (1.2), T TT (1. 37) and aa: (1. 33). In fe (1. 45) and 479 (1. 12) the rules of sandhi have not been properly observed. has been unnecessarily doubled in fuafacand visarga has been changed into double in Torado (1. 27). Other instances of mistakes are ate for (1. 45), for (i. 13) and a forge (1. 17). As all the mistakes occurring in the record have been corrested in the text or in the foot notes, they have not been given here in more detail. The first three verses are invocations addressed to Siva, Ganapati and the boar incarnation of Vishnu. The fourth introduces the Moon, and the fifth refers to Yadu and Vasudova. The historical portion commences with Singama (v. 6). His son was Bukka. When he became king, the prosperity of the Karnata kingdom was permanently established (vv. 7 and 8). Harthara (O) was born to him; he filled the quarters with the wealth of his charity (v. 9). He had & son named Pratapa-Devaraya (I) by whom the Turushkas and hostile kings were overcome (vv. 12 and 13). His queen was Domimbika and their son was Vijayabhtipati, renowned for his wisdom (v. 14). Vijayabhi pati's son by Narayanidevi was Pratap, also called Praudhapratapa (v. 15), who obtained from his elder brother the kingdom of Ghanidri (v. 16). His son by queen Siddaladevi was Virttpaksha. The titles Rajadhiraja (v. 18), Rajaparamesvara (1. 42), Mururdyaraganda, Parardya-bhayaskara and Hinduraya-Suratrana and Chhurikabhalanetra (v. 20) are given him. It is said that he obtained the kingdom by his own prowess and ascended the ancestral throne on the bank of the Tangabhadra, in the presence of god Virupaksha (vv. 21 and 22). In speaking of the ancestors of Virdpaksha, our record refers to the valour of Bukka I, the manificence of Harihara II, the prowess of Devaraya I and the wisdom of Vijayabhupati. The mano is pithily expressed in a single couplet elsewhere thus : m tirat a fixtu: 1 ghaurya bodevarAjeyo jAnaM vijayabhapatiH // 1 Smutf-Ind. Inser., Vol. I, p. 183, verse 16.
Page #222
--------------------------------------------------------------------------
________________ No. 14.). SOMALAPURAM GRANT OF VIRUPAKSHA: SAKA 1389. 196 The statement that when Bukka I, one of the two earliest sovereigns of the Vijayanagara dynasty, ascended the throne, the prosperity of the Karnata kingdom was well established, is of partioglar interest to the student of history, as it seems to hint the probable fact that the Vijayanagara dominion was founded on the ruins of the Hoysala (i.&. the Karnata) dominion, which was wrecked by the Muhammadan invasions of South India; and shows also that the inveterate feud between the Vijayanagara kings and the Muhammadan monarchs should have risen even from the very inception of the new Hindu kingdom. There is not much doubt that the country over, which Bukka raled was & portion of the Karnata empire and that the Vijayanagara kings were the political successors of the Hoysalas. Of greater importanos are the statements of our plates that Pratapa, also called Praudhapratapa, was the younger son of Vijayabhapati, that he obtained from his older brother,--show. ing clearly that he held a subordinate position under him, the government of Ghanadri, and that Virtpakaba II was his son. The Satyamangalam plates of Davariya (II) state that Vijayabhtipati had two sons of whom the elder was called Devaraya and the younger Pratapa-Dovaraya. From this it is clear that both the song had in common the name Ddvardya. The existence of these two sons of Vijayabhupati, though not with their names specified, is recognised in the three copper-plate grants of Vird paksha known to us so far, viz. the Sajjalar plates, the Srisailam platest and the present Somalaparnm grant. These, being directly concerned in tracing the main line of Virti pakaba, naturally enough, omit to mention the name of the elder. While the Srisailam plates call the younger Pratapa-Raya, the other two give the additional information that he was renowned by his title Praudhapratapa. Thus, from all these sources it can be gathered that while the first son of Vijayabhupati was known by the mere name Dovardyawith or without the common addition of Virapratapa which is generally assumed by Vijayanagara kings--the younger was always called Praudhapratapa or Pratapa-Devaraya which is sometimes supplemented in stone records by the epithet gajavaffai-landaruliya. Among the stone records of Vijayanagara kings, the following are clearly attributable to the second son of Vijayabhapati No. 92 of the Madras Epigraphical Dated in Saka 1351 in the reign of Pratapa. collection for 1918. Devardya, son of Vira-Vijayaraya. No. 01 of 1918 . . . . Dated in Saka 1852 in the reign of Praudha! Dovariya-Mehariya, son of Vlra-Vijaya riya-Mahariya. No. 68 of 1918 * . . Dated in Baka 1967 in the reign of Pratapa Davariya-Mahardys, son of Vira-Vijaya raya-Mahariya. Thus it is beyond doubt that the second son of Vijayaraya or Vijayabhupati was not only called Prataparaya and Praudhapratapa, but had the additional name Doverdya suffixed to these names. Fnrther, the Madras Museum plates of Devardya Ito refer to a younger brother of his named Srigiri who was governing Maratakanagara in A.D. 1424-5 and the Satyamangalam plates of Devaraya II, dated in the same year, imply that his younger brother Pratapa-Dovaraya was 1 If Mr. Rice has correctly read wijagrajapraptam-anadl-rajyam (p. 186 of Bp. Carn., VOL. ILI), it is *vidently a mistake of the engraver for nigagrajataprapta.Ghanadri-rajyan given in our plates. All remarks (ibid., introduction, p. 23) that Pratapa or Praudha-prataps obtained the immemorial kingdom from his elder sister requiros modification, * Ep. Ind., Vol. III, p. 87 . * Ep. Carn., Vol. III, PP. 185 4., ML. 191. * Ep. Ind., Vol. XV, pp. 8 ff. * Ep. Ind., Vol. VII1, pp. 808 tf. . This is a shortened form of Praudhapratape.
Page #223
--------------------------------------------------------------------------
________________ 196 EPIGRAPHIA INDICA. [VOL. XVII. ruling over the same district. There is thus no doubt that Pratapa-Devaraya is identical with Brigiri and this fact has been pointed out by Mr. Venkayya in his Annual Report on Epigraphy for 1906 (p 82). It may be added that the name Praudhapratapa-Devaraya was already assumed by Devaraya J.1 A stone inscription of this second son under the name SrgirinathaUdayar, dated in Saka 1348, has also been discovered. In the face of the inscriptional evidence furnished in a number of genuine copper-plate grants and stone records referred to above, we do not attach any value to conclusions differing from recorded facts as have been arrived at by the late Mr. T. A. Gopinatha Rao in editing the Srisailam plates, where he has vainly attempted to show that there was but one son of Vijayabhupati, by name Dovarzya. He has advanced no valid grounds for disproving the identity of Srigiri with Praudhapratapa-Devariya, the second son of Vijayabhapati. The first two sons of Vijayabhapati being known by the name Deva riya, it is but natural to mistake the sons of one of the Devarayas for those of the other. But the fact mentioned in our inscription, vis, that Virapaksha was the son of the second son of Vijayabhu pati, whom we have pointed out above to have borne the full name gajavottai-kandaruliya Prandhapratapa Pratapa Devariya, is of importance as it conclusively controverts the commonly accepted view, vis. that Mallikarjuna and Virupaksha were the sons of Davaraya II, the first son of Vijayabhapati. In this connection, we may point out that two unpublished stone inscriptions furnish definite information. They come from Kundanis in the Salem District and Conjeeveram* in the Chingleput District and state that Mallikarjuna and Virupaksha were the sons of Gajavettai-kandaruliya Praudha-pratapa-Devaraya-Maharayr. Here the mention of the epithet Praudhapratapa makes it certain that the king referred to is the younger son of Vijayabhapati. Another stone inscription of Virapaksha, dated in the cyclic year Sarvari, calls him the son of Gajavettai-Pratapa-Devaraya. It may be noted that while the mother of Virapaksha was Siddhaladevi, the mother of Mallikarjuna was Ponnaladevi, who must have been two different queens of Praudhapratapa. Devariya, the second son of Vijayabhupati. Our record is dated in Saka 1389, expressed by the word nav-ashta-guna-bha, Sarvajit, Karttiga month, bright fortnight, Utthana-dvadasi. According to Dewan Bahadur L. D. Swamikkannu Pillai's 'Ephemeris,' this date corresponds to Monday, 9th November, A.D. 1467. It may be noted that the stone inscriptions of this king range in date from Saka 1387,6 Vyaya to Saka 14077 from which it would appear that he ruled for at least ten years. But the latter date is very doubtful as the record is damaged. The generals and officers of this king made known to us from inscriptions are Vittharasa, Odeya, Saluva-Tirumalariya, Siluva-Narasimha, 10 and Singappa-(or Singapa-) Dandan,yaka.11 Of these. Vittharasa-Odeya was in charge of Barakaru and Mangalore which he was governing from Saka 1387 to 1398. Tirumalaraya was in charge of Trichinopoly and Salava-Narasimha developed into a usurper in later years. Two stono records of Virapaksha in particular are 1 No. 188 of the Madras Epigraphical Collection for 1889, * No. 68 of the ss.ne collection for 1909 * No. 208 ditto 1911. * No. 89 ditto 1890. No. 661 ditto 1904. . Nos. 180 and 168 of 1901. * No. 898 of 1909. * Nou. 80 and 168 of the Madras Epigraphical Collection for 1901. * Koyilo Jugu maken mention of this chief-we Ind. Ant., Vol. XL, p. 141. 10 See aite 6, below. 11 N3.28 and 168 of the Madras Epigraphical Colleetion for 2001,
Page #224
--------------------------------------------------------------------------
________________ No. 14.] SOMALAPURAM GRANT OF VIRUPAKSHA: SAKA 1389. worth mentioning in this connection, of which the one, dated in Saka 1390, registers a gift by an agent of Saluva-Narasimha, and the other, dated in Saka 1394, records a gift for the merit of the same chief.1 197 The subjoined inscription registers (i) a gift of land situated to the west of the Hagari river within the boundary of the village of Yammegenaru in Muda-nadu, a sub-division of Hastinavativalita, to a Brahmana resident of Nittura, the son of Sarangirya, learned in the Vedas, Sankhya and Mimamsa and reputed as the author of a work called Bhishya-Bhisha; (ii) gift of lands under the tanks called Krishna-tataka, Kariyakere and in the village of Chitukanihilu to another Brahman named Virapaksharya, a physician and the son of Rasesvara; and (iii) gift of the village of Somalapuram, with its name changed into Virapikshapuram, to a certain Viranarya, who, in turn, appears to have distributed it among Brahmans, dividing it into 60 vrittis. The distribution of the full 60 vrittis among Brahmans is not given. But it is said that four Brahmans and three others connected with the issue of the copper-plate grant received 8 shares. The account for the rest is omitted, but it is evident from the blank space preceding verse 46 that possibly one or more plates containing the names of the rest of the vritti holders, which were intended to be inserted, have not been so done. The description of the boundary marks too, which must have followed this verse, is omitted, as already remarked. Of the geographical names found in this inscription, Nittura, Chitukanahalu, and Somalapura are villages situated in the Bellary taluka; Hastinavati is another name for Anegondi near Hampi; Yammegonuru is in the Bellary taluka at the place where it borders on Hospet; and the river Hagari bears the same name even now. It is noteworthy that the old name Somalapura is retained at present while its later name Virapikshapuram given in Saka 1389 has not survived. Khari, according to the dictionaries, is equal to 3 bushels and perhaps indicates the extent of land by its sowing capacity. The two tanks, Krishna-tataka and Kariyakere, must be looked for also in the Bellary taluka. The composer of the grant was Durga-Bhatta, son of Madhavaradhya, who figures also in Ml. 121; and the engraver was the goldsmith Viranarya, son of Muddanarya. This engraver is perhaps identical with Viraparya, the father of Mallapa, who incised the inscription Ml. 121.. [The following metres are employed: vv. 1-3, 5, 7, 11, 14, 15, 17, 20-53, Anushtubh; vv. 1, 10, Sardalavikridita; vv. 8, 12, 13, 16, 19, Upajati; vv. 6 and 18, Upendravajra; v. 9, Malini ; and v. 54, Salini.] TEXT. First Plate. 1 yogavAdhipataye namaH / nama (tuMga (mi) ravidracAmaracAraye / 1 2. 2 lokyanagarAraMbhamUlastaMbhAya zaMbhave [1] racAyai jagatAM bhUyAdadayAkui 3radAnanaH [1] pAyakroDAvidho yasya paravanaMti payodhayaH I [a] 'namaH (sta) me) parA 4k, vertuant get aftursentega(m):* | [*] 1 No. 79 of the Madras Epigraphical Collection for the year 1919 and No. 188 of the same collection for the year 1902. ? The Srisailam plates were also incised by the same person (see above, Vol. XV, p. 19) where the name of the person occurs as Viranacharya, son of Muddanacharya. Cancel the visarga. Omit the visarga, is the reading in Ml. 121. 2 x
Page #225
--------------------------------------------------------------------------
________________ 198 EPIGRAPHIA INDICA. [VoL.XVII. 6 'asthi (sti) zrIkamalAlayAnujatayA dIvyanabhomaMDale nakSatrAdhipati[:] pra. 6 bhAbhiranisaM(zaM) di[]DalojAsakata] [1] kSorAbdhiprabhavaH kalAnidhiri7 ti khyAtasu(sma)dhAMsu()[:*] zva(kha)yaM / ' mauko yasya (sa) vibhUSaNasvamagama cchaMbhovA8 nopate[*] // [4*] vaMse (ze) tasyaiva saMjAto yadurnAma mahIpatiH [1] yahaMsa(sa)jena bhU9 [2]SA vAsudevena paalitaa| [5*] yasminmaMgarajicca (tyobhaMgurabhara' pratyarthipRthvI10 bhRtAM 'sArthI(tha)bhagamupAgatairapi gatA dinnaDalo saMbhramA[1] / tatkotirvi11 varISu' gacchati puro diGgAthavRMdeSvaho sahatta: zazimauLimaMDana12 maNi[:"] zo(so)bhUnR )pa: sagamaH / [6] tatobhUkabhUpAlaH sarvabhUpa kulAgraNI: / "] 13 yatpratApAnale sarva (va) pataMgatyaribhUbhRtaH // [7*] karnATalakSmI[:"] 'savilAsa[mA]14 sa yasminmahIpe mahanIyakotto(tI) [*] bhUmistathaivApa' vasaMdharAtvaM sthirati nAma 15 prathama guNoghe // . [*] udayamuda[ya]zelAdudyaduhAmatejA[:"] zasa(1)dhara va bU(bu) kakSmA16 bhRt:stNgmaule| hariharanarapAlaH prApadAsa[](gA) [:"] samasyA (stAH) karata vasupUrai[:*] 17 pUrayan pUrNadhAmA // [e"] yenAkAri kalo liH) katAdhikatarI yene()Sa [ghaM] DApata(tha): ka18 maMbaM(bra) hmapathojano ni) prasa(za)mitAzeSopasargaH parA(ra) [*] yenAMbhonidhi mekhalA vasu19 mato dharmeNa saMrakSa(cya)te tasyAnakadigIsa(za) pAli[ta]"yazobiMbasya keno-" 20 pama(mA) // [10] [mekAdevIti vikhyAtA zrIpArvatyosta maLanA[*] sAsojjAyA mahobhata :.] 1 M1. 121 hos svasi. ? Delete the punctuation. foy is also the reading in the Kannada test of M. 121 (see p. 203 of Ep. Carr., Vol. III), but it in read Mnitya in the romanisod text given on p. 135. Read akhina saMgara. * Read bharaiH 'saMca is the variant given in M1 121. * Kend varaSu. 1 degsathA' is the reading in M1. 121. * gu in a correction from y; read guzIgha:.. * Read bhUtastujAmaula.. .. 10 Mi. reads payojanI... Haisa correction from-r. 11 The Kannada text of Ml. 191 bas augu (p. 203 of Kp. Car, III) and the romanised text has waloopana ibid., p. 135). MAnother variant of this is pAsauhAryA which is found in M1. 121.
Page #226
--------------------------------------------------------------------------
________________ No. 14.] SOMALAPURAM GRANT OF VIRUPAKSHA: SAKA 1989. 199 21 ma[va]' puskhalakSaNA // [11] iMdra: svadoSa, parivartakammo bhUmAvavosvA(sya) pra. 22 tipatra rUpaH] [1] pratApapUrva[:.] kila devarAyaH pratApato bhUmimapAlayaH 23 [maH / ] [*] prAtApabanhauM parisuMbhamANe zuSkAsturuSkA papi yasya rAjaH [*] ri Second Plate ; First Side. 24 pakSitIza[*] nirastadhairyAH kAtAravasmokakatAtmarakSA: [13] tasya demAbi. 25 kAbhartuH putraH zatrupramardana: [*] vidyAnidhirvizeSajJo vIro vijayabhUpatiH [ // 141] 26 tasya nArAyaNIdevyA prAdurAsIdyazodhana: / prauDhapratApavibhava: pratA. 27 pAkhyo mahIpatiH / [15*] guNa (ranikai vanautasmin virAjamAnamma28 tApta kIrtti[: *1] nijAgrajAt prAptadhanAdirAjyaH sArthIkatArthiva29 japArijAtaH // [16] tasya 'ziddaladevIti bhAryA sarvaguNAzrayA / 30 lakSmInA(nA)ra[r*]yaNase (sye)va sa(za) [cIva namucihiSaH // [17] tasyA si(zi)va: prAdurabhU31 gaNAnyo nAnA virUpAkSa iti prasiddhaH [*] rAjAdhirAjaH citipA32 lamaukivadAnya mUtti(ti): karaNekasiMdhuH // [18] nijaprasApA[dadhi[ga]33 tya rAjyaM samastabhAgya[:] parisevyamAnaH [*] khaDgA (zA)mataH sarvaripandhi34 jitya sa modate vIravilAsabhUmi: // [18] cu(chu)rikAbhAlanaco()ti vi. 85 khyAtaH pratipaM(pa)vadhIH / mUrurAyaragaMDAMkaH pararAyabhaM(bha)yaMkaraH [] 36 hiMdarAyasuratrANa ityAdi viru[dobataH // [20] tuMgabhadrAmadItI. 37 re / virUpAkSasya saMnidhau [*] picya" siMhAsanaM prApya pAlayana(ba). - vanomimA [ // 21] puM(pa)38 NyazlokAgraga(ga)Nyosau virUpAcacitIkha(kha)raH / dharmasthAnagataH] 39 saddhiH saMyuto gharaNIsuraiH [22] mAlivAhananirNItasakapa40 SaMkramAgate / navASTa]guNabhUyuko sarvajisare zubhe // 21.] mAse kArtika- . * Cancel - Perhaps the correct reading is an orgotut; M. 121 has auf. 1 Ml. 121 has ; read 1991. - Read katAra'. * Read nyA. * Bee note 8, p. 4, above. MI. 121 has siMhaladevI. sacI namucivihiSa: is the rending in MI. 121. * The variant found in MI. 121 is saMgrAmasa: 10 Cancel the danda. feet is the reading that occurs in Ml. 121. saMyatrI is another variant found in Mn.121. 1 The Kannada text of Mi. 121 bas vedet:, but the romannined text ronds correctly at: 2. 2
Page #227
--------------------------------------------------------------------------
________________ 200 EPIGRAPHIA INDICA. [VoL. XVII. 41 vikhyAte site pakSa[2] vizeSataH / utthAnA(na)hAdaso(yo)puNA(Nya)kAle cApi nRpI42 tamaH [1] [24*] rAjAdhirAjaH'stejasvI yo rAjaparamezvaraH [1] [vi] rUpAkSa . kSitIyo43 dha(tha) dharmavuddhayA yutaH sudhIH / [25*] pAtreyAya rugadhyetre nihurasthasavAsi. 44 ne| sAM(sAraMgAryasutAyAtha sarva yAstra vide tathA / [24] bhASyabhUSAkArA. 45 yAtha sAMkhyAmomAMsavedine / sauvazAstrapravANoya catuSa(pSa)STikaLA(lA)46 ni(vi)de [27] SaDaMgasahitaM vedaM vedArtha vetti bhUmaraH [*] tam dijAya bhU47 [pAlo] hastinAvativakritagaM(gAM) [28] mUDanADasthitaM (tAM) caiva hagare[:*] pa[ci] Second Plate ; Second Side. 49 me sthitaM(at) / yaMmegenUru soMgnyeva / khAro bhUmiM mahIpatiH // ] [28] prAdAttathA ca sa(ma)hi. 49 taM kSetraM sasya phalapradaM // [28] bhAradvAjAya viduSe / rasekharasu50 tAya ca / virUpAkSAryabhiSaje ruvazAkhA(khA)dhyA[yi]51 ne tathA [30] khArisaptapramANaM ca [ta]TAke klaNasaMjita [*] kariyakare ye52 ti vikhyAte khAritrayamitAM bhuvaM [21] ciTukanAhAku nAmnyeva khAricayamitAM 53 bhU(bhuvaM / militvA khArisaMkhyA (khyAtra trayodaza suvizrutA // [32] tra(ta)trasthaM grAmamekaM tu so. 54 malApuranAmaka [*] asmAkaM bhI virUpAkSamahInAtha dadakha naH / [33] [ti| 55 vijJApya bhUbhartavirUpAkSamahopate: / "] vi(vo)raNArya[:*] svayaM labdhA(bdhA) grAma cA[va] 56 mahIsva(kha)rAt // [34] zR(zrutvA vijJApanaM tasya virUpAkSamahIpati[:] / [35] nidhinikSe 1 Velete the risarga. * Read . * Read sarvazAstrapravINAya. * Cancel the danda. * Read . * The e of seems to have been erased in the original. Either the word veroor: should be cancelled; otherwise there would be redundancy. .washould have expected auraNA saMvamI yAmadhAna:. For the pleonastic use of the words mahIpata: and nahIvarAt mabove, note 1.
Page #228
--------------------------------------------------------------------------
________________ No. 14.] SOMALAPURAM GRANT OF VIRUPAKSHA: SAKA 1389. 201 57 pasaMyuktaM jalapASANamizritaM / pakSiyAgAmisaMyukta / sihasAjyasa68 manvitaM / [36 | aSTabhogeca saMyuktaM kukhyArAmamamanvitaM [*] samastabaLisaMyu59 taM sarvamAnya phalapradaM] / [37* taMgabhadrAnadItIre virUpAkSasya saM(sa)vidhau[*] 60 sahira(ra) Nyodaka(ka) dAnadhArApUrva yathAvidhi [ // 38*] virupAkSaraM caiti61 pratinAma vidhAya ca // bhoktuM dAtuM vijebhyazca prAdAdA[caMdra] tArakaM / [38*] 62 sopi hijazca saMtuSTa[:*] saMyutaH parayA suMdA [*] prakara(ro)dAziSaM rAje cira63 jovI bhavaviti // [4.*] gotraM zAkhA piturnAma dijAnAM ca yathAsthitaM [*] likhyaM64 te vRttisaMkhyAtra SaSTisaMkhyA yathAkramAt [ // 41*] zrIvatso rugadhItaca [hema]. 65 NAyasutaH sU(su)dhIH [*] mallibhaddeti vikhyo(khyA)to vRttimekaamihaashrute|| [42*] vAsi66 To(Tho) rugadhotaca valaMbhaTTama[taH] sudhI[:] / [durgAbhaTTeti vikhyAtI vRttime kA mihAzru. 67 te // [43*] hArIto gadhotaca haMpaNArya[sa]ta: sudhI[:] [*] sAraMgAyaca vikhyAta[:*] sAdha[meka]68 . .[sa]: [ // 44*] pAtreyotha rugadhyeta bhAyaNA[ya]sya [naMdana]: [*] bhAyibhaTTo vijatheSTo(Tho) vRtti69 [iyami]hAzrute // [45*] Third Plate. 70 testai [sa] (sma)manvitazcinhe di. 71 tu prAsyA(yAdiSu kramAt [*] somAnozyA(syA)grahArasya likhyate deSa(zabhASayA [84*] 72 vAsiSTo(Tho) baM(ba)ha(ba)co vihAn 73 aitayAryasutaH sudhI: [*] vanabho rAyasakhA(svAmi(mI) hatti"mekAmihAnate / [47*] 1 Cancel the dande. ina correction from F. . Read gadhItaka * Read mahati . * Read gacautaya. At the top of this plato, a little below the right side of the ring-hole, is the letter vi which I am not able to explain. . The line begins about the middle of the plate. 10 Like to in line 23 in written with preceding ha. The grammatically correct form wonld be vice verad. - The two syllables & are written over an eroure. Read gotA.
Page #229
--------------------------------------------------------------------------
________________ 203 EPIGRAPHIA INDICA. [VoL. XVII. 74 tvaSTA bomuhalAcAryasUnaH mAsabarI[kha]ka: [1] vIraNaH suguNo dhImAna] 18 ettimekAmihAzrute [48*] pAyo bAjuSo dhImAnmAdhA(dha)vArAdhyanaMda76 naH [1] 'mAsana:1 ghaMthalahitAm dummA(e~)bhaTTo vRttibhAka [4 ] dAnapAkha nayo17 madhye dAnAcche(cche) yonupAlana [*] dAnAsva(kha)rgamavApnoti pAlanAdaJca(cutaM 78 pada // 5.*] svadattAhika)guNaM paM(pu)NyaM paradattAnupAlanaM / / * ] paradattApa hAra79 Na khadattaM niSphalaM bhavet // [51*] svadattA(ttA) 'paradattA vA yo hara(2)ta vasaM. 80 dharA / SaSTirva[rusa] hasrANi viSTAyAM jAyate kli(ka)mi[*] // [52"] .. ekaiva bhami. 81 nI soke sarveSAmeva bhUbhujA [*] na bhojyA na kha(ka)rAhA(mA) vipradattA [vasuM]83 gharA // [53] sAmAnyoyaM dharmasetuM nRpANAM kAle kAle pAla[nIyo] bhavani:] [*] 83 sarvAne tAn bhAvinaH pArthiveMdrAn bhUyo bhUyo yAcate rAma[caMdraH] // [54 *] yo[*] 84Sri-Virapaksha.s TRANSLATION. (Line 1.) Obeisance to Gapadhipati. (V.1.) Invocation to Siva [by the common verse namas=turiga, etc.]. (V.2.) May the merciful elephant-faced (god), in the course of whose water-sport the oceans become (mere) ponds, protect the worlds. (V. 3.) Salutation to that boar, at the tip of whose stalk-like snout, the earth, comprising the seven islands, seemed (to possess the beauty of) a lovely lotus. (V. 4.) There is the Lord of stars (ie. Moon), the younger brother of her who resides in the lotus (i.e. Lakshmi), who shines in the region of the firmament. with his (lustrous) ray and constantly illuminates the quarters, who is born of the milk-ocean and is renowned as the depository of kalas (digits), himself being made of nectar rays and who has obtained the position of a jewel in the head of Sambhu, the consort of Bhavant (1.e. Parvati). (V.5.) In his family was born the king named Yadta; and this world was protected by Vasudova who was born in that family. (V. 6.) There was king Sangama of good conduct, wearing Sasimauli (Siva) as an ornamental jewel; on whose victory in battles, the crowds of enemy kings heavily burdened (with numbers) though vanquished reach the cardinal points in great haste; (but) whose (i.6., the King's fame moves further an (passing) through intervening spaces amidst lords of the (eight) directions. 1"attcel the visargo afterw. The rest of this line and the next line up to a FA: are written on an erasoro. * Read varSasa'. * Read degseturgapA...................In Kavnada characters.
Page #230
--------------------------------------------------------------------------
________________ No. 14.] SOMALAPURAM GRANT OF VIRUPAKSHA: SAKA 1389. SOM 203 (Vv. 7 and 8.) Then came king Bukka, the foremost of the kingly race, in the fire of whose valour the hostile rulers were consumed as moths. In this king of great fame, the goddess of prosperity of the Karnata (kingdom) rested with pleasure. And the goddess of the earth also for the first time realised the significance of her) names Vasundhara and Sthira on account of her qualities of bearing wealth and remaining permanent. (V. 9.) Like the moon of bright lustre rising from the Udaiya-Saila of lofty peak, king Harihara of rising full glory took his birth from king Bakka who wore a splendid crown and filled all the quarters with abundant wealth acquired by taxation as the moon with the exuberent lustre of his rays. (V. 10.) What could stand comparison with him the reflection of whose fame is protected by the deities of the quarters, by whom the (stern) Kali age has been turned into one better than the (golden) Kcita age; by whom was caused the highway of the school of philosophy which considers Duty (Karma) as god (Brahmi) free of all obstacles, and by whom the earth, having for (its) girdle the oceans, was ruled with justice. (V. 11.) She, who was called Moladevi because she was a combination of Sri i.e. Lakshmi) and Parvati and was in every way possessed of auspicious marks, was the consort of this king. (Vv. 12 and 13.) Indra, desirous of removing his stains, obtained on earth the form of this (king) and in the nam of Dovariya, with Pratipa prefixed to it, ruled the world with his prowess. In the glowing fire of this king's valour, the Turushkas were scorched up and (other) hostile monarchs, with (their) bravery lost, sought self-protection in forests and ant-hills. (V. 14.) The son of this husband of Damambik, was Vijayabhapati, the destroyer of his enemies, the store-house of learning, of supreme knowledge and a hero. (Vv, 15 and 16.) To him, through Narayanidovi, was born the king called Pratapa, renowned as Praudhapratapa, who had fame for wealth. He shone on this earth with many virtues, obtained famo by meritorious deeds, got the (kingdom) of Ghanidri-rajya from his (uterine) elder brother and was a Parijata in granting their desired objects to crowds of mendicants. (V. 17.) His wife was Siddaladevi, the resort of all good qualities, like Lakshmi to Nardyana And Sachi to the enemy of Namuchi (i.e. Indra). (V. 18.) Siva (himself) was born of her under the well-known name of Virapaksha, full of good qualities, a rajadhiraja, the head-ornament of kings, a munificent person and the one ocean of mercy. (V. 19.) Acquiring the kingdom through his own prowess, attended with all kinds of prosperity, and conquering all his enemies with the point of his sword, he, as the play-ground of heroism, rejoices. (V. 20.) He who is renowned as Chhurika-Bhalanetra (i.e. Siva in wielding the sword) and ripe of wisdom holds the high (sounding) titles, such as Mururayaraganda, Pararayabhayarikara and Hindurayasuratrana. (Vv. 21 to 29.) On the bank of the Tungabhadra river (and) in the presence of the god) Vira paksha, having obtained his ancestral throne, this king Virupaksha, the foremost among those) possessing noble virtues, rules the earth, surrounded by pious Brahmanas assembled in his court. In the course of the Sala yeary determined by the Salivahana-[Ern), in the excellent year Sarvajit (corresponding to the year) expressed by nine, eight, gunas (three) and bha (one) (i.e. 1389), on the auspicious occasion of Utthanadvadasi, in the brigbt half of the month of Karttika, he, the best of kings, the wise Virupaksha, a rajadhiraja (and) rajaparamatusta, of great valour, with the intention of making charity, made a grant to Brahmana resident of Nittura, who was the son of Sarangarya, who belonged to the Atroya-[gotra), and was a endent of the Rik-[Sakha], who was well versed in all the Sastras, who knew the sixty-four arts
Page #231
--------------------------------------------------------------------------
________________ 20+ EPIGRAPHIA INDICA. [VOL. XVII. as well as the Sankhya and the Mimamsa (systems of philosophy), who was learned in the Vedas and the six angas (branches) with their meaning, and who was the author of the Bhashya-Bhusha, of (one) khari of land situated to the west of the Hagari (river), within the boundary of the village of) Yammegeniru in Mada-nada and in (the sub-division of) Hastinavati-valita. (Vv. 30 to 32.) Again he gave to the scholar and physician Virapaksharya, son of Rasesvara of the Bharadvaja-[gotra) and a student of the Rik-Sakha, 7 khari of valuable land yielding grain and fruit under the tank called Krishna, 3 khari of land under the tank) known as Kariyakere and of 3 khari of land in (the village) called Chitukanahalu-thus in all, the number of 13 kharis. (Vv. 33 to 39.) Having petitioned thus to king Virapaksha "Oh! King Virupaksha ! grant me the village situated there named Somalapura", Viranarya obtained from the king the (said) village. On hearing the request, king Virapaksha made, in the presence of the god Virapaksha on the bank of the river Tungabhadra, a sarvamanya gift with gold and water, uscompanied by libation of water as laid down by rule, of the fertile village (Somalapuram) with all its royal revenuel, together with canals and gardens, with its name changed into Virupakshapuran,--for being enjoyed as long as the Moon and the Sun endure, or for being given away to Brahmanns, together with the eight kinds of enjoyment, i.e. (the right to own) the widhi, niks kepa, jala, pashana, akshini, agani, siddha, and sadhya. (V. 40.) The Brahman tou, pleased and overpowered with joy, blessed the king with long life. (V. 41.) (Here) will be written, in order, the gotra, sakha and the father's name and the names of the Brahmans. The number of vrittis (who received shares in the village) is sixty. (Vv. 42 to 45 contain the names of four of these donees.) Verse Name of the donee. Father's name. Gotra. sakhi. Number of trittis owne.l. . . . . Srivatss. . Vasislitha Malli-Bhatta Darga-Bhatta 41 Sarangarya . 45 Bhayi-Bhatta Hemanarya . .Vallam-Bhatta Hainpanarya Bhayanarya . . . * Atriya. . . (V. 46.) The boundaries of this Brahman village (agrahara) with their respective marks are written (below) in the language of the country, in the four directions commencing with the east, in order. (V. 47.) The wise and learned Vallabha, son of Aitayarya, and the chief of the Secretaries (Rayasa) belonging to the Vasishtha-Cgatra] and the Bahvpicha-[Sakha), holds one vritti (in this village). (V. 48.) The intelligent smith Virana of virtuous qualities, (who was) the engraver of this document and the son of the prosperous Muddanacharya, holds one vritti (in this village). (V. 49.) The learned and intelligent Durga-Bhatta of the Atroya-[gotra] and the Yajus[Sakha], the composer of this document and the son of Madhavaradhya, owns one vritti (in this village) (Vv. 50 to 54.) Five of the usual imprecatory verses.] (line 84.) Sri-Virupaksha. TLe word has pe:haps to be correcte:t into afa
Page #232
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM. No. 15.-THE BRAHMA-SIDDHANTA OF BRAHMAGUPTA, A.D. 628 : MEAN SYSTEM. BY ROBERT SEWELL (I.C.S., RETIRED). 205 (Continued from Vol. XVII, p. 187.) 321. The Tables published in my last article (above, Vol. XVII) enabled the dates of ancient Indian inscriptions and records to be verified according to the requirements of the BrahmaSiddhanta with, as basis of calculation, the "true" or apparent motions of sun and moon. This mode of reckoning appears to have been introduced in the 11th century A.D. But the Brahma-Siddhanta was composed in A.D. 628 and for at least four centuries after its appearance details for the Calendar were almost certainly based on mean planetary motions; while it is believed that this mean system continued to guide the preparation of panchangas (almanacs) till a much later date-perhaps for several centuries in some parts of the country. For the correct verification, therefore, of early dates it is necessary for historians to be provided with a set of Tables based on mean planetary motions and the postulates of the BrahmaSiddhanta in addition to those based on mean motions and the postulates of the Arya-Siddhanta. The latter were provided in a previous article in this volume. The former are presented herewith. They cover a period of 800 years, from K.Y. 3700 to 4500, or from A.D. 599 to 1400. The system of work is the same as in all my previous Tables, that is to say, it is the system of Largeteau as adopted by Professor H. Jacobi in the Indian Antiquary, Vol. VIII, and in the Epigraphia Indica, Vol. XI. Full examples shewing the method of work, which is very simple, are given in my former articles; others, specially concerning the system of mean reckoning ou Brahma-Siddhanta principles, are given below. In case of doubt as to which of the Tables already published should be used in the present case attention is directed to the accompanying SS 329. 322. In examining the dates of records in earlier years it is necessary to remember that the modes of reckoning adopted were not always the same as those used in more recent years. As to eras, reference to articles 6-12 of my former work, Indian Chronography, is recommended. For other matters the late Dr. J. F. Fleet's remarks in the Journal of the Royal Asiatic Society for 1912, pp. 704-5, will be found very valuable. Especially let it be borne in mind that the lunar month reckoning in early years was probably carried out on the purnimanta system. According to the late Professor Kielhorn the earliest known date certainly in amanta reckoning belonged to the year A.D. 794. It is contained in the Paithan plates of the Rashtrakuta king Govinda III (Epig. Ind., III, 105; Ind. Ant., XVII, p. 142, No. 9). As regards these two systems, the amanta and purnimanta names of lunar months, see Indian Calendar, SSSS 13, 45 (with Table on p. 26), 47, 51, and the late Sankara Balkrishna Dikshit's footnote on p. 31; also Indian Chronography, SSSS 75, 76, p. 31. Elements of the Brahma-Siddhanta mean reckoning. 323. The principal elements are fully stated in my former article on this authority (above, Vol. XVII, SS 313). For calculation on the mean system the following notes are necessary. (i) The length of the mean sidereal solar year is 365 6h 12m 9, a fixture afterwards adopted by Bhaskaracharya in his Siddhanta-Siromani, A.D. 1150. 27
Page #233
--------------------------------------------------------------------------
________________ 206 EPIGRAPHIA INDICA. (VOL. XVII. (u) The advance of a (distance of mean moon from mean sun)-which finally fixes the index of the tithi (5th of a mean lunation) in measurement by 10,000ths of circle-in every civil day of 24 hours and in hours, minutes and seconds, has already been given for the Siddhanta-Siromani in Tables LIV, A and B above, Vol. XV). These Tables are applicable to the Brahma-Siddhanta. (ii) For the sun's mean motion per day, hour, minute, etc., see Tables XLIII and XLIV (above Vol. XIV). (iv) The advance of a in one mean solar month is, in 10,000ths of circle, 307-349156595. (v) Each solar month consists of 304 10h 31m (75. Table XCI below shews the interval of days, hours, etc., between the moment of mean Mesha-samkranti, when the mean sun is at celestial long. 0deg (Table xc, cols. 13-17), and the moment of each subsequent sankranti when the mean sun enters each of the twelve signs; and so enables the day and time when each mean solar month begins to be ascertained. The same Table gives the advance of a from its value at the moment of mean Mesha-sankranti to the same at each subsequent samkranti. (vi) The interval between the moments of true and mean Mosha-samkranti, i.e. between the moments of the astronomical beginning respectively of the true and mean solar year, which interval we call the sodhya, varies slightly year by year in consequence of the postulated shift of the sun's apsis (SS 313, VII, above). The exact intervals, century by century from K.Y. 3700 to 4300, were given above in 9 315. The Table is here repeated and extended so as to embrace the whole period of the general Table XC below. The quantities were computed by Dr. Robert Schram. TABLE B. (above, p. 126.) VALUE OF sodhya BY THE Brahma-Siddhanta. SODHYA AT BEGINNING OY CENTURIES. Kaliyoga. A.D. D. H. . S. Days and decimals. 599-600 2 3700 3800 4 4 8 9 69-8128 20160 4.2192 2:1729145 -2.1729400 699-700 3900 799-800 2-1729655 4000 2 4 9 6.4224 21729910 4100 2.1730165 4200 2-1730420 899-900 999-1000 1099-1100 1199-1200 1299-1300 1399-1400 4300 2:1730675 2 2 2 400 8.6256 10-8288 13-0320 15-2352 17.4384 4 4 4 9 9 9 2.1730930 4500 2-1731185
Page #234
--------------------------------------------------------------------------
________________ No. 15.) THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 201 The moment of mean Mesha-sankranti, or the beginning of the mean solar year. 324. The general Table which follows (Tabie XC, cols. 13-17) states the moment of beginning of each mean solar year according to the Brahma-Siddhanta. The first entry is for the expired year 3700 of the Kaliyuga (A.D. 599-600), in which year the astronomical beginning is fixed as at 5h 15m after mean sunrise on Saturday, 21 March, A.D. 599. It is incumbent on me to prove the correctness of this fixture. Subsequent entries are based on it by the addition to it year by year of 3654 6h 12m 9. Proof may be offered in three ways :-(A) by compari. son with the date and time already found for the beginning of the true solar year K.Y. 3700, utilizing Dr. Schram's determination of the interval between the two occurrences; (B) by comparison with the date and time fixed for the beginning of the same mean solar year according to the First Arya-Siddhanta, allowing for the time difference between the two anthorities caused by their different estimate as to the length of the mean solar year, viz. 21'; (C) by direct com. putation from the moment in K. Y. O of mean Mosha-samkranti, 3,700 years earlier, which, according to the Brahma-Siddhanta (SS 313, v, above), was exactly at mean sunrise, or Oh Om D* Lanka time, on Friday, 18 Febr. (B.C. 3102). A h. m. 8. Moment of true Mesha-samkranti in K. Y.3700 (A.D. 599) (Table LXXXII, (5) Thur., 19 Mar. 16 01872 Vol. XVII, above). fodhya as above ($ 323, Table). . + (2) 2 4 8 59-8128 Moment of mean Mesha-samkranti (0) Sat., 21 Mar. 5 15 0 v [See Indian Calendar, Table I, cols. 13-17, for A.D. 599-600.] h. m. 8. True Mesha-sankranti by Arya Siddhanta . . . . . (5) Thur., 19 Mar. 23 17 30 Arya-Siddhanta fodhya . . . +(2) 2 3 32 30 Mean Mesha-samkranti by Arya Siddhanta . . . . . (1) Sun., 22 Mar. 2500 Less Time-difference in 3,700 years . -21 35 0 Mean Mesha-samkranti. by Brahma Siddhanta . . . . . (0) Sat., 21 Mar. 5 15 0 The epoch of the Kaliyuga was Oh Om 0* Lanks time, or exactly at mean sunrise on Friday. The length of the mean solar year being 365d 6h 12m 9', the beginning of the next mean solar year took place 6h 12m 9after mean sunrise ; and after the expiration of a century from the epoch the mean solar year began at 20h 15m 0 after mean sunrise ; so that after 37 centuries had passed the mean solar year K.Y. 3700 began at 5b 15m 0 after mean sunrise. When this latter calculation is carried out century by century, the figures shew that centuries 6, 12, 19, 25 and 32, five in all, were defective centuries consisting each of 36,525 days, the remainder being common centuries of 36,526 days. Since 36,526 divided by 7 leaves no See Tatle, $ 273, in Article on the Siddhanta-Siromani (Vol. XV above), which is equally applicable to the Brahma-Siddhanta ; or refer to Indian Chronography, p. 61. The time-ditforence in 8,000 years is 17" 80-, in 700 years 4h 5deg, total 216 85.
Page #235
--------------------------------------------------------------------------
________________ 208 EPIGRAPHIA INDICA. [Vol. XVII. remainder and 36,525 divided by 7 leaves remainder 6, the results show that whereas century 0 began on a Friday, century 37 began on a Saturday. Table xd therefore, as regards the moment of mean Mosha-sankranti in K.Y. 3700 expired, A.D. 599-600, is proved to be correct. The beginning of the mean luni-solar year, i.e. the civil day on which the tithi Chaitra sukla 1 expired; and the value of a (mean tithi-index) at mean sunrise of that day. Amanta system. 325. In $ 317 of my article on the Brahma-Siddhanta as calculated by the true motions of the sun and moon (above, Vol. XVII) it will be seen that the value of a at mean sunrise of Sunday, 22 March, A.D. 599 (K.Y. 8700) was proved to be, in measurement by 10,000ths of a circle, 6567-108945284. The mean solar century, however, began on the previous day, Saturday, 21 March. Deducting one day's value of a, viz. 338-631985412, from the above, we find that at mean sunrise of that Saturday the value of a, or the mean moon's distance from mean sun, was 6228-476959872. This was its value at the beginning of the 37th century K.Y. Hence the first entry in Table XCII below which gives the values at mean sunrise on the day on which each century began. The remaining figures in that Table were obtained by the addition to this valde of the increase of a in a century. (See 8 316 of the same article. The increase of a in a century of 36,525 days is 997678896964, and in & common century of 36,526 days is 0-416684507.] Centuries 38 and 44 were defective centuries; the rest were common ones. For the beginnings of the odd years of centuries Table LXXXVII was used, the value of a there given being added to that for the century. Thus was determined the value of a at mean sunrise of the day on which each mean solar year begins (800 Example 1 below). From this is found the value of a at mean sunrise of the day on which the luni-solar year begins. 326. The first day of the luni-solar year is, according to the general rule, the civil day on which expired the first tithi of the bright half (sukla) of the amanta lunar month Chaitra, i.e. the tithi which begins at the moment of the first new moon after the Mina-8amkranti, or at the moment of the new moon when that amanta lunar month begins within the limits of which the Mesha-sankranti occurs. Having already established the value of a on the day in any year on which mean Mesha-sankranti occurred, we have to subtract from that value the increase of a in whole days between the two dates, the day on which the luni-solar year began being the earlier. The first 30 days' entries in Table LIVA (above, Vol. XV) enable this to be done. We select in that Table the a in col. 3 the value of which is next lower than the a of mean Mosha-sankranti, and the Table then shews in col. 1 the number of intervening days, and therefrom the European day and month, and, by subtraction, also (col. 2), the week-day. Deducting the selected a from the a of mean Mesha-sartkranti, we have the a of mean sunrise of the day, Chaitra sukla 1, on which the mean luni-solar year begins. Thus,-mean Masha-sankranti of the year K.Y. 3700, A.D. 599-600, was shewn in 9 325 to have occurred on (0) Saturday, 21 March A.D. 599, at mean sunrise on which day the mean moon's tithi-index a was 6228-4770. In Table LIVA, amongst the values of a in the first 30 days, it is seen that the next lower value is 6095-3757. 6228-4770-6095-3757=133.10131. Col. 1 shows that the interval of days was 18, and col. 2 shows the week-day 4. Mean Moshasankranti occurred on (0) Saturday. O (or 7)-4=8 Tuesday. It is therefore found that the day Chaitra fuklu ), the first civil day of the mean luni-solar year, was (3) Tuesday, 3 March A.D. 599, and that the value of a at mean sunrise on that day was 133-1013, shewing the currency of the tithi fukla 1. This is the entry in Table XC below. It comes to the same thing if the a of Table XCIII below is added to the a of mean Mosha-sankranti, the Table being prepared for that purpose. The a of mean Mesha All value of a below 888-9 prove the tithi to have been the first of the amanta lunar month, 1.e, the first tithi of the first (Bukla) fortnight.
Page #236
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 209 samkranti was 6228-4770. We select sucb a value of a in col. 3 of that Table as, added to the former, makes a value between 0 and 333-3, the limits of the tithi fukla l; and note the interval of days, and the week-day resulting by addition of the given week-day (col. 2) to the week-day of mean Mesha-sankranti. Here the selected value of a is 3904:6243, since 6228-4770+ 3904-6243=133-1013. The interval of days is 18 (col. 1). The week-day corresponding to the day Chaitra sukla 1 is (0+3 =) 3. The result is the same as obtained by the former process. All the entries in the general Table XC, cols. 19-23, can be proved in this way. To find the exact phase of the mean moon, i.e. the mean tithi-index a, on any day of any year, or at any particular moment of any day, it is only necessary to add to the value of a given in col. 23 of Table XC for the first day of the luni-solar year the amount of increase of a during the intervening whole days, hours, etc., given in Tables LIVA and B (above, Vol. XV). The purnimanta system of lunar months. 327. The amanta lunar month begins at the moment of new moon, the purnimanta month at the moment of full moon a fortnight earlier; so that the fortnight (sukla) between new moon and full moon bears the same month-name by both systems, while the fortnight (krishna) between full moon and new moon bears, in the purnimanta system, the name of the lunar month next after that which it bears in the amanta system. The sukla fortnight of the first lunar month, for instance, belongs to Chaitra by both systems. The following krishna fortnight, however, belongs to Chaitra by the amanta system, but to Vaisakha by the purnimanta system. This should always be borne in mind when examining dates of inscriptions, especially in earlier years. For references to already published explanations see $ 322 above, and for a Table of corresponding fortnights aud lunar months see Indian Calendar, Table II, Part I. The mean moon's nakshatra. 328. The note on this subject already given ( 308) in dealing with calculation by the First Arya-Siddhanta mean system (above, Vol. XVI) applies equally to the Bruhma-Siddhanta mean system. It is unnecessary to repeat it. Tables LXXX and LXXXI, fixing the sun's mean longitude for every day of the mean solar year according to the First Arya-Siddhanta, may safely be used for general calculation by the Brahma-Siddhanta, since the difference between the two authorities in their estimates of the length of the year only amounts to 21 seconds. But in any exceptionally close case the exact value, at mean sunrise of any day in the year, of, or the sun's mean longitude, can be found by multiplying the sun's mean motion in one day (Table XLIII, Vol. XIV above). by the number of days' interval between the day on which mean Mesha-sankranti occurred and the given day. The sun's mean motion in one day by the Brahma-Siddhanta is 59m 8-172655, or in 10,000ths of circle 27.377875426. The Rule for work is as follows. (i) Find, as above, value of "a" at menn sunrise of given day. (ii) Note number of whole days intervening between the day of mean Mosha-sankranti (Table XC below, col. 18, figure in brackets) and the given day. Turn to Table LXXX and note the increase of sun's mean long., "", during that interval. Deduct from this, by Table LXXXI, the increase of long during the hours and minutes stated in col. 17 of Table Xc. The result is the sun's mean long., 8, at mean sunrise of given day. (iii) Add to a. This *, the reqnired index of the mean nakshatra, or the mean moon's place in the heavens at that moment. Table LXVIII above, or Table VIII, Indian Calendar, will shew in which nakshatra the mean moon stood at the time. In yenurument by 10,000ths of circle the total difference in 365 days is 0:0X666, by which amount the Bralna-Siddhanta is the greater.
Page #237
--------------------------------------------------------------------------
________________ 210 EPIGRAPHIA INDICA. [Vol. XVII. The 19-year intercalation cycle. 329. (See Indian Calendar, $ 50, p. 29, and notes in previous articles above on the working of the cycle by different systemis.] The sequence in the present case works perfectly regularly except in four instances. In every case except these, after four successive intercalations of the same lunar month at intervals of 19 years each, the intercalated month gives way to the month next preceding it. The exceptions are-a run of five mean intercalary Bhadrapadas between A.D. 746 and 822, five Asvinas between 952 and 1009, five Karttikas between 1120 and 1196, and five Paushas between 1231 and 1307. Working Tables. 330. For general guidance the following Tables, as given for work by the Arya-Siddhanta (above, Vol. XVI), should be used, or the similar Tables published in the Indian Calendar. Table LXII, or Ind. Cal., Table II, Parts I and II, for names of months and nakshatras. Table LXIIIA, or Ind. Cal., Table III, Part I, for collective duration of mean lunar months. Table LXVIII, or Ind. Cal., Table VIII, for indices of tithis, karanas, nakshatras and yogas. Table LXIX, or Ind. Cal., Table IX, for the serial number of days of the year and their names and numbers in European reckoning. Table LXX, or Ind. Cal., Table X, for conversion of the indices of tithis, nakshatras and yogas into time. Table LXXI. the European Calendar for 23 centuries. [Table XIII, Indian Calendar, may also be used, but the former is easier.] Table XCI below gives the collective duration of mean solar months, measured from the moment of mean Mosha-samkranti, the astronomical beginning of the mean solar year; also the increase of a, the mean tithi-index, during the interval. Table XCII shews the value of a at the beginning of each mean solar century of the Kaliyuga, that is to say, its value at mean sunrise of the day on which each such solar century began. For odd years of such centuries Table LXXXVII (above, Vol. XVII) is to be used in con. junction with Table XCII, addition of the two given values of a yielding the value of a at menn sunrise of the day on which each mean year of the Kaliyuga solar century began. For increase of a in subsequent days, hours, etc., in any K.Y. year, or any moment of any day Tables LIVA and B (above, Vol. XV) are to be used. The use of Table xCill is explained in 9 326 above. Table XCIV-A to enables the units and decimals of units of results obtained from our system of reckoning in measurement by 10,000ths of a circle, to be converted readily into time, if required. The same can be converted into space-measurement in degrees, etc., by Table XLVB (above, Vol. XIV). EXAMPLES. [N.B.-Work may always be done in whole numbers, resorting to decimals only in close cases.] Example 1. To find the mean tithi-index, or phase of moon, at mean sunrise of the day on which mean Mesha-sansktanti occurred in any year. This is a necessary operation for finding the tithi-index a at the moment of mean Meshasankranti, which is obtained by addition of the a of subsequent hours, minutes, etc., to the a
Page #238
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 211 of mean sunrise. [The intercalation of lunar months is decided by the value of a at the moment of mean Mosha-sankranti.] Two cases are considered, A and B. A. Take the year Kaliyuga 3851 expired. This was the Saka year 672 expired. It began (Table XC, cols. 13-17) astronomically at 5h 49m 39after mean sunrise on Sunday, 22 March A.D. 750. We want to know the moon's phase, as shewn by the tithi-index a, at mean sunrise of that day. ["w.-d."=week-day.] W.-d. a. (Table XCII.) At beginning of K.Y. Century 38, mean sunrise (0) 5100-3761 (Table LXXXVII.) At beginning of K.Y.year 51, do. (1) 8036 6243 At mean sunrise on the Sunday in question . . (1) 3137.0004 B. The year K.Y. 3849, Saka 670 both expired. This began (Table XC) at 176 250 21 after mean sunrise on Thursday, 21 March A.D. 748. The first result shews the a for mean sunrise on Friday, 22 March, and the a for one day has to be deducted. This is due to the fact that Table LXXXVII has to serve for all K.Y. centuries, common or defective. The correction required is never more than that for one day. (Table XCII.) At beginning of K.Y. Century 38, mean sunrise (0) 5100-3761 (Table LXXXVII.) At beginning of K. Y. year 49, do. (6) 835-2749 At mean sunrise on Friday, 22 Mar. . Deduct one day's value of a . . . . . . . . . (6) 5935 6510 .-(1) -338 6320 At mean sunrise on Thursday, 21 Mar. . . . . (5) 5597.0190 E.cample 2. To find the civil day corresponding to Chaitra sukla 1, or the first civil day of the luni-solar year; and the value of a (place of mean moon) at mean sunrise thereon. The civil day corresponding to mean Chaitra bukla 1 is that on which the mean tithi" fukla l" expired. The tithi-index (a=) 333 3 marks the last instant of the first sukla tithi, so that we have to find a day on which at mean sunrise the tithi-index a was between 0 and 333-3. The amanta lunar month called "Chaitra" begins with the first new moon after the Mina-samkranti, and the civil day called "Chaitra bukla 1" is necessarily earlier than the day on which mean Mesha-sankranti occurred. We have to find the number of days' interval between these two days. There are two ways of ascertaining these points, one by using Table XCIII and adding its figures, one by using Table LIVA and subtracting its figures. (i) Take the year in Example 1, A, above. The value of a at mean sunrise of Sunday, 22 March A.D. 750, was found to be 3137.0004. We turn to Table XCIII and select in col. 3 such a value of a as, added to 3137.0004, will result in total value of a between 0 and 333-3. This is found to be 6952 3121, the sum of the two (always disregarding quantities over 10,000) being 89-3125. The interval of whole days from mean Mesha-sankranti day was 9 (col. 1). Adding the number of the week-day (col. 2), viz. 5, to the week-day of mean Mashasarkranti, viz. 1 Sunday, we have the week-day 6 Friday. Mean Mesha-sankranti occurred on Sunday, 22 March; and, therefore, it has been determined that the day Chaitra sukla 1, the first day of the luni-solar year, was Friday, 13 March A.D. 750, on which day, a being 89-3125, Chaitra Sukla 1 was the current tithi at mean sunrise. Similarly in Example 1, B. At mean sunrise of (5) Thnrsday, 21 March A.D. 748, a was 5597.0190. Add (Table XCIII, col. 3) 45818882. Result 178.9072. The interval of daya was
Page #239
--------------------------------------------------------------------------
________________ 212 EPIGRAPHIA INDICA. [Vol. XVII. (col. 1) 16. The week-day number was 5. The week-day of 21 March was 5 (Thursday). Hence the week-day 16 days earlier was 5+5=3 Tuesday. So the beginning of the mean luni. solar year was on Tuesday, 5 March A.D. 748, on which date at mean sunrise the mean tithi "Sukla 1" was current, the value of a at that moment being 178-9072. The entries in Table XC against these years correspond to these results. (ii) The same results are obtained by using Table LIVA (above, Vol. XV) and deducting the figures for the interval of whole days between the two occurrences. We note that value of a in the first 30 days of that Table which is next lower than the value of a already found for the day of mean Mesha-samkranti, and deduct the former from the latter. The number of intervening days (col. 1) and the number of week-days (col. 2) stand against the selected entry. This week-day number is deducted, of course, from the week-day of mean Mosha-sankranti. ThusA. For K.Y. 3851, A.D. 750. w.-d. a. (Example 1, A.) For mean sunrise on Sunday, 22 March (1) 3137.0004 A.D. 750. (Table LIVA.) Next lower value of a, and week-day -(2) -3047.6879 At mean sunrise of the day Chaitra fukla 1 . . . (6) 89-3125 The interval of days (col. 1) was nine. 6=Friday. Hence the day corresponding to Chaitra sukla i was Friday, 13 March, and at mean sunrise the mean tithi Chaitra fukla 1 was current, the value of a being 89-3125. B. For K.Y. 3849, A.D. 748. (Example 1, B.) At mean sunrise on Thursday, 21 March (5) 5597-0190 A.D. 748. (Table LIVA.) Next lower value of a, and week-day .-(2) --54181118 At mean sunrise of the day Chaitra sukla 1 . . . (3) 178-9072 The interval of days was 16.3=Tuesday. Hence the day corresponding to Chaitra sukla 1 was Tuesday, 5 March A.D. 748, and at mean sunrise the value of a was 178.9072. These results are the same as those found by the former process. The examples enable any worker to prove the correctness of all my entries in cols. 19-23 of the general Table XC below. Example 3. To find if a lunar month was or was not intercalated in the given year. It will be enough, for this problem, to refer to Example 3 (above, Vol. XVI) of my article on the Arya-Siddhanta-mean system. The work here is precisely similar ; but for the values of a for hours and minutes Table LIVB (Vol. XV above) should be used, and Table XCI for the advance of a during the mean solar months, etc. Example 4. To find the mean tithi-index a, shewing phase of moon, at mean sunrise of any day in the year; or at any moment of any day. Table XC (colo. 19-23) gives the civil day corresponding to mean Chaitra bukla 1 (the initial day of the mean luni-solar year), its serial number in brackets) from January 1st of the equivalent A.D. year, and the mean tithi-index at mean sunrise. Calculate by Table III, Indian Calendar, or by Table LXIIIA (above, Vol. XVI) the interval of whole days from that day to the given day, and, if necessary, the excess of hours, minutes, etc., to the given moment on that day. Add the increment of a for the interval of whole days from Table LIVA and for fractions of days from Table LIVB to the a, as above, of the initial day; as also the number of days' interval and the corresponding week-day.
Page #240
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 213 2.g. Required the tithi-index at mean sunrise of the day called "Abhadha fulla 4" in Saka 547 expired, or A.D. 625-26, and the corresponding A.D. day and week-day. In this year there was no intercalated month. The interval from the day "Chaitra sukla 1" to the day "Ashadha sukla 4" is approximately (Table LXIII-A above, p. 335) 93 days. We try this d. w.-d. a. Table xc. Chaitra sukla 1, mean sunrise , . (74) (6) 1846506 *Table LIVA for 93 days . . . . . +(93) (2) 1492.7746 (167) (1) 1677-4252 This value of "a" (Table LXVIII) shews that the 6th fukla tithi was current at mean sunrise. .Deduct for 2 days . . . -(2) -(2) -677-2640 At mean sunrise on Ashadha fukla 4 . . . (165) (6) 1000-1612 Table LXVIII or VIII Indian Calendar, shews the currency of the 4th fukla tithi, at that mean sunrise, since its first point is when a=1,000. Day 165 was (Table IX, Indian Calendar, or LXIX, above) 14th June A.D. 625. 6=Friday. We learn, however, that the 4th mean tithi had begun only about of a minute before the moment of mean sunrise ; BO that if the basis of calculation had been the moment of true sunrise (a little earlier than mean sunrise) the corresponding day might have been Thursday, 13 June. Erample 5. To find the nakshatra, or place in the heavens of the mean moon, at mean wunrise of any day or of any later moment in the day. Take the case in the last example. It is required to find the value of " ". the nakshatraindex, at mean sunrise of the day called, in the mean system, "Ashadha fukla 4" in the given year, A.D. 625. The mean tithi-index, "a", at that mean sunrise was found to be 1000 1612. Since s+a=n (8 327 above), we have to ascertain the value of "8", the sun's mean longitude at that moment. The day, 14 June, was the 165th day after Jan. 1 in that year. Mean Mesba-sankranti had taken place on (Table XC, cols. 13-17) the 79th day at 22h 30m 54' after mean sunrise. The day 14 June was (165-79) 86 days later. We proceed as follows: 2354-4957 Table LXXX, p. 444. Interval of 86 days Less (Table LXXXI) for 22h. . . . . . . . 25.0964 0-5704 0-0171 25-6839 -25-6839 At mean sunrise on the day Ashadha bukla 4 sun's mean long., "," = Ada "a" as already found for that moment . . . . . 2328-8118 1000-1612 At mean sunrise on that day "9"= . . . . . . 3328-9730 This last is the required nakshatra-index. Reference to Table VIII, Indian Calendar, or Table LXVIII (above Yol, XVI) shews that the moon was then in the nakshatra Aglesha by the
Page #241
--------------------------------------------------------------------------
________________ 214 EPIGRAPHIA INDICA. [VOL. XVII. equal-space system of division of the ecliptic, which ended when "n" =33333; but that by the system of Garga or the Brahma-Siddhanta (our present authority) she was in Magha, of which the ending points are respectively 35185 and 3477-1. Converted into degrees (Table VIII-B, Indian Calendar, or Table XLV-B, above) the moon at that mean sunrise stood at about 119deg51'. For the value of "n" at any later hour of the given day the index-value for the time since mean sunrise must be added (Table LXXXI) to the "n" of mean sunrise. At about 3 hours 50 min. after mean sunrise, for instance, the mean moon entered, Magha by the equal-space system; for the beginning point of that nakshatra is 3333-3. The increase of "n" in 3 hours 50 min. is 4.3728, and 3328-9730+4-3728-3333-3458. Example 6. To find the yoga, "y", at the same moment as in Example 5. The formula for finding the yoga-index is either s+n="y", the yoga-index; or, in cases where it is not necessary to calculate n (the nakshatra), 2 "s"+a="y". Here, at mean sunrise on 14 June A.D. 625, we have found ""-2328-8118 and "n"=3328-9730. The yoga-index, "y", therefore, =5657-7848; and reference to Table VIII, Indian Calendar, cols. 12-13, or Table LXVIII (above, Vol. XVI, cols. 6, 8, 9, 10), shews that the mean moon was at that moment in the yoga Siddhi. Again 2 sm4657-6236, and this +"a," which was found to be 1000-16125657-7848, the same as before.
Page #242
--------------------------------------------------------------------------
________________ No. 15.) THE BRAHMA-SIDDHANTA: MEAN SYSTEM. ____215 TABLE XC. REMARKS. K.Y. 3736 expired, A.D. 635-36. A very close case in the matter of intercalation of lanar month. Mean new moon occurred about 2m after the moment of the Karka-sankranti (mean Bun at long. 90deg), and, therefore, at that moment the mean moon was waning, while she was wax. ing at the next, Simba-sankranti (mean sun at 120deg). Accordingly the intercalated month was Sravana. K.Y. 3923 expired, A.D. 822-23. According to the 19-year sequence of intercalations the same month is generally intercalated four times running, i.e. at intervals of 19 years each. Here, however, is an instance of a fifth intercalation of the same month. [See 329 of text above.] K.Y. 4110 expired, A.D. 1009-10. A similar case. Asvina intercalated for the fifth time. K.Y. 4297 expired, A.D. 1196-97. Another. Karttika intercalated for the fifth time. K.Y. 4408 expired. A.D. 1307-08. Another. Pausha intercalated for the fifth time. This was a very close case. The moment of mean new moon was about 1 minute after the mean sun reached the Dhanus-samkranti (mean eun at long. 240deg), but she was actually waning at the moment of the sankranti and was waxing at the next, Makara, sankranti. Consequently the lunar month Paasba was intercalated.
Page #243
--------------------------------------------------------------------------
________________ 216 EPIGRAPHIA INDICA. [Vol. XVII. TABLE MEAN SYSTEM TABLE, Numbers of columns conform (Cols, 1 to 4.)-The years herein stated are the current years corresponding (Cols, 6 and 7.)-Samvatsara-names of mean solar years in italics shew cases CONCURRENT YEAR. JOVIAN SAMVATSARA. Mean intercalated (adhika) lanar month. Kali. Saks Meshadi solar year in Bengal. Kollam. A.D. Chaitradi Vikran.... Southern system. Northern system. 1 2 4 8701 599-600 8702 . 2 Vaisakha 8703 *600-01 601-02 602-03 8704 10 Pausha 3705 603-04 . . . . 3706 *604-05 3707 605-06 7 Asvina 3708 606-07 . . 8709 607-08 608-09 . 3 Jyeshtha 3710 8711 50 Anala 51 Pingala . 52 Kalayukta 53 Siddharthin. 54 Randra . 55 Durmati . 56 Dandubhi. 57 Radhirodgarin 58 Raktaksha. 59 Krodhana. 60 Kabaya . 1 Prabhava . 2 Vibbers . 3 sukla 4 Pramoda . 5 Prajapati 8 Angiras . 7 Srimukha. 8 Bhara 9 Yuvan . 3712 . . . 12 Pbalguna 8718 8 Karttiks 609-10 610-11 611-12 -612-13 618-14 614-15 615-16 *616-17 017-18 618-19 , . . . 5 Srivasa 3718 3719 8720 .
Page #244
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 217 xc. BRAHMA-SIDDHANTA. to Table I, "Indian Calendar." to the A.D. years in col. 5; as in Table I, "Indian Calendar." where differences exist from Surya-Siddhanta nomenclature in true solar years. COMMENCEMENT OF THE MEAN SOLAB YEAR. MEAN LUNI-BOLAR YEAR (MEAN SUNRISE OF THE CIVIL DAT ON WHICH CHAITRA SUKLA I ENDS). Kali. Day and month, A.D. Time of Week-day. mean Mesha sankranti. Day and month, A.D. Week-day. a (heret, the index of the titht). 13 14 20 23 . 133-1013 3701 8.8241 3702 O Sat. . 1 San. 2 Mon. 8 Tues. 5 Thur. .8 Tues. Sat. 6 Pri. 4 Wed. 8 Taes. .1 43.5065 8703 3704 257-8614 292-5437 8705 6 Fri. 0 Sat. 168-2666 3706 0 Sat. 18 43-3394 3707 4 Wed. 3 Taes. . 78-6718 3708 1 San. 8709 293.0266 168-7494 17 19 H. M. S. 5 15 0 3 Mar. (62) 11 27 9 20 Feb. (51) 17 39 18 10 Mar. (69) 51 27 28 Feb. (59) . 1 8 36 19 Mar. (78) 7 Mar. (67) 54 24 Feb. (55) 3 15 Mar. (74) 6. 12 6 Mar. (64) 18 4 21 22 Feb. (53) 19 80 12 Mar. (71) 39 1 Mar. (80) . 7 40 48 20 Mar. (79) 57 9 Mar. (69) 8 26 Feb. (57) . 2 17 15 17 Mar. (76) 24 6 Mar. (65) 41 33 24 Feb. (55) 42 13 Mar. (72) 8 613 Mar. (62) . 21 Mar. (80) 20 Mar. (80) . 20 Mar. (79) 20 Mar. (79) 21 Mar. (80) 20 Mar. (80) 20 Mar. (79) 21 Mar. (80) 21 Mar. (80) 20 Mar. (80) 20 Mar. (79) . 21 Mar. (80) 21 Mar. (80) 20 Mar. (80) 20 Mar. (79) 21 Mar. (80) 21 Mar. (80) 20 Mar. (80). 20 Mar. (79) . 21 Mar. (80) 3710 Mon. 8 Taos. 4 Wed. 5 Thur. O Sat. San. 2 Mon. 5 Thur. 4 Wed. 203-4218 . . 3711 . 79-1547 3712 113-8371 3713 18 . 828-1918 1 Sun. O Sat. 5 Thur. 2 Mon. 1 San. 5 Thnr. 3 Tuor. 20 - 203-9147 3714 8715 8716 3717 Thur. 238-5972 8 114-3199 Sat 3 Taes. 328-6747 8718 . . Sun. 20 1 San. 24-7252 3719 8 Fri. 239.0801 ST20
Page #245
--------------------------------------------------------------------------
________________ 218 EPIGRAPHIA INDICA. [VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SARVATSARA. kali. Moan intercalatel (adhika) lanar month. Saka Chaitradi Vikrame. Meshauli solar year in Kollam. Southern system. Northern system. 8a 3721 619-20 . . 1 Chaitra 8722 *620-21 10 Dhatri . 11 Isvars . 19 Bahudhanya . . . 8723 10 Pansha 621-22 622-23 *724 13 Pramatbin. . 3725 623-24 . . 14 Vikrama 15 Vrisha g 3726 +624-25 6 Bhadrapala 3727 625-28 16 Chitrabhanu . 3728 3729 3 Jyeshtha 9730 626-27 627-28 *628-29 629-30 630-31 . . . 3731 11 Magha 8732 17 Subbanu 18 Tarana . 19 Partbiva . 20 Vyaya . 21 Sarvajit . 22 Sarvacbarin 23 Virodhin . 24 Vikrita . 25 Kbars 26 Nandana . 3733 631-32 3734 *632-33 . . 8 Karttika S 8735 633-34 . 8736 634-35 . . . 635-86 5 Sravanas 3737 8798 8739 *636-37 27 Vijaya 28 Jaya 637-38 8740 I 1 Chaitra 638-39 639-40 20 Manmatha 80 Darmukha S 640-41 . 10 Pausbs 641-42 642-43 31 Hemalamba 32 Vilamba . 38 Vikarin . 34 sarvarin . *744 S S . . . 3745 643-44 . 6 Bhalmpalo. $ See " kemurls," p. 215 above
Page #246
--------------------------------------------------------------------------
________________ No. 15.] XC-contd. Day and month, A.D. 13 MEAN SOLAR YEAR. 21 Mar. (80). 20 Mar. (80). 20 Mar. (79) 21 Mar. (80) 21 Mar. (80) * 20 Mar. (80) 20 Mar. (79) 21 Mar. (80) 21 Mar. (80) 20 Mar. (80) 20 Mar. (79) 21 Mar. (80) 21 Mar. (80) 20 Mar. (80) 21 Mar. (80) 21 Mar. (80) 21 Mar. (80) 20 Mar. (80) 21 Mar. (80) 21 Mar. (80) 21 Mar. (80) 20 Mar. (80) 21 Mar. (80) 21 Mar. (80) 21 Mar. (80) . . . " . . . . THE BRAHMA-SIDDHANTA: MEAN SYSTEM. . Week-day. 14 4 Wed. 5 Thur. 6 Fri. 1 Sun. 2 Mon. 8 Tues. 4 Wed. 6 Fri. O Sat. 1 Sun. 2 Mon. 4 Wed. 5 Thur. 6 Fri. 1 Sun. 2 Mon. 8 Tues. 4 Wed. 6 Fri. 0 Sat. COMMENCEMENT OF THE 1 Sun. 2 Mon. 4 Wed. 5 Thur. 6 Fri. . . Time of mean Meshasamkranti. H. 17 M. S. 9 18 15 30 21 42 18 3 54 27 10 6 36 16 18 45 22 30 54 4 43 3 10 55 12 NO 2 1 0 7 8 0 17 7 21 23 19 30 0 5 31 39 9 11 43 48 0 8 ph che chee 17 55 57 6 20 15 6 12 32 24 13 21 18 44 33 19 83 0 56 42 8 51 0 9 1 45 18 7 57 27 24 9 36 MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF THE CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Day and month, A.D. 19 20 Feb. (51) 10 Mar. (70) 27 Feb. (58) 18 Mar. (77) 8 Mar. (67) 25 Feb. (56) 15 Mar. (74) 4 Mar. (63) 22 Feb. (53) 12 Mar. (72) 1 Mar. (60) 20 Mar. (79) 9 Mar. (68) 27 Feb. (58) 16 Mar. (75) 6 Mar. (65) 23 Feb. (54) 13 Mar. (73) 2 Mar. (61) 20 Feb. (51) 11 Mar. (70) 28 Feb. (59) 18 Mar. (77) 7 Mar. (66) 25 Feb. 56) + Week-day. 20 3 Tues. 2 Mon. 6 Fri. 5 Thur. 3 Tues. O Sat. 6 Fri. 3 Tues. 1 Sun. O Sat. 4 Wed. 3 Tues. 0 Sat. 5 Thur. 8 Tues. 1 Sun. 5 Thur. 4 Wed. 1 Sun. 6 Fri. 5 Thur. 2 Mon. 1 Sun. 5 Thur 3 Tues. a (here=t, the index of the tithi). 23 114.8028 149.4852 25-2081 59-8904 274.2453 149-9682 184-6506 60.3734 274-7282 309-4106 185-1334 219-8158 95.5387 309-8935 5.9439 220-2987 96.0216 130-7040 6-4268 220-7816 255-4640 131-1868 165-8692 41.5921 255-9470 219 Kali. 1 3721 8722 3723 3724 8725 3726 3727 3728 3729 3780 3731 3732 3738 3734 3735 3736 3737 3738 3739 3740 3741 3742 3743 3744 3745
Page #247
--------------------------------------------------------------------------
________________ 220 EPIGRAPHIA. INDICA. [Vol. XVII. TABLE CONCURRENT YEAR. JOVIAN SAUVATBABA. Mean intercalated (adhika) lunar month. Kali. Meshadi solar year in Bengal. Chaitradi Vikrama. Kollam. A.D. Southern Bystem. Northern system. 3746 . *644-45 645-46 3747 3748 646-47 . 3 Jyesbtha 3749 647-48 . . 3750 *648-49 11 Magba 3751 649-50 650-51 3752 3753 . . . 651-52 . 8 Karttika 8754 *652-53 . . 3755 653-54 . . . . 654-55 4 Ashadha 3756 3757 655-56 8758 35 Plava . 36 Sabhakrit. 97 sobhana . 38 Krodhin . 39 Visvavasu + 41 Plaranga. 42 Kilaka . 43 Saumya . 44 Sadharana 45 Virodhakrit 46 Paridhavin 47 Pramadin. 48 Ananda 49 Rakabasa . 50 Anala 51 Pingala : 52 Kalayakta. 53 Siddharthin 54 Raadra . 55 Durinati . 56 Dandabli . 57 Radhirodgarin 58 Raktaisia. 59 Krodhana. 60 Kshaya . 3759 . . 1 Chaitra *656-57 657-58 658-59 659-60 . 3760 3761 . 9 Margasira . 3762 *660-61 661-62 : . . . . D . 662-63 3763 3764 3765 8766 6 Bhadrapada. 663-64 #664-65 665-66 . . 3767 . 2 Vasakba .. 666-67 3788 8769 3970 867-68 . . . . .11 Migha 1 ... *668-69 + 40 Parabhava was suppressed, both in new and true reckoning
Page #248
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 221 xc-contd. COMMENCEMENT OF THE MEAN SOLAR YBAB. MZAY LUNI-SOLAR YEAR (MEAN SUNRISE OP TE CIVIL DAY ON WHICE CHAITRA SUKLA 1 ENDS). Kali. Day and month, A.D. Tiine of Week-day. mean Mesha samkranti. Day and month, A.D. Week-day. a (here=t, the index of the tithi). 13 17 19 20 23 Mon. 290-8293 3746 . . . O Sat. 2 Mon. 3 Tues. 166-3522 3747 6 Fri. .3 Toes. 2 Mon. 42-0750 3748 1900 4 Weil. 767673 3749 M. . 20 21 45 15 Mar. (75) 4 Mar. (63) 3 21 Feb. (52) 12 12 Mar. (71) 1 Mar. (61) 80 20 Mar. (79) 39 9 Mar. (68) 15 46 48 26 Feb. (57) 5716 Mar. (76) 5 Thur. o Sat. 2911122 3750 6 Fri. 325-7946 0 Eat. 1 San. 2 Mon. . . . 3752 3 Taes. o Eat. 201.5175 77-2402 3753 3 Tues. 0 Sat. : 111-9227 5 Thur. . 326-2775 4 Wed. 1 Sun. 3754 3755 3756 6 Fri. . . . 1000 0 Sat. Sat. 20 Mar. (80) 21 Mar. (80) 21 Mar. (80) 21 Mar. (80). 20 Mar. (80) 21 Mar. (80) 21 Mar. (80) 21 Mar. (80) 20 Mar. (80). 21 Mar. (80) 21 Mar. (80) . 21 Mar. (80) 20 Mar. (8C) 21 Mer. (80) 21 Mer. (80) 21 Mar. (80) 20 Mar. (80). 21 Mar. (80) 21 Mar. (80) 21 Mar. (80). 21 Mar. (81) 21 Mar. (80). 21 Mar. (80). 21 Mar. (80). 2. Mar. (81) . 3757 202.0003 236-6827 112.4056 326-7604 1 Sun. 4 Wed. 3758 . 3 Tues. 2 Mon. 3759 4 Wed. 22-8108 3760 5 Thur. 17 0 Eat. 6 Tur. 4 Wed. 8761 . 6 Fri. . 28 2871656 271-8440 147-5708 3762 23 Feb. (54) 14 Mar. (73) 2 Mar. (62) 42 20 Feb. (51) 51 10 Mar. (69) 24 0 28 Feb. (59) 86 918 Mar. (78) Mer (68) 27 24 Feh. (55) 36 15 Mar. (74) 24 45 4 Mar. (81) Feb. (52) 8 12 Mar. (71) 121 Mar. (60) 13 21 19 Mar. (79) 1 San. 3763 2 Mon. 23-2937 . 3764 3765 3 To.. 1 Snn. 5 Thur. 4 Wed. 2 Mon. 6 Pri. . 18 57 9761 5 Thor. 272-3310 3766 8767 6 Fri. 148-0587 5 Thur. . 1827361 8768 . 0 Sat. 1 1 bna. . 3 Tues. 58-4590 2 Mon. 1 San. . . 1 3769 3770 93-1413 2 H
Page #249
--------------------------------------------------------------------------
________________ 222 Kali. Saka. 3790 3791 8792 3798 3794 8795 co Chaitradi Vikrama. co Meshadi solar year in Bengal 3a 592 727 76 3771 3772 593 798 77 3773 594 729 3774 595 730 3775 596 731 80 78 79 3776 597 732 81 3777 598 733 82 3778 599 734 83 8779 600 735 84 3780 601 736 85 602 737 86 87 3781 8782 603 738 3783 604 739 3784 605 740 3785 606 741 90 88 89 8786 607 742 8787 608 743 92 3788 609 744 93 3789 610 745 94 611 746 612 747 613 748 614 749 615 750 616 751 91 95 388 38 99 100 EPIGRAPHIA INDICA. CONCURRENT YEAR. Kollam. 4 A.D. 5 669-70 670-71 671-72 #672-73 673-74 674-75 675-76 #676-77 677-78 678-79 679-80 #680-81 681-82 682-83 683-84 #684-85 685-86 686-87 687-88 #688-89 689-90 690-91 691-92 #692-98 693-94 JOVIAN SAMVATSARA. Southern system. 6 Northern system. 1 Prabhava 2 Vibhava 3 Sukla 4 Pramoda 5 Prajapati 6 Angiras 7 srimukha 8 Bhava 9 Yavan 10 Dhatri 11 Isvara 12 Bahudhanya 13 Pramathin 14 Vikrama 15 Vrisha 16 Chitrabhanu 17 Subhanu . 18 Tarana 19 Parthiva 20 Vyaya 21 Sarvajit 22 Sarvadharin 23 Virodhin 24 Vikrita 25 Khara . 7 [VOL. XVI. TABLE Mean intercalated (adhika) lanar month. 8a 7 Asvina 4 Ashadha 1 Chaitra 9 Margasira .. 6 Bhadrapada. ... 2 Vaisakha 11 Magha 7 Asvina ... 4 Ashadha
Page #250
--------------------------------------------------------------------------
________________ No. 15.] XC-contd. Day and month, A.D. 13 MEAN SOLAR YEAR. 21 Mar. (80). 21 Mar. (80). 21 Mar. (80) 21 Mar. (81) 21 Mar. (80). 21 Mar. (80) * 21 Mar. (80) 21 Mar. (81). 21 Mar. (80) 21 Mar. (80). 21 Mar. (80) 21 Mar. (81). 21 Mar. (80). 21 Mar. (80) . 21 Mar. (80). 21 Mar. (81) 21 Mar. (80). 21 Mar. (80) 21 Mar. (80). 21 Mar. (81). 21 Mar. (80) 21 Mar. (80) 21 Mar. (80) 21 Max. (81) . 21 Mar. (80). * THE BRAHMA-SIDDHANTA: MEAN SYSTEM. * Time of Week-day. mean Meshasamkranti. 14 4 Wed. 5 Thur. 6 Fri. 1 Sun. 2 Mon. 8 Tues. 4 Wed. 6 Fri. O Sat. 1 Sun. 2 Mon. 4 Wed. 5 Thur. 6 Fri. O Sat. 2 Mon. 3 Tues. 4 Wed. 5 Thur. 0 Sat. 1 Sun. 2 Mon. 8 Tues. 5 Thur. 6 Fri. . . COMMENCEMENT OF THE . * 17 H. M. 8. 7 25 30 13 37 39 19 49 48 57 8 14 6 14 26 15 20 38 24 2 50 33 2 1 9 15 14 51 21 27 0 3 89 9 51 18 17 Mar. (76) 5 Mar. (65) 23 Feb. (54) 13 Mar. (72) 3 Mar. (62) 20 Feb. (51) 2 42 10 Mar. (69) 27 Feb. (58) 18 Mar. (77) 7 Mar. (67) 24 Feb. (55) 8 27 15 Mar. (74) 4 Mar. (68) 22 Feb. (58) 12 Mar. (71) 1 Mar. (60) 20 Mar. (79) 8 Mar. (68) 5 16 21 11 28 30 26 Feb. (57) 17 40 39 17 Mar. (76) 6 Mar. (65) 28 52 48 64 57 18 17 6 23 Feb. (54) 13 Mar. (72) 16 9 22 15 36 4 27 45 10 89 54 16 52 8 MRAN LUNI-SOLAR YEAR (MEAN SUNRISE OF THE CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). 28 4 12 Day and month, A.D. 19 9 Mar. (68) 26 Feb. (57) Week-day. 20 6 Fri. 3 Tues. 2 Mon. 6 Fri. 4 Wed. 2 Mon. O Sat. 4 Wed. 3 Tues. O Sat. 6 Fri. 4 Wed. 1 Sun. O Sat. 4 Wed. 2 Mon. 1 Sun. 5 Thur. 4 Wed. 1 San. 6 Fri. 5 Thur. 2 Mon. 6 Fri. 5 Thur. . a (heret, the index of the tithi). 23 307-4962 183.2190 217-9015 93-6242 307-9791 4.0295 218-3843 94.1071 128-7896 4.5124 89-1947 258-5496 129-2725 163-9549 39-6776 254-0825 288-7149 164-4377 199-1200 74-8430 289-1978 328-8802 199-6080 76-3259 110-0082 223 Kali. 1 3771 3772 3773 3774 3775 3776 3777 3778 3779 3780 8781 3782 3783 3784 3788 3786 3787 3788 3789 8790 8791 8798 9798 8794 8985 2 x 2
Page #251
--------------------------------------------------------------------------
________________ 224 Kali. Saka. 1 2 co Chaitradi Vikrams. Meshadi solar year in Bengal. 3a 3796 617 752 101 3797 618 753 102 3798 619 754 103 3799 620 755 104 3800 621 756 105 3801 622 757 106 8802 623 758 107 3803 624 759 108 3804 625 760 109 761 110 3805 626 3806 627 762 111 3807 628 763 112 3808 629 764 113 3809 630 765 114 3810 631 766 115 3811 632 767 116 3812 633 768 117 3813 634 769 118 3814 635 770 119 3815 636 771 120 3816 637 772 121 3817 638 773 122 3818 639 774 123 3819 640 775 124 3820 641 776 125 CONCURRENT YEAR. Kollam. EPIGRAPHIA INDICA. 4 A.D. 5 694-95 695-96 #695-97 697-98 698-99 699-700 *700-01 701-02 702-03 703-04 *704-05 705-06 706-07 707-08 *708-09 709-10 710-11 711-12 #712-13 713-14 714-15 715-16 *716-17 717-18 718-19 JOVIAN SAMVATSARA. Southern system. 6 Northern system. 26 Nandana 27 Vijaya 28 Jaya. 29 Manmatha 30 Durmukha. 31 Hemalamba 32 Vilamba 33 Vikarin 34 Sarvarin 35 Plava. 36 Subbakrit 37 Sobhana 38 Krodhin 39 Visvavasu 40 Parabhava. 41 Plavanga 42 Kilaka 43 Saumya 44 Sadbarapa 45 Virodhakrit 46 Paridhavin 47 Pramadin 48 Ananda 49 Rikshan 50 Anala 7 [VOL. XVII. TABLE Mean intercalated (adhika) lunar month. 8a 12 Phalguns 9 Margasira 5 Sravana 2 Vaisakha 10 Pausha ... 7 Asvina 4 Ashadha ... 12 Phalguns 9 Margaira !!
Page #252
--------------------------------------------------------------------------
________________ No. 15.) THE BRAHMA-SIDDHANTA: MEAN SYSTEM. XC-contd. COMMENCEMENT OF THE MBAN SOLAR YEAR. MAAX LUNI-SOLAR YSAB (MEAN SUNRISE OY THS CIVIL DAY ON WHICH CEAITRA SUKLA 1 ENDS). Day and month, A.D. Time of Week-day. mean Mosha sankranti. Day and month, A.D. Woek-day. -day. a (here=t, the index of the tithi). 14 19 20 28 8796 824-3631 20-4135 . 8797 1 San. 6 Fri. 8798 O Sat. 2 Mon. . 8 Tues. 4 Wed. 5 Thur. O Sat. . 1 San. 2347683 110-4911 3799 8 Tues. 2 Mon. 6 Fri. 145-1785 8800 20-8968 8801 285-2512 3803 21 Mar. (80) 28 Mar. (81). 21 Mar. (81) . 21 Mar. (80). a Mar. (80) 29 Mar. (81) 81 Mar. (81) . (80). 21 Mar. (80) 22 Mar. (81). 21 Mar. (81). 21 Mar. (80). 21 Mar. (80) . 22 Mar. (81) . 21 Mar. (81). . 4 Wed. . 3 Toes. 2 Mon. 269-9386 8808 0 Sat. 145-6564 A804 Wed. 21-3792 8805 Taos 56-0616 8800 8807 270-4164 H.M.S. 3 Mar. (62) 24 21 Mar. (80) 10 Mar. (70) 27 Feb (58) 18 Mar. (77) 7 Mar. (66) 9 25 Feb. (56) 18 15 Mar. (74) 4 Mar. (63) 38 21 Feb. (52) 45 11 Mar. (71) 1 Mar. (60) 8 20 Mar, (79) 12 Mar. (88) 26 Feb. (57) 80 18 Mar. (76) 43 89 8 Mar. (65) 48 28 Feb. (54) 57 18 Mar. (73) 82 Mar. (61) 22 32 15 21 Mar. (80) 44 24 10 Mar. (69) 10 56 33 28 Feb. (59) . 17 8 42 18 Mar. (77) . | 23 20 61 Mar. (66) Suz, Eat. 8808 A Wod. 805:0988 180-8217 8809 8810 1 San. 56-5446 Set. 91.2269 8811 8 Tues. . 5 Thur. 6 Fri. . O Sat. . 1 Sun. . 3 Taes. . 4 Wed. 6 Thur. 6 Fri. . 1 San. 2 Mon. . 8 Tue. .' Wed. . 6 Fri. . Sat. .1 San. 2 Mon. . 6 Thar. 21 Mar. (80). 23 Mar. (81) . 8818 805-5817 181-8048 2 Mon. 3818 215-9869 8814 91-7098 8816 128-8922 . 1 San. . 5 Thur. 4 Wed. 1 San. 6 Fri. 5 Thar. 2 Mon. 3816 8817 21 Mar. (80). 21 Mar. (80). 28 Mar. (81) . 21 Mar. (81) . 21 Mar. (80) Mar. (80) 9-1150 216-4698 8818 3819 . 251-1882 126-8761 8820
Page #253
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [VOL. XVII TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Mean intercalated (adhika) lunar month. Kali. Meshidi solar yaar in Bengal. Kollam. A.D Chaitridi Vikram Southern system. Northern ayseth. Sa 719-20 . 5 Sravana 8821 2892 . . . . 3828 *720-21 721-22 722-23 723-24 3824 2 Vaisakhs . 3825 3826 *724-25 . . . 10 Pausba 3827 8828 . . . . 8829 7 Aavina 8830 . . 725-26 726-27 727-28 *728-29 729-80 730-31 731-32 *732-33 733-84 734-35 . . 3831 8882 3833 8834 3 Jyeshtha 51 Pingala . 52 Kilayakta . 53 Siddharthin. 54 Randra 55 Darmati . 56 Dandabhi . 57 Radhiradgarin 58 Raktiksha. 59 Krodhana . 60 Kshsys . 1 Prabhavs. 2 Vibhava . 3 Sakls 4 Pramoda . 5 Prajapatit . 7 Srimukha. 8 Bhara 9 Yuras . 10 Datri . 11 Isvara . 19 Bahndhinys 13 Pramithin. 14 Vikraina . 15 Vrisha 16 Chitrabbana . 12 Phalgana 8885 . . . 3836 735-36 8 Karttiks . *736-37 . 737-88 3837 3838 8839 3840 8841 8342 788-39 . 5 Sravana 739-40 *740-41 . . . . 741-42 . 1 Chaitra 3849 8844665 3845 1 888 742-48 749-44 . 10 Paushs + No. 8 Abgirus was suppressed according to the mean system. By the Brahma Siddhanta 'true" system K.Y. 8888, A.D. 734-736, was called Anginn, 7 Srlinakba being soppressed K.Y. 3837, A.D. 735-36, was 8 Bhava by both ayutem
Page #254
--------------------------------------------------------------------------
________________ No. 15.] XC-contd. Day and month, A.D. 13 22 Mar. (81) 21 Mar. (81) 21 Mar. (80) 22 Mar. (81) 22 Mar. (81) MEAN SOLAR YEAR. . 21 Mar. (81) 21 Mar. (80) 22 Mar. (81) 22 Mar. (81) 21 Mar. (81) 21 Mar. (80) 22 Mar. (81). 22 Mar. (81) 21 Mar. (81) 21 Mar. (80) 22 Mar. (81) 22 Mar. (81) 21 Mar. (81) 21 Mar. (80) 22 Mar. (81) 22 Mar. (81) 21 Mar. (81) 21 Mar. (80) 22 Mar. (81) 22 Mar. (81). * . * + . . THE BRAHMA-SIDDHANTA: MEAN SYSTEM . Week-day. 14 4 Wed. 5 Thur. COMMENCEMENT OF THE 6 Fri, 1 Sun. 2 Mon. 3 Tues. 4 Wed. 6 Fri. 0 Sat. 1 Sun. 2 Mon. 4 Wed. 5 Thur. 6 Fri. 0 Sat. 2 Mon. 3 Tues. 4 Wed. 5 Thur. 0 Sat. 1 Sun. 2 Mon. 3 Tues. 5 Thur. 6 Fri. " . . Time of mean Meshasamkranti. _H 5 n Yo 17 H. M. S. 5 33 0 11 45 9 17 57 18 0 9 27 6 21 36 12 33 45 18 45 54 0 58 7 10 12 13 22 21 19 34 30 1 46 39 88 3 7 58 48 14 10 57 20 23 6 15 48 2 35 15 8 47 24 14 59 33 21 11 42 3 23 51 9 36 0 9 22 0 18 4 12 27 10 24 36 MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF THE CIVIL DAY ON WHI CHAITRA SUKLA 1 ENDS). Day and month, A.D. 19 24 Feb. (55) 14 Mar. (74) 4 Mar. (63) 21 Feb. (52) 12 Mar. (71) 29 Feb. (60) 19 Mar. (78) 9 Mar. (68) 26 Feb. (57) 16 Mar. (76) 5 Mar. (64) 23 Feb. (54) 14 Mar. (73) 2 Mar. (62) 21 Mar. (80) 10 Mar. (69) 28 Feb. (59) 17 Mar. (77) 7 Mar. (66) 24 Feb. (55) 15 Mar. (74) 3 Mar. (63) 21 Feb. (52) 12 Mar. (71) 1 Mar. (60) .. * . * Week-day. 20 6 Fri. 5 Thur. 3 Tues. 0 Sat. 6 Fri. 3 Tues. 2 Mon. O Sat. 4 Wed. 3 Tues. O Sat. 5 Thur. 4 Wed. 1 Sun. O Sat. 4 Wed. 2 Mon. O Sat. 5 Thur. 2 Mon. 1 Sun. 5 Thur. 3 Tues. 2 Mon. 6 Fri. a (here=t, the index of the tithi). 23 2.5979 37-2803 251-6352 127-3579 162-0403 37-7632 72-4457 286-8004 162-5233 197-2057 72-9284 287-2838 321.9657 197-6886 232.3709 108-0938 322-4486 18.4990 232.8538 108-5767 143-2591 18-9819 233-3367 268-0191 143-7420 227 Kali. 1 3821 3822 3823 8824 8825 3826 3827 3828 8829 3830 3831 3832 3833 3834 3835 3836 3837 3838 3839 3840 3841 3842 3843 3844 3845
Page #255
--------------------------------------------------------------------------
________________ 228 EPIGRAPHIA INDICA. (VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAXTATSARA Kali. Mean intercalated (adhika) lanar month. saka. Chaitradi Vikrama. Mesbadi solar year in Bengal. Kollam. A.D. Southern system. Northern systein. . 8846 3847 3848 *744-45 745-46 . . . 746-47 8 Bhadrapada. 3849 geng 747-48 *748-49 3850 3951 749-50 . 8 Jyosktha. 8852 750-51 8855 751-52 12 Phalguna 8954 *752-53 . . . . . . . . . . . 753-54 8855 8856 754-55 . 8857 8858 17 Sabhanu . 18 Tarsna . 19 Parthiva . 20 Vyaya . 21 Sarvajit . 22 Sarvadharin 23 Virodbin . 24 Vikrita . 25 Khara . 26 Nandana 27 Vijaya . 28 Jaya . . 29 Manmatha. 80 Darmukhs . 31 Hemalamba 32 Vilamba . 33 Vikarin . 34 sarvarin 35 Plava 36 Sabbakpit. 37 sobhana 38 Krodhin . 89 Visvavasu. 40 Parabhava . 41 Plavanga . 755-56 *756-57 757-58 5 Sravalla 3869 8860 758-59 8861 759-60 . . 8862 1 Chaitra *760-61 761-62 3963 8864 762-68 10 Pagoh 3965 763-64 o 8866 *764-65 765-66 8867 6 Bhadrapuda. . . . . . . 766-67 3868 3867 8870 767-88 . . *768-69 3 Jyoshtha
Page #256
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 229 XC-contd. COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-BOLAR YEAR (MEAN SUNRISE OP THE CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDB). Kali Day and month, A.D. Time of Week-day. mean Mesha- sarink ranti. Day and month, A.D. Week-day, a (here-t, the index of the tithi). 13 17 19 20 23 21 Mar. (81). 21 Mar. (80) 22 Mar. (81). 3846 3847 . H. M. S. 16 36 45 19 Mar. (79) 22 48 54 8 Mar. (67) 3 26 Feb. (57) 12 17 Mar. (76) 215 Mar. (65) 30 22 Feb. (53) 39 | 18 Mar. (72) 12 1 178.4243 54:1472 268-5021 303-1844 8848 3849 O Ent. 1 San. . 3 Taes. 4 Wed. I 5 Thur. 6 Fri. . 1 Sun. I 2 Mon. . Tues. . 6 Thor. 6 Fri. 3850 .5 Thur. . 2 Mon. O Sat. 6 Fri. 3 Tues. o Sat. 6 Fri. 4 Wed. 178-9072 54-6301 3851 89-3125 8852 309-6678 8853 2 Mon. 8854 10 MAT. 3855 15 27 Feb 8856 8857 O fat. .12 9999-71778 214-0726 89-7958 124-4778 0-2008 214-5555 249-2878 . Eun. 19. 8858 Toes. 21 Mar. (81). 21 Mar. (80) 22 Mar. (81) 22 Mar. (81) 21 Mar. (81). 22 Mar. (81). 22 Mar. (81) 22 Mar. (81) 21 Mar. (81) 22 Mar. (81) 22 Mar. (81). 22 Mar. (81) 21 Mar. (81) 22 Mar. (81) 22 Mar. (81) 22 Mar. (81) 21 Mar. (81) 22 Mar. (81) . 22 Mar. (81) . 22 Mar. (81) 21 Mar (81) 8859 O Eat. 4 Wed. 8 Tues. O Sat. 5 Thor. . 4 Wed. 1 Sun. 5 Thur. 4 Wed. 2 Mon. . 4 Wed. 3860 5 Thur. 124-9607 3861 19 8862 0-6835 35-8658 8863 249-7207 8864 42 24 Feb. 26. 51 15 Mar. (74) 13 0 4 Mar. (68) 9 21 Feb. (52) 3 18 11 Mar. (70) 16 27 1 Mar. (60) 27 86 20 Mar. (79) 20 45 8 Mar. (68) Fob. (56) 9 3 16 Xar. (75) 15 16 12 8 Mar. (65) 21 28 21 23 Feb. (54) . 1 Sun. 284 4031 8 Fri. . 1. Sun. . 9 Mon. . 8 Tues. 4 Wed. . . Eat. i 1 Sun. 2 Mon. 3865 160-1 261 8866 5 Thur. 2 Mon. 6 Fri. 85-8488 8867 . 70-5312 8848 1 Ean. . 6 Fri. .Tues.. 3869 284.8860 160-6088 8870 Chaitra fukla 1 was suppressed.
Page #257
--------------------------------------------------------------------------
________________ 290 EPIGRAPHIA INDICA. [Vol. XVII. TABLE CONCURRENT YEAR. JOVIAN SANYATSABA. Mean intercalated (adhika) lunar month. Kali Meshadi solar yeur in Bengal. Kollam A.D. Chaitradi Vikram Southern system. Northern system. 8871 . 176 177 769-70 770-71 8878 . 11 Magha 3878 771-72 772-78 . . . . 778-74 . 8 Kirttika 8876 3876 8877 8878 3879 774-75 775-76 *776-77 4 Ashadha 777-78 778-79 8890 42 Kilaks . 43 Saumya . 44 Sadhirana. 45 Virodhakrit 46 Paridhavin. 47 Pramadin. 48 Ananda 49 Rakshasa . 50 Anals . 51 Pingala . 62 Kalayukta . 59 Siddharthin. 54 Raudra . 55 Darmati . 56 Dandubhi. 57 Radhirodgarin 58 Raktaksba . 59 Krodhana. 60 Kshaya . 1 Prabhava . . . 8881 1 Chaitra 3862 779-80 *780-81 781-82 8888 . 9 Margasira 8884 782-83 . . . . . . . . . . . . T 8885 783-84 . 9886 784-85 6 Bhadrapada 8887 785-86 8888 786-87 . 787-88 3 Jyeshtha 3889 3890 TREE 788-89 . 3891 . 11 Magha 789-90 790-91 8892 2 Vibhava 8 Sukla 4 Pramoda 3893 791-92 . . . . 18 Kiritiks. 8894 792-93 . 5 Prajapati 6 Angiras 1996 793-94
Page #258
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM, 231 XC-contd. COMMENCEMENT OF THE MEAN SOLAR YEAR. MBAN LUXI-SOLAR YEAB (MBAN BUNRISE OF TAX CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDB). Kali. Day and month, A.D. Week-day. Time of mean Mesha. samkranti. Vay and month, A.D. Week-day, a (heret, the index of the titht). 13 14 17 19 20 20 23 2 Mon. . 195-2912 3871 4 Wed. 5 Thar. . 19 6 Fri. 71.0141 3872 oor 105-6965 3873 5 Thor. Taes. Sat. 820-0513 3874 2 Mon. 195-7741 O Sat. Fri. 230-4566 . . . . 3875 3876 3877 3 Tues. 106-1793 3 Taes. 4 Wed. 5 Thur. Sat. Sun. 1 San. 3878 . 320-5342 16-5846 280-9395 106-6622 141 3446 3879 3880 2 Mon. . 17 6 Fri. Wed. Sun. Sat. 4 Wed. . 8881 3 Taes. 22 Mar. (81) 22 Mar. (81) 22 Mar. (81) 21 Mar. (81) 22 Mar. (81) 22 Mar. (81) . 22 Mar. (81) 21 Mar. (81) . 22 Mar. (81) 22 Mar. (81) 22 Mar. (81) 21 Mar. 81). 22 Mar. (81) . 22 Mar. (81) 22 Mar. (81) 22 Mar. (82) (81) . 22 Mar. (81) 22 Mar. (81) 22 Mar. (82): 22 Mar. (81) . 22 Mar. (81) 22 Mar. (81)'. 22 Mur. (82) 22 Mar. (81). 3882 H. M. S. 40 30 13 Mar. (72) 52 39 2 Mar. (61) 4821 Mar. (80) 57 10 Mar. (70) 6 27 Feb. (58) 15 18 Mar. (77) 16 53 247 Mar. (66) 28 5 33 25 Feb. (56) 42 14 Mar. (73) 29 51 4 Mar. (63) 0 21 Feb. (52) . 23 9 11 Mar. (71) 6 18 28 Feb. (59) 18 27 19 Mar. (78) 30 36 9 Mar. (68) 42 45 26 Feb. (57) . 6 54 54 16 Mar. (75) .13 7 3 5 Mar. (64) 19 19 12 23 Feb. (54) 1 31 21 13 Mar. (73) 302 Mar. (61) 39 21 Mar. (80) 48 10 Mar. (69) . 2 19 57 28 Feb. (59) 8 32 6 17 Mar. (76) . 17.0675 3883 en 00 00 00 00 en 5 Thur. Fri. .12 51.7499 3884 3 Taes. 1 Sun. . 266.1047 8885 Snt. Mon. lo 3886 5 Thor. 4 Wed. 141.8276 176-5100 22 Mar. . Tues. 3887 52.2327 3888 . Wed. 5 Thor. O Sat. 266-5876 3890 1 Sun. 6 Fri. 5 Thur. 2 Mon. 1 Sun. 8890 301-2700 176-9929 . 1 San. 3891 2 Mon. 211.6752 3899 . 3 Taos. 5 Thur. 3893 5 Thar. 6 Fri. 3894 87-3981 301-7530 9997-80335 3 Toes. . 1 San. 3895 Chaitra fukla 1 was snppressed. 212
Page #259
--------------------------------------------------------------------------
________________ 232 EPIGRAPHIA INDICA. [VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SARVATSARA. Mean intercalated (adhika) lunar month. Kali. Saka Meshidi solar year in Bengal. Kollam. Chaitradi Vikrans Southern system. Northern system. 80 3898 794-95 3897 . . . . 795-96 *796-97 Ashadla 3898 797-98 8899 8900 . . . 798-99 1 Chaitra 8901 799-800 . . 8902 *800-01 . 9 Margasira 8908 801-02 . . . 802-03 3904 8905 8906 803-04 . 6 Bhadrapada. *804-05 3907 805-08 . . . 7 srimukha. 8 Bhava . 9 Yayan . 10 Dhatri . 11 Isvara . 12 Bahadhinya 13 Pramathin . 14 Vikrams . 15 Vrisha . 16 Chitrabhanu 17 Subhanu . 18 Tirana . 19 Parthiva . 20 Vyays . 21 Sarvajit . 22 Sarvadharin 23 Virodhin . 24 Vikrita . 25 Khars 26 Nandana . 27 Vijaya , 28 Jaya . . 29 Manmaths. 30 Parmakha. 31 Hemalambat . . . . 2 Vaisakha 8908 806-07 3909 807-08 . . 3910 *808-09 11 Migha 8911 809-10 3912 810-11 811-12 3918 . . 7 Asvins 2914 *812-13 818-14 8915 . . 3016 814-15 Asludha . 3917 815-16 . 3918 12 Phalguna *816-17 817-18 . . . . 3919 749 8920 741 818-19 7 82 Vllamba was suppressed by mean reckoning. By Brahma-Siddhanta "trao" K. Y. 3921, A.D. 819-20, was 32 "Vilambe," and 38 Vikarin was suppressed. reckoning the year
Page #260
--------------------------------------------------------------------------
________________ No. 15.] XC-contd. Day and month, A.D. 13 MEAN SOLAR YEAR. 22 Mar. (81). 22 Mar. (81) 22 Mar. (82) 22 Mar. (81) 22 Mar. (81) 22 Mar. (81) 22 Mar. (82). 22 Mar. (81) 22 Mar. (81) 22 Mar. (81) 22 Mar. (82) 22 Mar. (81) 22 Mar. (81) 22 Mar. (81) 22 Mar. (82). . . " * . . 22 Mar. (81) 22 Mar. (81) 23 Mar. (82) 22 Mar. (82) 22 Mar. (81) 22 Mar. (81) 23 Mar. (82) 22 Mar. (82) 22 Mar. (81) 22 Mar. (81) . . * * . THE BRAHMA-SIDDHANTA: MEAN SYSTEM. * Week-day. mean Mesha Time of samkranti. 14 COMMENCEMENT OF THE O Sat. 1 Sun. 3 Tues. 4 Wed. 5 Thur. 6 Fri. 1 Sun. 2 Mon. 3 Tues. 4 Wed. 6 Fri. O Sat. 1 San. 2 Mon. 4 Wed. 5 Thur. 6 Fri. 1 Sun. 2. Mon. 3 Tues. 4 Wed. 6 Fri. 0 Sat. 1 Sun. 2 Mon. . . . . . . 17 H. M. S. 14 44 15 20 56 24 8 33 9 20 42 15 32 51 21 45 0 3 57 3 10 9 9 18 MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF THE CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). 8 Day and month, A.D. 19 7 Mar. (66) 24 Feb. (55) 14 Mar. (74) 3 Mar. (62) 21 Feb. (52) 12 Mar. (71) 29 Feb. (60) 19 Mar. (78) 8 Mar. (67) 26 Feb. (57) 16 21 27 22 33 36 4 45 45 16 Mar. (76) 10 57 54 5 Mar. (64) 17 10 22 Feb. (53) 23, 22 12 13 Mar. (72) 5 34 21 2 Mar. (62) 11 46 30 17 58 89 21 Mar. (80) 10 Mar. (69) 27 Feb. (58) 0 10 48 6 22 57 17 Mar. (77) 12 85 6 7 Mar. (66) 18 47 15 24 Feb. (55) 0 59 24 15 Mar. (74) 7 11 33 3 Mar. (63) 13 23 42 22 Mar. (81) 19 35 51 11 Mar. (70) Chaitra fukla 1 was suppressed. * Week-day. 20 6 Fri. 3 Tues. 2 Mon. 6 Fri. 4 Wed. 3 Tues. O Sat. 6 Fri. 3 Tues. 1 Sun. O Sat. 4 Wed. 1 Sun. 0 Sat. 5 Thur. 4 Wed. 1 Sun. 5 Thur. 4 Wed. 2 Mon. 6 Fri. 5 Thur. 2 Mon. 1 Sun. 5 Thur. a (here=t, the index of the tithi). 23 212-1581 87-8810 122-5633 9998-28625 212-6410 247-3234 123-0463 157.7287 33.4515 247-8064 282-4888 158-2115 33-9344 68-6168 282.9716 317-6540 193.3769 69-0998 103-7821 318-1369 193-8598 228-5421 104.2650 138-9474 14.6703 233 Kali. 3896 3897 3898 3899 3900 3901 3902 3903 3904 3905 3900 3907 3908 8909 3910 3911 3912 3913 3914 3915 5916 3917 8918 3919 8920
Page #261
--------------------------------------------------------------------------
________________ 234 Kali. 3921 3922 3923 Saka. 3924 742 877 226 743 878 227 744 879 228 745 880 229 3925 746 881 230 3926 747 882 231 3927 748 883 232 8930 3928 749 884 3929 750 885 234 751 886 235 8931 752 887 236 3932 753 888 237 8933 754 889 238 3934 755 890 239 3985 756 891 240 3936 3939 757 892 241 8987 758 893 242 8938 759 894 243 895 244 8940 761 896 245 3941 762 897 245 3942 763 898 247 3948 764 899 248 3944 765 900 249 3945 763 901 2 Chaitradi Vikrama. Meshadi solar year in 3a 233 250 CONCURRENT YEAR. Kollam. 4. 0-1 1-2 2-3 3-4 4-5 5-6 6-7 7-8 EPIGRAPHIA INDICA. 8-9 9-10 10-11 11-12 12-13 13-14 14-15 15-16 16-17 17-18 18-19 A.D. 5 819-20 *820-21 821-22 822-23 823-24 *824-25 825-26 826-27 827-28 *828-29 829-30 830-31 831-32 #832-33 833-34 834-35 835-36 #836-37 837-38 838-39 839-40 #840-41 841-42 842-43 843-44 JOVIAN SAMVATSARA. Southern system. 6 33 Vikarin 34 Sarvarin Northern system. 35 Plara 36 Subhakrit. 37 Sibhana 38 Krodhin 39 Visvavasu 40 Parabhava 41 Plavanga 42 Kilaka 43 Saumya 44 Sadharana 45 Virodhakrit 46 Paridhavin. See "Remarks," p. 215 above. * 7 47 Pramadin 48 Ananda 49 Rakshasa 50 Anala 51 Pingala 52 Kalayakta. 53 Siddharthin. 54 Randra 55 Durmati 56 Dandubli 57 Rudhirodgarin [VOL. XVI I. TABLE Mean intercalated (adhika) lanar month. 8a 9 Margasira 6 Bhadrapada++ 2 Vaisakha 11 Magha 7 Asvina 4 Ashadha 12 Phalguns 9 Margasira 5 Sravana
Page #262
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 235 XC-contd. COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-SOLAR YEAR (MEAN SIN RISE OF THE CIVIL DAY ON WHICH CHAITBA SUKLA 1 ENDS). Kali. Dey and month, A.D. Time of | Day and month, Week-day. mean Mesh A.D. Bamkranti. Week-day. a (heret, the index of the tithe). 13 20 23 3 Tues, 229-0250 3921 23 Mar. (82): 22 Mar. (82). 2 Mon. 263-7074 3922 22 Mar. (81). 139.4313 3923 6 Fri. Taes. 0 Sat. 16-1531 8924 2 Mon. 49-8855 3926 22 Mar. Eat. . 264-1904 8926 139-9132 8997 Thor. 174-5955 8998 Eat. 50-3184 3929 3930 4 Wed. 3 Tues. Sat. 6 Fri. 4 Wed. 1 Son. Sat. 4 Wed. 85.0009 299-3556 Mon. 3931 14 17 M. S. 4 Wed. 48 0 1 Mar. (60) . Thur. 18 9 | 19 Mar. (79) Fri. 18 8 Mar. (67) 25 Feb. (56) Mon. 36 16 Mar. (75) Tues. 5 Mar. (65) 4 Wed. 15 22 Feb. (53) 21 13 3 13 Mar. (72) 2 Mar. (61) 1 Sun. 9 37 21 20 Mar. (80) 15 3010 Mar. (69) 3 Taes. 27 Feb. (58) Thur. 18 Mar. (77) 6 Mar. (66) 0 Sat. 16 24 Feb. (55) 16 14 Mar. (78) 8 Taes. 4 Mar. (63) . 4 Wed. 22 Mar. (82) . Thor. 17 26 11 Mar. (70) 23 38 51 28 Feb. (59) 019 Mar (78) 2 Mon. 8 Mar. (68) . 3 Tues. 18 15 18 25 Feb. (56) . 5 Thar. 0 27 27 16 Mar. (75) . 6 Fri. 6 39 38 5 Mar. (64) 175.0784 3992 . 209-7609 3938 Fri. 85-4837 22 Mar. (81). 23 Mar. (82) (82) 22 Mar. (81) 22 Mar. (81) 23 Mar. (82) 22 Mar. (82) 22 Mar. (81) 22 Mar. (81) 23 Mar. (82) 22 Mar. (82) 22 Mar. (81). 22 Mar. (81) 28 Mar. (82) 22 Mar. (82) . 22 Mar. (81) 22 Mar. (81) 23 Mar. (82) 22 Mar. (82) 22 Mar. (81) 28 Mar. (82) 23 Mar. (82) . A834 .. 299-8385 8985 2 Mon. O Sat. Sun. 9995-8889 $ 8936 210-2438 8987 5 Thar. 4 Wed. 8988 244-9262 120-6490 9996-37185 8839 8 Fri. Ean. 3940 31.0542 3941 1 San. 5 Thur. 4 Wed. 2 Mon. 6 Fri. 5 Thnr. 2 Mon 245-4090 3942 121.1319 3943 To 155-8143 394+ 81.5372 3915 $ Chaitra sukla 1 was soppresud.
Page #263
--------------------------------------------------------------------------
________________ 236 EPIGRAPHIA INDICA. [Vol. XVII TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Mean interculated (adhika) lanar month. Kali. Saks. Kollam. A.D. Chaitradi Vikrama. Southern system. Northern system. 8a 8946 19-20 .844-45 . . 2 Vaisakhs 8947 20-21 845-46 846-47 . 10 Pansha 8948 8949 21-22 22-23 . . 847-48 28-24 *848-49 3950 8961 24-25 849-50 7 Afvina 25-26 850-51 851-52 26-27 8053 8968 8954 3956 27-28 *852-58 . 3 Jyeshtha . . 8956 . 12 Phalguna . 28-29 29-30 80-81 31-32 32-33 . . 8957 8954 58 Raktaksha. 59 Krodhana 60 Kshaya . 1 Prabhava. 2 Vibhava . 3 Sukla 4 Pramoda. 5 Prajapati . 6 Angira . 7 srimukhs . 8 Bhava . 9 Yavan . 10 Dhatri 11 Ivars 12 Bahadhanya 18 Pramithin . 14 Vikrams . 15 Vrisha . 16 Chitrabhina 17 Sabhina . 18 Tirana . 19 Parthiva. 20 Vyaya . 81 Sarvajit . 22 Barvadharin 859-54 854-55 855-58 *856-57 857-58 858-59 859-60 *860-61 861-62 8959 . . 8 Karttika 8960 88-34 84-85 8961 . . 85-36 . . . 3962 3968 5 Sravans 36-37 37-38 862-68 8964 8966 38-39 89-40 3966 . .10 Pausha 8987 40-41 868-84 *884-85 885-86 866-87 867-68 *868-69 8968 41-42 . . . . . 8969 42-48 8970 7 Aivina g
Page #264
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 237 XC-contd. COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-BOLAR YEAR (MBAN SUNRISE OF THE CIVIL DAY ON WHICH CHAITRA SUKUA 1 ENDS). Kali. Day and month, A.D. Time of Wook-day. mean Mesha-l Day and month, A.D. samkranti. Week-day. (heret, the index of the tithe). 18 14 17 20 23 . 245-8919 3946 Sat. 6 Fri. . 280-5743 3947 O Sat. 1 Sun. . 8 Tues. . 4 Wed. 156-2972 3948 8949 190-9796 66-7024 5 Thur. 3950 281-0672 8951 815-7897 Toes. 2 Mon. 8 Fri. 4 Wed. 8 Tues. O Sat. 4 Wed. 8 Tros. 8958 22 Mar. (82) 22 Mar. (81) 28 Mar. (82) . 28 Mar. (82) 22 Mar. (82) . 22 Mar. (81) . 28 Mar. (82) . 28 Mar. (82) . (82) . 22 Mar. (81). 88 Mar. (82) 23 Mar. (82). 22 Mar. (82) 22 Mar. (81) . (82) * (82) . . 6 Fri. . 1 San. . 2 Mon. . 8 Tues. I Wed. 3958 191.4624 67-1858 101-8677 3984 9955 1 Sun. 816-2225 3958 8 Fri. 12-2729 8967 45 28 Feb. (54) 54 18 Mar. (76) 2 Mar. (61) 21 Mar. (80) 219 Mar. (69) 80 27 Feb. (58) 89 18 Mar. (77) 487 Mar. (66) 14 28 57 24 Feb. (55) 2041 614 Mar. (73) 15 4 Mar. (68) 24 22 Mar. (81) 17 89 11 Mar. (71) 29 12 28 Feb. (59) 41 51 19 Mar. (78) 08 Mar. (87) 9 26 Feb. (57) 18 16 Mar. (76) 80 216 Mar. (64) 42 36 22 Feb. 16 12 Mar. (72) 28 54 2 Mar. (61) 19 8 21 Mar. (80) 31 12 10 Mar. (69) 48 21 27 Feb. (58) 4 Wed. 226-6278 3958 MOD: 8959 102-8506 187-0329 12-7558 8980 . 9 4 Wod. 3961 8909 . 2 Mon. 227-1107 29 1 sun. . 3968 . O Sat. 1 Sun. . .4 Wed. . 5 Thur. 6 Fri. . 0 Sat 2 Mon. Tues. 4 Wod. . 5 Thur. O Sat. 1 Sau. 2 Mon. 6 Thur. 8964 kon. (81) . 28 Mar. (82) 23 Mar. (82) 29 Mar. (82) 22 Mar. (81). 28 Mar. (82) 28 Mar. (82). 22 Mar. (82). 261-7930 187-5159 18-2987 47-9211 262-2759 3966 3966 . 1 Sun. 6 Fri. . 3967 Thor. 8968 296-9584 172-8812 48-4039 2 Mon. 6 Fri. 8982 1970 2x
Page #265
--------------------------------------------------------------------------
________________ 238 EPIGRAPHIA INDICA. [VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATBABA. Kali. Chaitradi Vikrama. Mean intercalated (adhika) lanar month. Meshadi solar year in Benga! Kollam. A.D. Southern system. Northern system. 8971 44-45 869-70 23 Virodhin 3972 45-46 46-47 47-48 . . . . 8978 8 Jyeshtha . 8974 8975 48-49 12 Phalgona 1 870-71 871-72 *872-78 873-74 874-75 875-76 .876-77 877-78 3976 3977 49-50 50-51 51-52 . 3978 8 Karttika 3979 52-58 3980 58-54 878-79 3981 . 5 Sriyana . . 3982 54-58 55-56 56-57 87-58 879-80 *880-81 881-82 882-83 3988 24 Vilfita . 25 Khara . 28 Nandans . 27 Vijaya . 28 Jaya . . 29 Manmatha . 30 Darmakha. 31 Hemalamba 32 Vilamba . 33 Vikarin . 34 Sarvarin . 35 Playa 36 Subhakrit . 37 sobhana 38 Krodhin 89 Visvavasu. 40 Parabhavs. 41 Plavanga . 42 Klaks . 43 Saamya . 44 Sidharans. 45 Virodhakrit 46 Paridhavin 3984 . . 1 Chaitra 8985 58-59 3986 59-60 10 Paasha 3987 60-61 888-84 *884-85 885-88 886-87 887-RR 3988 61-62 3989 62-63 . . . . . 3990 63-64 *888-89 . 6 Bhadrapada. . . 64-65 3091 8992 66-66 . 8 Jyenhtha . 889-90 890-91 891-92 .892-99 3998 BR.67 3994 87-68 , 11 Magha 8995 68-69 893-94 47 Prandin. .
Page #266
--------------------------------------------------------------------------
________________ No. 15.] XC-contd. Day and month, A.D. 13 22 Mar. (81) 23 Mar. (82) 23 Mar. (82) 22 Mar. (82) 23 Mar. (82) 23 Mar. (82) 23 Mar. (82) 22 Mar. (82) 23 Mar. (82) 23 Mar. (82) 23 Mar. (82) 22 Mar. (82) 23 Mar. (82) 23 Mar. (82) 23 Mar. (82) 22 Mar. (82) 23 Mar. (82) 23 Mar. (82) 23 Mar. (82) 22 Mar. (82) 23 Mar. (82). 23 Mar. (82) 28 Mar. (82) 22 Mar. (82). 23 Mar.. (82) . + . . MEAN SOLAR YEAR. * . . . * THE BRAHMA-SIDDHANTA: MEAN SYSTEM. . Time of Week-day. mean Mesha samkranti. 14 3 Tues. 5 Thur. 6 Fri. O Sat. 2 Mon. 8 Tues. 4 Wed. 5 Thur. O Sat. 1 Sun. 2 Mon. 3 Tues. 5 Thur. 6 Fii. COMMENCEMENT OF THE 0 Sat. 1 Sun. 3 Tues. 4 Wed. 5 Thur. 6 Fri. 1 Sun. 2 Mon. 8 Tues. 4 Wed. 6 Fri. . . * * * . * . 17 H. M. S. 23 * 2012 6 12 19 48 55 30 18 31 7 39 p6 , nndd-- 13 0 44 6 6 56 15 8 24 19 20 33 1 32 42 7 44 51 13 57 0 20 9 " 8 33 27 9 2 21 18 MEAN LUNI-SOLAR TEAR (MEAN SUNRISE OF THE CIVIL DAY ON WHICH CHAITEA BUKLA 1 ENDS). 14 45 36 20 57 45 3 9 22 3 15 34 12 21 46 21 3 58 30 10 10 39 16 22 48 22 34 57 4 47 6 Day and montli, A.D. 19 17 Mar. (76) 7 Mar. (66) 24 Feb. (55) 14 Mar. (74) 3 Mar. (62) 22 Mar. (81) 12 Mar. (71) 29 Feb. (60) 19 Mar. (78) 8 Mar. (67) 26 Feb. (57) 15 Mar. (75) 5 Mar. (64) 22 Feb. (53) 13 Mar. (72) 1 Mar. (61) 9 54 20 Mar. (79) 10 Mar. (69) 27 Feb. (58) 17 Mar. (77) 6 Mar. (65) 24 Feb. (55) 15 Mar. (74) 8 Mar. (63) 23 Mar. (81) Week-day. 20 5 Thur. 8 Tues. 0 Sat. 6 Fri, 3 Tues. 2 Mon. 0 Sat. 4 Wed. 3 Tues. 0 Sat. 5 Thur. 3 Tues. 1 Sun. 5 Thur. 4 Wed. 1 Sun. 0 Sat. 5 Thur. 2 Mon. 1 Sun. 5 Thur. 3 Tues. 2 Mon. 6 Fri. 5 Thur. . ** * a (heret, the index of the tithi). 23 83.0864 297.4412 173-1641 207-8464 83.5693 118-2517 332-6065 208-3293 243-0118 118-7346 333-0894 29-1398 243-4947 119-2175 153-8998 29-6227 64.3052 278-6599 154-3828 189-0652 64-7881 279-1428 313-8252 189-5481 224-2304 239 Kali. 1 3971 3972 3973 3974 3975 3976 3977 3978 8979 3980 3981 3989 3983 3984 3985 3986 3087 8988 8989 3990 3991 3992 3993 3994 3995
Page #267
--------------------------------------------------------------------------
________________ 240 Kali. Saka. 2 8 817 818 958 835 952 819 954 8996 801 69-70 3997 802 70-71 8998 303 71-72 3999 890 804 72-73 4000 821 956 805 73-74 4001 822 957 306 74-75 4002 893 958 807 75-76 4008 834 959 808 76-77 4004 825 960 809 77-78 4005 8.26 961 310 78-79 4006 827 968 811 79-80 4007 828 968 4008 829 964 312 80-81 313 81-82 314 82-83 4009 880 965 4010 881 966 4011 315 83-84 967 316 888 968 817 882 84-85 4012 85-86 4018 884 969 318 86-87 4014 970 319 87-88 4015 836 971 320 88-89 4016 837 972 321 89-90 978 $22 4017 838 90-91 4018 839 974 $23 91-92 92-93 4019 840 975 324 4020 841 976 325 93-94 3a 955 EPIGRAPHIA INDICA. CONCURRENT YEAR. Kollam. A.D. 5 JOVIAN SAMVATSARA. 914-15 Southern system. 6 Northern system. 7 894-95 895-96 *896-97 897-98 898-99 899-900 *900-01 901-02 902-03 903-04 #904-05 58 Raktaksha 905-06 59 Krodhana 906-07 60 Kahaya 907-08 1 Prabhava #908-09 2 Vibhava 909-10 3 Sukla 910-11 4 Pramoda 911-12 5 Prajapati *912-13 6 Angiras. 913-14 7 Srimukha 8 Bhava 915-16 9 Yuvan 916-17 10 Dhatri 917-18 11 Iavara 12. Bahudhanya 918-19 12 Bahudhanya 13 Pramathin 48 Ananda 49 Rakshasa 50 Anala 51 Pingala 52 Kalayukta. 53 Siddharthin 54 Raudra 55 Durmati 56 Dandubhi 57 Rudhirodgarint. . 59 Krodhana 60 Kahaya. 1 Prabhava 2 Vibhava 3 Sukla 4 Pramoda 5 Prajapati 6 Angiras. 7 srimukha 8 Bhava 9 Yuvan 10 Dhatri 11 Isvara [VOL. XVII. TABLE Mean intercalated (adhika) lunar month. 8a *** 8 Karttika 5 Sravana 1 Chaitra 10 Pausha 6 Bhadrapada. *** 3 Jyeshtha ... 11 Magha 8 Karttika 4 Ashadha +58 Raktaksha was suppressed in the north. By southern reckoning there was no suppression, and there has been none since. By Brahma-Siddhanta "true" reckoning K.Y. 4006, A.D. 904-05, was 58 Raktaksha, 59 Krodhana being suppressed in the north.
Page #268
--------------------------------------------------------------------------
________________ No. 15.) THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 241 XC-conta. COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-SOLAR YEAR (MRAN SUNRISE OF THE CIVIL DAY ON WHICH CHAITRA BUKLA 1 ENDS). Kali. Day and month, A.D. Time of Week-day. mean Mesha sankranti. Day and month, A.D. Week-day. a (here=t, the index of the tithi). 13 14 20 2 Mon. 99-9533 3996 314-8081 3997 23 Mar. (82) . 23 Mar. (82). 22 Mar. (82) 23 Mar. O Sat. 5 Thar. 3998 3 Toeg . 1 Sun. * 12 Mon. . 4 Wed. . 5 Thur. . 6 Fri. 1 Sun. 2 Mon. 10-3584 224-7133 100-4362 3999 er O Sat. 4000 6 Fri. 4001 135.1188 10-8415 (82) (83), (82). 3 Tues 23 Mar. 23 Mar. 4002 tar 225.4963 259-8786 4008 4004 13 Tues. Wed. 135-6015 4005 170-2839 4006 Sat. 17 19 H.M.S. 10 69 15 11 Mar. (70) 11 24 1 Mar. (60) 18 Mar. (78) 35 42 8 Mar. (67) 11 51 23 Feb. (56) .18 0 0 16 Mar. (75) 12 9 4 Mar. (64) 24 18 22 Feb. (53) 12 36 27 13 Mar. (72) .18 48 36 2 Mar. (61) 45 20 Mar. (80) 12 549 Mar. (68) 13 25 3 27 Feb. (58) 19 37 12 18 Mar. (77) 49 216 Mar. (66) 30 23 Feb. (54) 39 14 Mar. (73) 25 484 Mar. (63) 57 | 22 Mar. (82) 6 11 Mar. (70) 15 2 15 28 Feb. (59) 24 19 Mar. (78) 8 Mar. (68) 42 25 Feb. (56) 51 16 Mar. (75) 23 Mar. (82). 23 Mar. (82) 23 Mar. (83) 23 Mar. (82) 23 Mar. (82) 23 Mar. (82) 23 Mar. (83). 23 Mar. (82) 1 Sun. O Sat. 4 Wed. 3 Toes. O Sat. 5 Thur. 4 Wed. 1 San. Thur. . . . 4007 46-0067 260-3616 San. 4008 4009 295-0440 Mon. Wed. Thur. 170-7868 4010 46-4896 4011 23 Mar. 81*1720 2 Mon. 295-5269 Sat. Mon. 1 San. 330-2092 4012 4018 4014 4015 4016 w17 Tues. 4 Wed. 23 Mar. (82). 23 Mar. (83). 23 Mar. (82) 23 Mar. (82) 23 Mar. (82) 23 Mar. (83) . 23 Mar. (82). 23 Mar. (82). 205-9321 81-6549 Thur. 116-3373 6 Thur. .2 Mon. 1 Sun. 6 Fri. . 8 Toes. 2 Mon. 830-6921 4018 . . 1 Sun. 206-4150 4019 2 Mon. . 16 2410974 4020 2 3
Page #269
--------------------------------------------------------------------------
________________ 249 EPIGRAPHIA INDICA. [VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Mean intercalated (adhika) lunar month. Ksli. Moshidi solar year in Bengal. AD. Chaitridi Vikrams. Southern system. Northern system. 88 4022 94-96 4028 95-98 . 4028 | 1 Chaitra . 9 Margadirs 4024 4036 . 4056 4024 6 Bbidrapada. 4028 . 4029 4990 2 Vaisakhs . 4081 4036 11 Magha 919-20 13 Pramathin *920-21 14 Vikrams 921-22 15 Vrishs. 922-28 16 Chitrabhana 998-24 17 Subhana *924-26 18 Taraps 925-26 19 Parthiva 926-27 20 Vyaya . 927-28 21 Sarvajit. *928-29 22 Sarvadhirin 929-8023 Virodhin 930-31 24 Vikrita 981-82 25 Khara *932-88 26 Nandana 988-84 37 Vijay , 984-85 28 Jays . 985-88 20 Meamstha *988-8780 Darmakha- 987-88 81 Hemslambe 988-89 89 Vilambs 989.40 88 Vikarin. 940-41 Sarwarin 941-42 86 Plana . 94646 * Subhakarit 948- 2 ssbles. 96-97 97-98 98-99 90-100 100-01 101-02 102-08 108-04 104-05 106-08 106-07 107-08 108-09 109-10 110-11 111-13 118-18 118-14 14-15 18-16 116-17 117-18 118-19 14 Vikrams .15. Vrishs 16 Chitrabhant 17 Subhana 18 Tirana . 19 Parthiva 20 Vyaya. 21 Sarvajit 22 Sarvadharin .23 Virodhin 24 Vikrita. 25 Khara .26 Nandana 27 Vijays. 28 Jays . 99 Manmatha 20 Durmukha . 31 Hemalamba 82 Vilamba . 38 Vikirin. . 84 Sarnain 35. PIAVE : 86 Subhaknit 87 sobhan. 88. Krodhin . 4084 4086 4096 4081 . . . 7 Abrina 4088 Asbitha | . 4040 404 1 Chaitra 404 9 Marguer 10 OM . . . . 900 100 860
Page #270
--------------------------------------------------------------------------
________________ No. 15.) THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 843 XC-contd. COMMENCEMENT OF THE MBAN BOLAB YRAR. MSAN LUXI-BOLAB BAB (MEAT SUNRISE OP THE CIVIL DAY ON WHICH CBAITRA BUILA 1 BNDB). Kali. Day and month, A.D. Week-day. Time of mean Mesha | Day and month, A.D. sankranti. Week-day. a (heret, the index of the titat). 13 14 17 19 1 20 23 4021 16 Fri. 4 Wed. . . 116-8202 331 1750 4029 2 Mon 27.2254 4028 0 Sat. 241.5802 4024 San. 6 Fri. 276-2626 4025 151.9855 4096 4027 17 27-7084 62-3907 4028 276-7455 4029 4030 4031 4095 23 Mar. (82) 23 Mar. (83). 23 Mar. (82) 23 Mar. (82) 23 Mar. (82) 23 Mar. (83). 28 Mar. (82) . 23 Mar. (82). 23 Mar. (82). 23 Mar. (83) 23 Mar. (82) 23 Mar. (82) 24 Mar. (83) 28 Mar. (83; 23 Mar. (82). 28 Mar. (82) . 24 Mar. (89) 28 Mar. (88) . Mar. (82) 23 Mar. (82) 24 Mar. (83) 23 Mar. (83). 28 Mar. (82) 23 Mar. (82) 24 Mar. (83) H. M.S 3 Tues. 22 301 5 Mar. (64) . Thur. 14 9 23 Feb. (54) Fri. 18 12 Mar. (71) Sat. 39 272 Mar. (61) 21 Mar. (80) . Tues. 45 9 Mar. (69) . Wed. 54 28 Feb. (57) . Thur. 317 Mar. (76) . Fri. 40 12 7 Mar. (68) Sun. 52 21 24 Feb. (55) Mon. 30 | 14 Mar. (73) Taes. 18 18 39 3 Mar. (62) Thar. 48 22 Mar. (81) . 40 57 11 Mar. (71) O 53 628 Feb. (59) . 1 Sun. 6 16 19 Mar. (78) 8 Tros. 17 348 Mar. (67) 4 Wed. 26 Feb. (57) 5 Thur. 18 41 42 15 Mar. (74) 8 Fri. 19 516 Mar. (64) 1 Sun. '8 023 Peb. (53) 2 Mon. 912 Mar. (72) 3 Tues. 18 1 Mar. (60) .14 Wed. 27 20 Mar. (79) 16 Fri. 36 10 Mar. (69) 4083 3 Tues Jo Sat. .8 Fri. 14 W d. . 1 San. . Sat. 4 Wed. 8 Tues. 1 Sun. 6 Thur. 4 Wed. 1 Sun. 6 PH. . Wod. 2 Mon. .6 Pri. 162-4884 187-1507 62-8736 97-5580 311-9109 187-6886 222-9161 98-0889 4034 4035 Set 19 4086 4097 818-8988 4038 8-4441 4039 222-7990 4040 98-5228 4041 1The 188-2042 4049 8-9270 4048 48-6094 404 1 San. Fri. 957-9648 4046 2 L 2
Page #271
--------------------------------------------------------------------------
________________ 244 EPIGRAPHIA INDICA. [Vol. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Chaitradi Vikrama. Mean intercalated (adhika) lanar month. Meshadi solar year in Bengal. Kollan Southern system. Northern system. 4046 6 Bhadrapada. 4047 120-21 4045 353 4049 3 Vaisakha 4060 11 Magha 4061 4052 4053 351 119-20 352 121-22 354 122-23 855 123-24 358 124-25 357125-26 358 126-27 127-28 128-29 129-80 130-31 181-32 4054 7 Asvins 4055 4056 4057 4 Ashadh 4058 *944-45 38 Krodhin 39 Visvavasu . 39 Visvivasa 40 Parabhava 946-47 40 Parabhava 41 Plavanga 41 Plavanga 42 Kilaka *948-49 42 Kilaks. 43 Saumyb. 949-50 43 Saamys . 44 Sadharana 950-51 44 Sadharana 45 Virodhakrit . 951-52 45 Virodhakrit 46 Paridhavin *952-53 46 Paridhivin 47 Pramidin . 953-54 47 Pramadin 48 Ananda . . 954-55 48 Ananda 49 Rakshasa 955-56 49 Rakshass 50 Anala. *956-57 50 Anala . . 51 Pingala . 957-58 51 Pingula. 52 Kilayakta 958-59 52 Kalayukta 53 Siddharthin . 959-60 53 Siddharthin .54 Randes. *960-61 54 Randra. . 55 Darmati. 961-62 55 Darmati 56 Dandabhi 962-68 56 Dandabhi 57 Radhirodgarin 963-64 57 Radhirodgarin . 58 Raktaksha . *964-65 68 Raktaksha 59 Krodhana 965-66 59 Krolhana 60 Kshaya 966-67 80 Kshay& 1 Prabhava 967-68 1 Prabhava 2 Vibhava. . +968-69 2 Vibhava . 8 Sukla . 132-33 12 Phalguna 4059 4060 4061 4062 9 Margasira . 4062 4064 4065 133-34 134-35 135-36 136-37 137-38 188-29 139-40 140-41 141-42 142-43 148-44 5 Srivapa . 4066 4067 4068 2 Vaisakha 4069 4070 10 Pausha
Page #272
--------------------------------------------------------------------------
________________ No. 15.] XC-contd. Day and month, A.D. 13 MEAN SOLAR YEAR. 23 Mar. (83) 23 Mar. (82) 23 Mar. (82) 24 Mar. (83) 23 Mar. (83) 23 Mar. (82) 23 Mar. (82) 24 Mar. (83) 23 Mar. (83) 23 Mar. (82) 23 Mar. (82) 24 Mar. (83) 23 Mar. (83) 23 Mar. (82) 23 Mar. (82) 24 Mar. (83) 23 Mar. (83) 23 Mar. (82) 24 Mar. (83) 24 Mar. (83) 23 Mar. (83) 23 Mar. (82) 24 Mar. (83) 34 Mar. (83) 23 Mar. (83) " . * * . . . . . THE BRAHMA-SIDDHANTA: MEAN SYSTEM. . Week-day. 14 COMMENCEMENT OF THE 0 Sat. 1 Sun. 2 Mon. 4 Wed. 5 Thur. 6 Fri. O Sat. 2 Mon. 3 Tues. 4 Wed. 5 Thur. 0 Sat. 1 Sun. 2 Mon. 3 Tues. 5 Thur. 6 Fri. 0 Sat. 2 Mon. 3 Tues. 4 Wed. 5 Thur. O Sat. 1 Sun. 2 Mon. Time of mean Meshasamkranti. H. M. S. 9 6 45 17 16 7 30 22 19 39 4 31 48 27 Feb. (58) 15 18 54 17 Mar. (76) 6 Mar. (65) 21 31 3 3 43 12 24 Feb. (55) 9 55 21 14 Mar. (74) 3 Mar. (62) 22 Mar. (81) 11 Mar. (70) 29 Feb. (60) 6 19 Mar. (78) 8 15 8 Mar. (67) 5 20 24 25 Feb. (56) 11 32 33 15 Mar. (75) 17 44 42 5 Mar. (64) 23 Mar. (82) 23 56 51 13 Mar. (72) 1 Mar. (61) 20 Mar. (79) 9 Mar. (68) 27 Feb. (58) 23 10 43 57 16 56 828 9 b sky onndd. 12 21 55 13 0 9 18 33 18 0 45 27 6 57 36 MEAN LUNI-SOLAR YEAR (MKAN SUNRISE OF THE CIVIL DAY ON WHICH CHARTRA SUKLA 1 ENDS). 19 21 54 Day and mouth, A.D. 1 34 3 7 46 12 13 58 21 19 9 45 17 Mar. (77) 6 Mar. (65) 23 Feb. (54) 14 Mar. (73) 3 Mar. (63) " . - Week-day. 20 3 Tues. 2 Mon. 6 Fri. 4 Wod, 3 Tues. O Sat. 6 Fri. 3 Tues. 1 Suu. 0 Sat. 4 Wed. 1 Sun. O Sat. 5 Thur. 1 Sun. 1 Sun. 5 Thur. 4 Wed. 1 Sun. 6 Fri. 5 Thur. 2 Mon. 6 Fri. 5 Thur. 3 Tues. a (heret, the index of the tithi). 23 133.6871 168-3695 44-0923 258-4471 293-1295 168-8524 203-5348 79-2576 293-6125 328-2949 204-0176 79-7405 114.4229 328-7778 24.8281 239-1830 114-9058 149.5881 25.3110 239-6659 274-3483 150-0710 25-7939 60-4763 274-8311 Kali. 1 245 4046 4047 4048 4049 4050 4051 4052 4053 4054 4055 4056 4057 4058 4059 4060 4061 4062 4063 4064 4065 4066 4067 4068 4069 4070
Page #273
--------------------------------------------------------------------------
________________ 246 EPIGRAPHIA INDICA. (VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Chaitradi Vikrama. Mean intercalated (adhika) lunar month. Meshadi solar year in Bengal. Kollam. A.D. Southern system. Northern system. 4071 4072 4078 4074 144-45 145-46 146-47 147-48 148-49 149-50 150-51 151-52 4075 . 4076 4077 882 4078 . 41779 152-58 4080 4081 . 4082 4088 969-70 3 Sakla . . 4 Pramoda 970-71 4 Pramoda . 5 Prajapati 971-72 5 Prajapati . 8 Angirw. . 7 Asvina *972-73 8 Angirus . . 7 Srimukha 978-74 7 Srimukha 8 Bhava , . 974-75 8 Bhava. 9 Yavan . . 4 Ashadha 975-76 9 Yavan 10 Dhatri. *976-77 10 Dhatri 11 Ikvari 12 Phalgana 977-78 11 Isvars . 12 Babadhanya . 978-79 12 Bahadhanya . 13 Pramithin 979-80 13 Pramithin 14 Vikrama 9 Margadin *980-81 14 Vikrama 16 Vrisha. . 981-82 15 Vrisha. 16 Chitmbhant. 982-88 16 Chitrabhana 17 Subhanu . 6 Sravana 988-84 17 Subhana 18 Tar . *984-85 18 Tana 19 Parthiva I 985-86 19 Partbivs 20 Vyaya . 2 Vaibikha 986-87 20 Vyays . 21 Sarvajit . 987-88 21 Sarvajit . .22 Sarvadhirin . 10 Pausha *988-89 22 Sarvadhirin .23 Virodhin 988-90 23 Virodhin 24 Vikpitat 990-91 24 Vikrita. .28 Nandana . 7 Alvina 991-9225 Khars, 27 Vijaya. *992-98 26 Nandans. | 28 Jaya . . 993-9487 Vijays. . 29 Manmatha 3 Jyiths 4084 4085 4086 153-54 154-55 155-56 156-57 167-58 158-59 169-60 160-61 161.82 162-68 183-84 164-66 186-68 166-67 167-68 188-89 4087 4088 4089 4090 4091 4092 4093 4094 899 400 4096 26 Khan wm sapproned in the north by tie Brahma-Siddhanta system, whether calculated by "true" or mean reckoning
Page #274
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM. XC-contd. COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-SOLAR YRAB (MRAN SUNRIBE OF THE CIVIL DAY ON WHICE CHAITRA BUKLA 1 ENDS). Day and month, Time of Wook-clay. mean Mehs Barnkranti. Day and month, A.D. Week-day. a (beret, the index of the tithi). A.D. 13 17 19 20 23 . (82). 24 Mar (88) 24 Mar. (88) .3 Tues. . 2 Mon. 6 Fri. 309-5135 186-2364 60-9593 4071 4072 5 Thur. 6 Fri. 3 Tues. Mon. (83). 0 Set. 95-6416 (82) 4073 4074 4075 4076 . 1 San. 309-9864 186-7198 3 Tuos. 4 Wed. 220-4016 4077 96.1245 4078 5 Thur. 6 Fri. 1 San. 180-8089 4079 4080 . 4081 2 Mon. 3 Tues. 4 Wed. 4082 22 Mar. (81) 39 11 Mar. (70) 48 28 Feb (59) 57 18 Mar. (78) 8 Mar. (67) 15 25 Feb. (58) 24 16 Mar. (76) 4 Mar.: (64) 42 28 Mar. (82) 51 12 Mar. (71) 02 Maz. (61) 9 20 Mar. (80) 18 9 Me. (88) 27 28 Feb. (57) 36 17 Mar. (78) 8 Mar. (86) 54 23 Feb. (54) 3 14 Mar. (78) 12 Mar. (68) 21 21 Mar. (81) 3011 Maz. (70) 89 28 Feb. (69) 37 48 19 Mar. (78) 49 57 7 Mar (67) 2 6 26 Feb. (56) 24 Mar. (88) 24 Mar. (83). 23 Mar. (88) 23 Mar. (82) 24 Mar. (83) . 24 MAR (83) . 28 Mar. (83). 23 Mar (82) 24 Mar. (83). 24 Mar. (83) 23 Mar. (83) 23 Mar. (82) 24 Mar. (83) 94 Mar. (83). 28 Mar. (88) 24 Mar. (88) . 24 Maz. (83) 24 Mar. (83) . 23 Maz. (83) . 24 Mor. (83). 4 Wod. . 3 Tro. Jo Sat. . 6 Pri. .8 Tane. 1 Sun. . O Sat. . 4 Wed. i San. O Sat. 6 Thar. . . Mon. 1 Ban. 5 Thur... 4 Wod. 6:5298 290-8845 266-5869 181-2898 7-01.27 41-6950 . 4084 4085 4086 258-0499 Mon. 181 7727 4087 4088 . 11 168-4650 49-1779 76-8808 4089 I 9 Mon. . 191-2152 Wod. Thur. 6 Pri. . 1 Sun. 2 Mon. . 8 Tros. . Wed. 6 Fri. 4090 4091 4092 4093 6. Tri. 5 Thur. 2 Mon. o Sat. . . 166-9898 201-6204 77-8482 291-6980 18 1
Page #275
--------------------------------------------------------------------------
________________ 248 EPIGRAPHIA INDICA. (VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Mean intercalated (adhika) lunar month. Saka. Mosbadi solar year in Bengal. Chaitridi Vikrama Kollam. A.D. Southern system. Northern system. 4 4096 917 4097 918 401 169-70 170-71 171-72 994-95 995-96 *996-97 28 Jaya . 29 Manmaths 30 Durmukha 12 Phalguns . 4098 4099 1052 1058 1054 1055 1056 1057 1058 172-73 997-98 31 Hemalamba 920 921 . 4100 I 8 Karttika 4101 922 4102 928 4108 5 Srivana 4104 4105 173-74 174-75 175-78 176-77 177-78 178-79 179-80 180-81 181-82 182-83 4106 4107 4108 30 Durmukha 31 Hemalamba 32 Vilamba 33 Vikarin. 34 Sarvarin. 35 Plava 36 Subhaksit 37 sobban .38 Krodhin 39 Visvavasu 40 Paribhava 41 Plavanga 42 Kilaks. 43 Saumys 44 Sadharana 45 Virodbakpit 46 Paridhavin .47 Pramadin . 48 Ananda. 49 Raksasa 50 Anala . 51 Pingala . . 52 Kalayukta . 53 Siddharthin 54 Randra. 1 Chaitra 1 10 Pausha 4109 4110 995-99 32 Vilamba 999-1000 33 Vikarin. 1000-01 34 Sarvarin 1001-02 35 Plava , 1002-08 36 Sabbakrit 1003-04 37 sobbans *1004-05 38 Krodhin 1005-06 39 Visvavasa 1006-07 40 Parabhavs 1007-08 41 Plavangs *1008-09 42 Kilaka. 1009-10 48 Saumya . 1010-11 44 Sadharana 1011-12 45 Virodbakrit 1012-18 | 46 Paridhavin 1013-14 47 Pramadin 1014-15 48 Ananda. 1015-16 49 Rakshasa *1016-17 50 Anala . 1017-18 51 Pingala . 1018-19 62 Kalayukta 1065 1066 1067 1068 . 7 Asvinat | 3 Jyeshtha . 4115 1071 1072 416184-86 185-88 186-87 187-88 188-89 189-90 190-91 191-92 192-98 198-94 4116 12 Phalguna . 1074 4119 . 8 Kattika 4120 1076 + See "Remarks," p. 215 above.
Page #276
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 249 XC-contd. COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAN LUNI-SOLAR YEAR (MBAN SUNRISE OF THE CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Kali. Day and month, A.D. Time of Wook-day. mean Mesha samkranti. Day and month, A.D. Week-day. a (beret, the index of the tithe). I 17 19 2023 6 Pri. . 326-3804 4096 24 Mar. 202 1033 4097 1 O Sat. . 1 Sun. . 2 Mon. Wed. 3 Tues. 2 Mon. 236-7856 4098 6 Fri. 112-5085 4099 Thur. 326-8633 4100 24 Mar. (83) (83) . 23 Mar. (83) 24 Mar. (83) 24 Mar. (83) 24 Mar. (83) 23 Mar. (83) 24 Mar. (83) 24 Mar. (83). 24 Mar. (83) 23 Mar. (83) 4 Wed. 2 Mon. 22-9136 4101 O Sat. 237-2685 M. S. 14 15 16 Mar. (75) 5 Mar. (64) 23 Mar. (83) 42 12 Mar. (71) 512 Mar. (61) 0 20 Mar. (79) 27 9 9 Mar. (69) 39 18 26 Feb. (57) 51 27 17 Mar. (76) 6 Mar. (65) 45 24 Feb. (55) 54 14 Mar. (73) 8 Mar. (62) 22 Mar. (81) 10 Mar. (70) 28 Feb. (59) 4102 4103 4 Wed. 2 Mon. 3 Tues. 112-9914 . 3 Tues. 147-6737 4104 23-3966 4105 4 Wed. 5 Thur. 237-7514 4106 24 Mar. O Sat. O Sat. 5 Thur. 4 Wed. 1 San. 0 Sat. 272-4338 4107 . 1 Sun. 4108 148-1566 182-8390 4109 4110 22 4 Wed. 58-5618 2 Mon. 3 Tues. Thur. Fri. 2 Mon. 272-9167 1 Sun. 307-5991 4111 4112 4113 sate 6 Thur. . 183-3219 24 Mar. (83) 24 Mar. (83) 23 Mar. 24 Mar. (83) 24 Mar. (83) 24 Mar. (83) 23 Mar. (83) 24 Mar. (83) 24 Mar. (83). 24 Mar. (83) 23 Maz. (83). 24 Mar. (83) 24 Mar. (83), 1 Sun. 4114 . . . 59.0447 93-7270 2 Mon.. 1 Sun. 6 Fri. 4 Wed. 2 Mon. 808-0820 16 40 488 Mar. (67) .22 52 57 25 Feb. (56) . 5 5 6 15 Mar. (74) . 11 17 15 5 Mar. (64) 17 29 24 23 Mar. (82) .23 41 33 12 Mar. (72) 5 58 421 Mar. (60) 12 5 51 20 Mar. (79) 3 Tues. 4 Wed. I 5 Thur. . 1 Son. I 2 Mon. 4115 4116 4117 4:1323 .! 218-4872 4115 6 Pri. 94-2100 4119 6 Thnr. 128-8924 4120 2 x
Page #277
--------------------------------------------------------------------------
________________ 250 Kali. Saka. 1 4348 4148 NO 4345 2 co Chaitradi Vikrama. Meshadi solar year in Bengal. Sa CONCURRENT YEAR. Kollam. EPIGRAPHIA INDICA. 4 A.D. 16 5 JOVIAN SAMVATSABA. 1019-20 58 Siddharthin 1020-21 54 Raudra. 1021-22 55 Darmati. 1022-23 56 Dundubhi 1028-24 57 Radhirodgarin. #1024-25 58 Raktaksha 1025-26 59 Krodhana 1026-27 60 Kahaya. 1027-28 1 Prabhava #1028-29 2 Vibhava 1029-30 8 Sakla 4121 942 1077 4.26 194-95 4122 943 1078 427 195-96 4123 944 1079 4.28 196-97 4124 945 1080 429 197-98 4125 946 1081 480 198-99 4126 947 1082 431 199-200 4127 948 1088 432 200-01 4128 949 1084 433 201-02 41,29 950 1085 434 202-03 4180 951 1088 435 203-04 4181 952 1087 436 204-05 4182 953 1088 437 205-06 4138 954 1089 438 206-07 4134 955 1090 439 207-08 #1032-38 4185 956 1091 440 208-09 1033-34 7 Srimakha 4188 957 1092 441 209-10 1034-85 8 Bhava 4 4187 958 1098 442 210-11 1035-86 9 Yuvan. A188 959 1094 443 211-12 1086-87 10 Dhatri 4189 960 1095 444 212-18 1037-88 11 16vara 4140 961, 1096 445 4141 962 1097 448 968 1098 447 964 1099 448 1030-31 4 Pramoda 1081-82 6 Prajapati 6 Angiras. 218-14 214-15 215-16 1038-39 12 Bahudhanya 1089-40 18 Pramathin 1040-41 14 Vikrama. 1041-42 15 Vrisha 1042,48 16 Chitrabhanu 1048-44 17 Subhana 216-17 965 1100 449 217-18 906 1101 450 218-19 Southern system. 6 . . * . Northern system. 7 55 Durmati. 56 Dundubhi 57 Rudhirodgarin 58 Raktaksha 59 Krodhana 60 Kshaya 1 Prabhava 2 Vibhava. 3 Sukla 4 Pramoda 5 Prajapati 6 Angiras. 7 srimukha 8 Bhava * 9 Yuyan 10 Dhatri 11 16vara 12 Bahudhanya 13 Pramathin 14 Vikrama 15 Vrisha 16 Chitrabhana 17 Subhana 18 Tarapa . 19 Parthiva [VOL. XVII. TABLE Mean intercalated (adhika) lunar month. 8a 5 Sravana 1 Chaitra 10 Pausha 6 Bhadrapada 3 Jyeshtha 11 Magha 8 Karttika 4 Ashadha 1 Chaitra
Page #278
--------------------------------------------------------------------------
________________ No. 15.) THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 251 xc-contd. COMMENCEMENT OF THE MEAN SOLAR YEAR. MEAX LUNI-SOLAR YEAR MEAN BUNRISE OF THE CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Kali. Day and month, A.D. Time of Week-day. mean Mesba sankranti. Day and month, A.D. Week-day. a heret, the index of tho tithi). 17 19 20 23 4-6131 4121 3 Tues. 5 Thur. 6 Fri. 2 Mon. 0 Sat. 6 Fri. 218-9701 4122 253-6525 0 Sat. 3 Toes. 129-3753 4123 4124 4125 1 Sun. 50981 . . . . O Sat. 6 Fri. 4 Wed. 39-7806 3 Taes. 4 Wod. 4126 254-1354 4127 5 Thur. 3 Tues. 288.8177 4128 6 Fri. 164.5406 4129 O Sat. 4 Wed. . 1 Sun. 40-2635 4130 4131 24 Mar. (83), 24 Mar. (84) 24 Mar. (83) 24 Mar. (83) 24 Mar. (83) 24 Mar. (84) 24 Mar. (83). 24 Mar. (83) 24 Mar. (83) 24 Mar. (84). 24 Mar. (83) 24 Mar. (83) 24 Mar. (83) 24 Mar. (84) 24 Mar. (83) 24 Mar. (83) 24 Mar. (83) . 24 Mar. (84) 24 Mar. (83) 24 Mar. (83) 24 Max. (88) . 24 Mar. (84). 24 Mar. (83) 24 Mar. (83) 24 Mar. (88) 2 Mon. 3 Tues. 4 Wed. 6 Fri. Sat. H. M. S. 18 18 0 9 Mar. (68) 0 30 9 27 Feb. (58) 6 42 18 17 Mar. (76) 12 54 27 6 Mar. (65) 36 23 Feb. (54) 4513 Mar. (73) 7 30 54 3 Mar. (62) 18 43 322 Mar. (81) 12 11 Mar. (70) 21 28 Feb. (59) 30 18 Mar. (77) 89 8 Mar. (67) 48 25 Feb. (56) 57 15 Mar. (75) 4 Mar. (63) 15 23 Mar. (82) 32 24 13 Mar. (72) 331 Mar. (61) 9 56 42 20 Mar. (79) 16 8 519 Mar. (68) 22 21 0 27 Feb. (58) 916 Mar. (76) 6 Mar. (65) 16 57 27 23 Feb. (54) 23 9 36 14 Mar. (73) 3 Tues. 1 Sun. 5 Thur. 4 Wed. 74-9458 289-3006 165.0235 4132 4133 4134 199-7059 75-4287 . 1 San. 4135 1 San. O Sat. 110-1111 5 Tirar. 324-4660 200-1888 2 Mon. 1 Sun. 5 Thor. 4136 4137 4138 4139 4140 234-8712 110-5940 . 2 Mon. 4 Wed. 5 Thur. 6 Fri. . 1 2 Mon. . 3 Tues. 4 Wed. 5 Thur. O Sat. . 3 Taes. 324-9489 4141 4142 1 San. 20-9992 6 Fri. 4143 . 3 Tues. 235-3541 111-0793 145-7593 4144 2 Mon. 4145 2 m 2
Page #279
--------------------------------------------------------------------------
________________ 252 EPIGRAPHIA INDICA. [VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Mean intercalated (adhika) lunar month. Kaii. Saka Kollam. A.D. Chaitradi Vikrama. 1 Southern system. Northern system. 1 2 3 82 4146 9 Margasira 4147 1103 4148 1104 4149 6 Bhadrapada . 4150 4151 . 4152 3 Jyeshtha ! 1014-45 18 Tarana . 1045-46 19 Parthiva 1046-47 20 Vyaya: 1047-48 21 Sarvajit. *1048-49 22 Sarvalbarin 1019-5023 Virodhin 1050-51 24 Vikrita. 1031-52 25 Khara . *1052-53 26 Nandana 1053-54 27 Vijaya * 1054-55 28 Jaya 1055-56 29 Manmatha *1056-57 30 Darmukha 1057-58 31 Hemalamba 4153 . 4154 11 Magha 451 219-20 220-21 221-22 222-23 223-24 224-25 225-26 226-27 227-28 228-29 229-30 230-31 231-32 232-33 233-34 234-35 467 235-36 236-37 237-38 238-39 4155 4156 . . . 4157 8 Karttika 4158 .. 20 Vyaya. . 21 Sarvajit .22 Sarvadharin 23 Virodhin 21 Vikrita . 25 Khara .26 Nandana . 27 Vijaya. 28 Jaya : 29 Manmatha 30 Darmukha 81 Hemalamba 32 Vilamba 88 Vikarin. 84 sarvarin .85 Plavs .88 Sabhakpit 37 sobhana 38 Krodhin 39 Visvavasi 40 Parabhava 41 Plavanga 42 Kilaka, 48 Saumya . 44 Sadharane 4159 . 4160 1058-59 32 Vilamba 4 Ashadha 4161 1117 4162 1118 4163 1119 . 1 Chaitra 4164 1120 4165 9 Margasira . 1121 1122 1059-60 33 Vikarin. *1060-61 34 Sarvarin 1061-6235 Plava . 1062-63 | 36 Sabhaksit 1063-64 87 sobhana *1064-65 38 Krodhin 1065-68 39 Vigvavagu 1066-67 40 Parabhava L067-68 41 Plavanga *1068-69 42 Kilata. 6166 239-40 . 4167 4168 6 Bhadrapada. 240-41 841-4% 242-43 243-44 4169 1125 1126 4170 991
Page #280
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 258 XC-contd. COMMENCEMENT OF THE MEAN SOLAR YEAR. MBAN LUNI-BOLAB YEAR (MEAN SUNRTER OY THE CIVIL DAY ON WHICH CRAITRA SUKLA 1 ENDS). Kali. Day and month, A.D. Time of Week-day. mean Mosha sankranti. Day and month, Week-day. A.D. a (bere , the index of the tiths). 18 19 20 23 17 M. 8 Fri. 21.4821 4146 JO Sat. . 1 San. 2 Mon. S. 45 2 Max. (62) 54 21 Mar. (80) 11 Mar. (70) Thur. 56-1645 4147 4148 270-5194 Taes. Sat. 3 Tues. 146-2422 4149 Thur. 6 Fri. 180-9246 56-6475 . 271-0023 O Sat. 2 Mon. . 8 Taes. 1 Sun. O Sat. 4 Wed. 3 Toes. 3 Tuer. & 805-6846 181-4075 216-0899 Wed. 5 Thur. O Sat. 0 Sat. 5 Thur. 91-8127 308-1675 24 Mar (84). 24 Mar. (83) . 24 Mar. 24 Mar. (83) 24 Mar. (84) 24 Mar. (83) 24 Mar. (88) 25 Mar. (84). 24 Mar. (84) 24 Mar. (83) 24 Mar. (83) 25 Mar. (84) 24 Mar. (84) 24 Mar. (83) 24 Mar. (83) 25 Mar. (84) 24 Mar. (84) 24 Mar. (83) 24 Mar. (83) . 25 Mar. (84) 24 Mar. (84) 24 Mar. (83) 24 Mar. (88) 25 Mar. (84). 24 Mar. (84) 4150 4151 4169 4158 4154 4155 4156 4167 4158 4159 4160 4161 4182 4168 2-2180 3 Tues. 1 San. 216-5728 21 18 Mar. (78) 7 Mar. (66) 25 Feb. (56) . O 46 48 16 Mar. (75) 58 57 4 Mar. (64) 6 23 Mar. (82) 19 23 15 12 Mar. (71) 35 24 2 Mar. (61) . 7 47 33 19 Mar. (79) . 59 42 9 Mar. (68) 20 11 51 26 Feb. (57) .224 017 Mar. (76) . 8 36 9 Mar. (65) 18 23 Feb. (54) 27 14 Mar. (78) 19 86 3 Mar. (62) 45 21 Mar. (81) / 15 54 10 Mar. (89) 828 Feb. (59) 4 1 12 19 Mar. (78) 10 18 21 7 Mar. (67) Sun. Mon. Tues. Thur. . 5 Thur. 92-2956 126-9780 2-7009 Sat 14 4 Wed. 1 Sun. 6 Fri. .Thar. 2 Mon 1 San. . San. 217.0556 251-7380 127.4809 Tues. Wed. 162-1433 4164 4165 4168 4187 4168 4160 37.8661 6 Thur. 6 Fri. Thar. Tues. 252-2210 . Mon. 1 Sun. 2 Mon. 286-9054 162-6268 Fri. 4170
Page #281
--------------------------------------------------------------------------
________________ 25-4 Kali. 1 CONCURRENT YEAR. HOHE Kollam. A.D. 4 Saks. 2 3 3a EPIGRAPHIA INDICA. 4171 992 1127 476 244-45 4173 4174 4175 4177 4172 993 1128 477 245-46 994 1129 478 246-47 995 1130 479 247-48 996 1131 480 248-49 4176 997 1132 481 249-50 998 1133 482 250-51 4178 999 1134 483 251-52 4179 1000 1135 484 252-58 4180 1001 1186 485 253-54 4181 1002 1187 486 254-55 4182 1003 1138 487 255-56 4188 1004 1139 488 256-57 4184 1005 1140. 489 257-58 4185 1006 1141 490 258-59 4186 1007 1142 491 259-60 4187 1008 1143 492 260-61 4188 1009 1144 493 261-62 4189 1010 1145 494 262-68 4190 1011 1146 495 -208-64 4191 1012 1147 496 264-65 4199 1013 1148 497 285-66 4198 1014 1149 498 266-67 4194 1015 1150 499 267-68 4195 1016 1151 500 268-69 5 1081-82 JOVIAN SAMVATSABA. 1082-83 Southern system. 1069-70 43 Saumya. 1070-71 44 Sadharana 1071-72 45 Virodhakrit *1072-73 46 Paridhavin 1073-74 47 Pramadin 1074-75 48 Ananda. 1075-76 49 Rakshasa *1076-77 50 Anala 1077-78 51 Pingala. 1078-79 52 Kalayakta 53 Siddharthin 1079-80 *1080-81 54 Raudra 55 Durmati 56 Dundabhi 1083-84 57 Radhirodgarin. *1084-85 58 Raktaksha 1085-86 59 Krodhana 1086-87 60 Kahaya : 1087-88 1 Prabhava *1088-89 2 Vibhava 1089-00 3 Sukla 1090-91 4 Pramoda 1091-92 5 Prajapati *1092-93 6 Angiras. 1093-94 7 Srimukha 6 Northern system. 7 45 Virodhakrit 46 Paridhavin 47 Pramadin 48 Ananda. 49 Rakshasa 50 Analat 52 Kalayukta 53 Siddharthin 54 Raudra 55 Durmati 56 Dundubhi 57 Rudhirodgarin. 58 Raktaksha 59 Krodhana 60 Kshaya 1 Prabhava 2 Vibhava 3 Sakla 4 Pramoda 5 Prajapati 6 Angiras. 7 Srimukha 8 Bhava. 9 Yuvan 10 Dhatri [VOL. XVII. TABLE Mean intercalated (adhika) lunar month. 8a 2 Vaisakha 11 Magha 7 Asvina Ashadha 12 Phalguns ... 9 Margasira :: 6 Bhadrapada. 2 Vaisakha ... 11 Magha "I 7 Asvina +51 Pingala was suppressed in the north, according to both "true" and mean systems, in Brahma-Siddhanta reckoning.
Page #282
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM. XC-contd. COMMENCEMENT OF THE MBAN SOLAR YEAR. MBAN LUNI-SOLAR YEAR (MBAN SUNRISE OF THE CITIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Kali. Day and month, A.D. Time of Week-day. mean Meshe | sankranti. Day and month, A.D. Week-day. a (heret, the index of the tithe). 13 14 23 3 Toes. 38.3490 . . 4171 4172 73.0314 25 Mar. . . 287-3863 4173 . 322-0686 197-7915 73.5143 4174 4175 4176 3 Tues. Wed. Fri. O Sat. 1 Sun. 2 Mon. 4 Wed. 5 Thar. 8 Fri 1-San. 2 Mon. 3 Tues. Wed. . . 106-1967 17 M. S. 16 25 30 24' Feb. (55) .22 37 39 15 Mar. (74) 49 48 5 Mar. (64) 11 57 23 Mar. (83) 612 Mar. (71) . 23 15 1 Mar. (60) 24 20 Mar. (79) . 11 50 33 9 Mar. (69) 18 42 26 Feb. (57) o 14 51 17 Mar (78) .627 06 Mar. (65) . 12 39 9 24 Mar. (84) 51 18 13 Mar. (72) 3 27 3 Mar. (62) 36 22 Mar. (81) 13 27 45 10 Mar. (70) 4177 4178 Mon. 0 Sat. 6 Fri. Taes. O Sat. 6 Fri. 4 Wed. 1 Sun. O Sat. 4 Wed. 3 Taes. o Sat. 5 Thur. 4 Wed. 322 5515 198.2744 4179 4180 232-9568 . . 108-6796 24 Mar. (88) 24 Mar. (83) (84) 24 Mar. (84) 24 Mar. (88) Mar. (83) 25 Mar. (84) 24 Mar. (84) 24 Mar (83). 25 Mar. (84) 25 Mar. (84) . 24 Mar. (84). 24 Mar (83) 25 Mar. (84): 25 Mar. (84) 24 Mar. (84). 24 Mar. (83) 25 Mar (84) 25 Mar (84). 24 Mar. (84) 24 Mar. (88) 25 Mar. (84) 25 Mar. (84) 24 Mar. (94) 24 Mar. (89) 4181 . . 4182 143-3620 19-0848 . 18 O Sat. 4183 4184 4185 4186 4187 . 1 San. 233.4397 26801220 143-8449 19.5678 54.2501 268-6050 1 San. 2 Mon. 5 Thur. 4 Wed. . 4188 . 5 Thur. 2 Mon. 6 Fri. Fri. 144-3278 4189 4190 4191 . Thur. 179-0102 54:7330 3 18 Mar. (77) 4 12 8 Mar. (67) 18 2125 30 15 Mar. (74) 4 Mar. (63) 8 4823 Mar. (82) 15 4 57 12 Mar. (72) 21 17 6 1 Mar. (60) O Sat. Mon. 3 Tues. 4 Wed. 5 Thur. 4192 Mon. 1 San. . 4198 89-4154 203-7708 4194 . 3 Tier 179-4930 4195
Page #283
--------------------------------------------------------------------------
________________ 256 EPIGRAPHIA INDICA. [VOL. XVII TABLE CONCURRENT YEAR, JOVIAN SAMVATSARA. Mean intercalated (adhika) lanar month. Kali. Saka Kollam. A.D. Chaitradi Vikrama. Southern system. Northern system. - 4196 1017 4197 4198 4199 1155 4200 166 . 4201 4202 4203 . 4204 1152 1018 1153 1019 1154 10/20 1021 1022 1023 1158 1024 1159 1025 1160 1026 1161 1027 1162 1028 1163 1029 1164 1030 1165 1031 1168 1032 1167 1033 1168 1034 1169 1035 1170 1038 1171 1037 1038 1173 269-70 270-71 271-72 272-73 273-74 274-75 27-5-76 276-77 277-78 278-79 279-80 280-81 281-82 252-83 283-84 284-85 285-86 4205 4206 4207 4208 1094-95 8 Bhava . 11 Isvara . 1095-96 9 Yuvan. 12 Bahadhanya. *1096-97 10 Dbatri. 13 Pramathin 4 Ashadha 1097-98 11 Isvara . 14 Vikrama 1098-99 12 Bab udhanya. 15 Vrisha 12 Phalguna 1099-1100 13 Pramathin 16 Chitrabhanu *1100-01 14 Vikrama 17 Subhana . 1101-02 15 Vpisha . . 18 Tarana 9 Margasira 1102-03 16 Chitrabbana 19 Parthiva 1103-04 17 Subhana 20 Vyaya. *1104-05 18 Tarana. 21 Sarvajit . . o sravana 1105-06 19 Parthiva 22 Sarvadharin ! 1106-07 20 Vyaya. . 23 Virodhin 1107-08 21 Sarvajit . 24 Viktita . 2 Vaisakha *1108-09 22 Sarvalharin . 25 Khara . . 1109-10 23 Virodhin 26 Nandana 10 Pausha 1110-11 24 Viktita 27 Vijaya. 1111-1225 khara 25 Khara . . 28 Jaya : 1 *1112-1326 Nandana 29 Manmatha 7 Asvina 1113-14 27 Vijaya. 30 Darmakha 1114-15 28 Jaya . . 31 Hemalamba 1115-16 29 Manmatba 32 Vilamba 3 Jyeshtha 1116-17 30 Dormukha 33 Vikarin. 1117-18 31 Hemalamba .34 Sarvarin | 12 Pbalgana 1118-19 32 Vilamba 35 Plava . 4209 4210 4211 4212 4213 286-87 4214 4215 112 4216 4217 287-88 288-89 289-90 290-91 291-92 292-93 . 4218 1039 1174 4219 1175 1040 1041 1170 4220 293-94
Page #284
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA : MEAN SYSTEM. XC-contd. COMMENCEMENT OF THE MBAN SOLAR YEAR. MBAN LUNI-BOLAR YRAR (MRAN SUNRISE OF THE SIVIL DAY ON WAICH CHAITRA GUILA 1 ENDS). Kali. Day and month, A.D. Time of Week-day. mean Mesha sankranti. Day and month, A.D. 1 Week-day. (heret, the index of the tithi). 13 14 19 20 28 4198 . Mon. .8 Fr. Wed. 25 Mar. (84) . 25 Mor. (84). 24 Mar. (84) . 24 Mar. (83) 25 Mar. (84) . 25 Mar. (84) 24 Mar. (84) . 24 Mar. (88) 25 Mar. (84) 4157 4198 4199 214-1755 89-8988 304-2531 0-8085 214-6684 ootto . Sat. . 1 San. . 2 Mon. Toes. . 5 Thur. 1 6 Fri. . 0 Eat. | 1 San. 3 Taos. 4 Wed. 4200 249-3408 4201 16 Tues. 125.0687 4208 . 0-7865 4200 o Eat. 6 Fri. 35.4689 4901 26 Mar. 4 Wed. 249-8237 4205 5 Thur. 4206 4207 17 H. M. 8. 29 15 20 Mar. (79) 41 4 9 Mar. (68) 16 53 38 27 Feb. (58) . 22 5 42 16 Mar. (75) 4 17 516 Mar. (65) 10 30 0 25 Mar. (84) 9 13 Mar. (78) 18 2 Mar. (61) 27 21 Mar. (80) . 11 11 Mar. (70) .17 28 Feb. (59) 23 42 54 18 Mar. (77) 5 55 3 7 Mar. (66) . 12 7 12 25 Feb. (56) .18 19 21 15 Mar. (75) 31 30 4 Mar. (63) 43 89 23 Mar. (82) 12 55 48 12 Mar. (71) 19 7 57 1 Mar. (61) 1 20 6 20 Mar. (79) 32 15 9 Mar. (88) 24 26 Feb. (57) 33 16 Mar. (76) 426 Mar. (65) 61 24 Mar. (88) 125-5466 160-2289 86-9518 250-8066 284-9889 4208 4209 24 Mar. (84) 24 Mar. (88) 25 Mar. (84). 25 Mar. (84) 24 Mar. (84). 25 Mar. (84). 26 Mar. (84) BE Mar. (84) . 24 Mar. (84) . 26 Mer. (84) . 26 Mar. (84) 25 Mar. (84) . 24 Mar. (84) . 26 Mar. (84) 26 Mar (84) 6 Fri. 1 San. 2 Mon. 3 Toes. . 5 Thur. 6 Fri. . 1 O Sat. . 1 1 San. . 1 3 Tres. 4 Wed. . 5 Thur. . 16 Fri. 1 San. Mon. 4210 4211 1 Ean. O Sat. 4 Wed. 2 Mon. 1 Eun. 5 Thur. 4 Wed. 1 Sun. 6 Fri. 5 Thur. . 160-7118 196-8942 71.1171 285-4718 320-1543 4213 4213 4214 4215 4216 4217 2 Mon. 195-8771 . 6 Fri. 71-6999 . 5 Thur. 108-2823 4218 . 320-6872 4919 3 Tues. 1 Sun. 16-6876 4820
Page #285
--------------------------------------------------------------------------
________________ 248 EPIGRAPHIA INDICA. (VOL. XVII: TABLE CONCURRENT YEAR. JOTIAN BAKTATSABA. Moun intercalated (adhika) lanar month. Kali. Saku. Meshidi rolar your in Bengal. Kollam. A.D. Chaitridi Vikams Southern syren. Northern system. 1938 680 1049 1177696 1048 1178 627 1044 1179 698 1046 1180 1048 1181 1047 1188 681 1046 1188 1144 1060 1051 488 4284 4938 1040 & 4880 1069 294-95 296-98 296-97 197-88 998-99 200-800 800-01 801-08 808-08 801-04 804-05 206-06 308-07 807-06 808-09 309-10 810-11 811-18 812-18 818-14 314-16 4881 . 1058 1964 1119-20 88 Vikirin. .38 Sabhakrit *1180-2184 sarvaria .87 sobhana. 8 Kirttika 1121-8286 Plavu . 88 Krodhin. . 1128-88 88 Subhakrit 89 'livivu 1188-8487 sobhana . 40 Pardbhava 5 Srivapa *1184-36 38 Krodhin. 41 Plavanga 1126-98 89 Visvivas 42 Kilaka. I 1186-27 40 Parabban / 49 Saumya 2 Vaibakha 1187-28 41 Platanga 44 Eldhirana 1128-29 48 Kilaks. 45 Virddhakrit 10 Pausha 1129-8048 Asemya . 46 Paridhavin . 1180-81 4 Slidhirapa 47 Pramadin 1181-8946 Virodhakrit . 48 Ananda . . 7 Alvin *1181-88 46 Paridhavin .49 Raksas 1183-8447 Pramidin . 50 Anals . . 1184-86 48 Ananda . . 61 Pingula . 8 Jyishtha 1186-88 49 Rakshas. 62 Kilayakta 1186-8750 Apala . .68 Siddharthin 12 Phalguns 1187-8861 Pingala . . 54 Raadrs. . 1188-89 68 Kilayakta 56 Darmati. 1189-4068 Siddharthiin 56 Dandabhi 8 Karttika 1140-41 54 Radn. . 87 Radhirddgatin. 1141-4266 Darmat. 58 Raktakaha 1142-48 68 Dandnbhi 59 Krodhana 5 Sravana 1148-4407 Radhirddgarin. 60 Kshaya. . * 1066 1180 . 1068 1191 1067 1191 1068 1198 1069 1000 1196 1081 116 1002 1197 1988 1198 1084 11% 1086 1300 1086 1.301 1941 816-18 816-17 817-18 818-19 4246 550
Page #286
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA : MEAN SYSTEM. 269 xo-contd. COMMENCEMENT OF THE MBAN SOLAB YBAR. MBAN LUNI-HOLAR YBAR (MEAN STN RISK OF THE CIVIL DAY ON WHICH CEAITRA BUKLA 1 ENDB). Kall Day and month, Time of Week-day. mean Maha smkrinti. ! Day and month, A.D. AD Week-day. a (here=t, the index of the tith). 14 19 20 23 2810484 6 Frl. 8 Tues. 106-7662 to 2 Mon. 141.4477 6 Pri 171704 4224 4 Wed. 8 Toon 231.5258 286-2077 4220 O Sat. 4228 4 Wed. 8 Tao. 141 9806 17-8583 52-8857 286-6906 8018799 177-0958 0 Sat. 1 Ean. 4230 0 4283 25 Mar. (84) 24 Mar. (84). 26 Mar. (84). 25 Mar. (84) 25 Mar. (84) . 24 Mar. (84) 25 Mar. (84) 25 Mar. (84) 25 Mar. (84) 24 Mar. (84) 25 Mar. (84). 25 Mar. (84) 28 Mar. (84). 24 Mar. (84). 25 Mar. (84) 25 Mar. (84) 25 Mar. (84). 24 Mar. (84) 25 Mar. (84) 25 Mar. (84) 25 May. (84) 25 Mar. (85). 25 Mar. (84): 26 Mar. (84) 86 Mar. (84). H. M. S. 3 Tues. .14 88 0 14 Mar. (78) . 4 Wed. . 20 45 9 2 Mar. (62) . 6. Fri. 18 21 Mar. (80) . o Sat. 27 10 Mar. (69) . 1 Bun. 86 28 Feb. (69) Mon. 83 45 18 Mar. (78) 4 Wed. 3 45 647 Mar. (66) 5 Thars. . 9 58 824 Feb. (66) 8 Fri. 18 10 12 16 Mar. (74) . 22 21 4 Mar. (64) . Mon 30 28 Mar. (82) 8 Tues. 48 s 12 Mar. (71) . 4 Wed. 481 Mar. (80) 6 Thars. . 10 57 19 Mar. (79) . 28 6 9 Mar. (68) . 35 16 26 Feb. (67) 2 Mon. . 17 47 24 17 Mar. (78) 69 886 Mar. (65) 5. Thurs. . 11 42 4 Mar. (88) 1 6 Pri. 12 28 51 18 Mar. (72) 18 86 0 8 Mar. (62) . Mon. 48 9 21 Mar. (81) 1 O 18 10 Mar. (09) Wed. 18 19 27 27 Feb. (58) 6 Thors.. 19 94 8 18 Mar. (77) O Sat. . 0 Eat 4 Wed. 1 8an. O Sat. 6 Thun Mon. 1 San. 5 Thon. Wed. Sun. Sun. 82-8186 87-5011 801-8558 177-8787 91-2811 87-9840 182-8868 9998-3892 8 Tue 29 4888 . 4940 4241 . 1 Sat. 6 Pri 2197440 Tae. 5 Than 2 Mon. 16 Pri. 640 | 247-4984 188-0492 . 900887214 . 88-6545 6 'Thor.. Chaitra fakla 1 wa sapproved.
Page #287
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. (VOL. XVII TABLE CONCURRENT YEAR. JOVIAN SAMTATSARA. Mean intercalated (adhika) lanar month. Kall Meshadi solar year in Kollam. Chaitradi Vikrama Bengal. Eouthern system. Northern system. 1 1. 18 4248 1202 1208 1204 4948 1905 4250 1206 4261 1207 4252 1067 1068 1088 1070 1071 1072 1078 1074 1075 1076 1077 1078 1079 1080 1908 1209 4258 4254 1210 4256 4858 4267 1211 1212 1218 1214 1915 4258 919-20 *1144-46 58 Raktaksha 1 Prabhava 820-21 1145-46 59 Krodhana. 2 Vibhava , . 1 Chaitra 821-22 1146-47 60 Kshaya . . 8 Sukla 822-28 1147-48 1 Prabhava 4 Pramoda. 10 Pausha 828-24 *1148-49 ? Vibhavs. 5 Prajapati 824-26 1149-50 8 Sukla . . 8 Angiras . . 826-28 1160-514 Pramoda 7 Srimukhs 6 Bhadrapada. 826-27 1161-62 6 Prajapati 8 Bhava 827-28 1162-58 6 Angiras . 9 Yavan . . 828-29 1168-54 | 1 Srimakha | 10 Dhatri . . 3 Jyeshtha 829-80 1164-66 8 Bhavs . 11 Isvara 880-81 1168 6.19 Yayan 12 Bahudhanya | 11 Migha 881-82 *1158-67 10-Dhitri . . 13 Pramathin 882-88 1167-68 11 Ivars . .14 Vikrama 883-84 1168-69 12 Bahodhanya . 16 Vrisha 8 Karttiks 884-85 1169-60 18 Pramithin 18 Chitrabhanut . 885-86 *1180-61 14 Vikrama 886-87 1161-62 16 Vrisha . . 19 Parthiva 5 Sravana . 887-881 1162-63 18 Chitrabbana. 20 Vyaya. 888-89 1188-84 17 Subhana . 21 Sarvajit . 899-40 1 164-65 18 Tirana . .22 Sarvadlarin . 1 Chaitra 840-41, 1165-68 19 Parthiva 28 Virodhin 841-42 1166-87 20 Vyaya . . 24 Vikrita 10 Prusha 842-43 1187-88 21 Sarvajit . .25 Kbara 348-44 *1968-69 22 Sarvadharin . 28 Nandana 4259 1980 1081 1916 1082 1817 4281 4282 1088 1918 18 Tarana 1988 1084 1219 1085 1290 1088 4964 4986. 1986 1987 1087 1088 1089 1228 1899 4868 4889 470 1090 1826 . 1091 675 17 Sabbinu ww wapproved in the north by the Brahma-Siddhanta, buti in true and munn reckoning.
Page #288
--------------------------------------------------------------------------
________________ No. 15.) THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 201 XC-contd. COMMENCEMENT OF THE MBAN SOLAR YEAR. MBAX LUNI-SOLAR YEAR (MBAN SUNRISE OF THE CIVIL DAY ON WHICH CHAITRA E UKLA 1 ENDB). Day and month, A.D. Time of Weekday. mean Mesha sankranti. Day and month, A.D. Wook-day. (here -t, the index of the tith). 13 14 17 20 23 8 Tues 247-9098 . . Sat. 128-8821 Sat. San. 2 Mon. Tuos. 158-8145 Tac Thurs. Mon. 1950 Pri. O Sat 84-0878 88-7197 288-0748 158-7974 198-4798 Wod. Tuos. San. 3 Tres O Sat. -69-2098 Thar. 288-5876 4856 4866 4866 26 Mar. (85) 25 Mar. (84). 25 Mar. (84) 26 Mar. (84) 25 Mar. (85) 25 Mar. (84) 25 Mar. (84) 25 Mars (84). 25 Mar. (85) 25 Mar, (84). 25 Mar. (84). 25 Mar. (84). 25 Mar. (85). 25 Mar. (84) 25 Mar. (84) 25 Mar. (84) 25 Mar. (86). 25 Mar. (84). 25 Mar. (84) . 25 Mar. (84) . 25 Mar. (85) 25 Nar. (84) 25 Mar. (84). 28 Mar. (80) 25 Mar. (85) H. M. . 36 467 Mar. (67) 7 54 24 Feb. (55) 815 Mar. (74) 12 4 Mar. (68) 25 21 22 Mar. (82) 12 Mar. (71) 891 Mar. (80) 48 20 Mar. (79) 578 Mar. (68) 26 Feb. (57) 16 17 Mar. (76) 6 Mar. (66) 24 Mar. (84) 12 18 Mar. (72) 61 8 Mar. (89) 021 Mar. (80) 51 910 Mar. (70) 8 18 27 Feb (58) 17 15 27 18 Mar. (77) 27 867 Mar. (66) 45 25 Feb. (58) 5415 Mar. (74) 18 8 Mar. (68) O 16 13 28 Mar. (89 8 98 a1 u Mar. (71) San. Wod. 1 Sun. O Sat. Wed. Mon. Sat. . 2 . 4 Wed. . 5 Thur. . Fri. . 2 Mon. 8 Tues. Wed. El Jo . . 4 Wed. 5 Thur. Fri. .Sun. 2 Mon 4850 4860 4a$i 5. Thar. Feb (58) 3 Mon. 1 Sun. 818-2898 198-9687 298-8451 104-8680 818-7887 147781 990-1990 1048508 189-6888 16-2581 319-6100 4642988 140-0101 174-066 60-438 San. 4864 2 Mon. 5 Thur. 8 Tae. 8 Mon. . Pr. .Tour. 2 Hon. 4808 4207 4.206 4860 .
Page #289
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. (VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SARVATSABA. Mean inte calated (adhika) lunar month. Meshidi olar year in Bengal. A.D. Chaitrid Vikram Southern system, Northern system. 1092197 6 Bhadrapada. 1973 . 4899 1988 18.20 1980 1881 1989 844-46 845-46 848-47 847-48 848-40 840-60 350-52 . 1099 1094 1096 1096 1097 1098 1000 1100 3 Jyeshtha 1976 4976 11 Magha 1988 . 4878 1984 1879 1996 8 Karttiks 4380 1101 1108 4.881 4.888 1.888 1987 1688 1108 4 Ashadha Haec 1888 42% 1104 1106 1108 362-58 858-54 864-56 866-50 956-57 087-58 369-5 S60 80 360-61 1361-69 1169-70 23 Virddhin . 27 Vijaya. 1170-71 24 Vikrita 28 Jaya . 1171-72 25 Khars. 29 Manmatha *1172-78 26 Nandana 30 Durmukha 1173-74 27 Vijaya . . . 31 Hemalamba 117476 28 Jaya . 32 Vilamba . 1176-78 99 Manmatha 38 Vikarin . 1176-77 80 Darmukha 34 sarvarin 1177-78 81 Hemalamba .35 Plava 1178-79 82 Vilambe . 36 subhakrit 1179-60 33 Vikarin 37 sobbans *1180-81 84 sarvarin 88 Krodhin 1181-83 86 Plava 39 Visvavad 1188-88 88 subhahrit 40 Paribhava 1188-84 87 sobham . 41 Plavaags 1184-86 88 krodhin 42 Kilaks. 1186.48 8e Witrivna 48 Saumya 1186-8740 Putibhava 44 Badharan 1187- Part 1 45 Virodhakrit 41188 Klaks. 46 Parldhivin 1189-8049 Spamyn . | 47 Pramadin 1190-91 Sidharapa 48 Inanda 1191,486 Viradhakrit .40 Rakuha 11814846 Poldalvin 50 Anals 1198-45 Promicin . 61 Piagala. 1986 1 Chaitra . 1107 1987 11 9 Margulins . 1109 1 1 1310 ini og WB . 6 Whalupada U13 888.64 18+66 18666 6.67 40 . 2 Valiklis 1 11 Millipha
Page #290
--------------------------------------------------------------------------
________________ No. 16.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM.. XCcontd. COMMENCEMENT OP THE MBAN SOLAR TXAR. MRAN LUNI-SOLAR YSAR (MEAN SUNRISE OF THI CIVIL DAY ON WHICH CHAITRA SULLA 1 EDB) K11 Day and month, A.D. Time of Week-day. mean Mish samkranti Day and month, A.D. sy. a (heret, the index of the lith). 13 19 20 28 . 1847782 4871 478 899-4586 176-1815 4273 o Sat. 6 Fri. 8 Thes. O Sat. 6 Pri. 4 Wed. 50-9042 4274 4875 85.5866 4876 399-9415 9993-0018 8 2 Mon. 4277 210-8487 BP.. 4978 4879 4890 26 Mar. (84) . 26 Mar. (84) 28 Mar. (85) 25 Mar. (85). 25 Mar. (84) . 25 Mar. (84) 28 Mar. (85) 25 Mar. (85) . 25 Mar. (84). 25 Mar. (84) . 28 Mar. (86). 25 Mar. (86) . 25 Mar. (84) . 25 Mar. (84). * War. (86) 20 Wor. (86) . 26 Mar. (86) . 25 Mar. (84) . 28 Mar. (85) 25 Mar. (85) . 26 Mar. (84) . 25 Mar. (84). 28 Mar. (85) . 26 Mar. (85) . 25 Mar. (84) H.M.S. . 3 Taes. . 12 80 1 Mar. (80) .4 Wed. 8920 Mar. (79) 6 Fui. 489 Mar. (68) O Sat... 57 28 Feb. (67) . 1 San. . 818 Mar. (75) .2 Mon. 19 8 Mar. (65) 4 Wed. 244 Mar. (88) . 5 Thur. 33 18 Mar. (73) 422 Mar. (61) . Sat. 1 6121 Mar. (80) 2 Mon. 10 Mar. (09) . z Toe. 28 Feb. (69) . 1818 Mar. (77) . 5 Thur. 277 War. (86) 24 Feb. (65) . 14 Mar. (74) . Mon. 4 Mar. (68) . 1 8 88 Mer. (89) 6 Thur. 1812 Mar. (71) . 8. Pri 31 80 Peb. (80) . O Sat. 19 Mar. (78) 1 San. 65 89 9 Mar. (88) . 8 Too. 48 26 Feb. (57) . 4 Wed. 18 Yer. (78) 6 Thar. 17.92 6 6 Mar. (64) O Sat. 14 Wed.. 3 Toes. . O Sat. 6 Thar. 4 Wed. . 1 San. 6 Thar. 4 Wed. 2 Mon. . 1 San. 86-0695 120-7619 9000-47476 210-8296 246.6120 121-2349 9906-0678 81-EUR400 846-9049 4881 4889 4883 4384 &at. 4886 4286 Bun. 4287 Toe 16 Ther. 280-6772 168-4001 89-1280 1989 4800 66-8084 420 .: Mon. . 1 Ban. .6 Full 8 Toes 281.1602 4998 166-8830 1915854 87 2882 o vrt. 4295 Chaitra inkl 1 wu sapproacd.
Page #291
--------------------------------------------------------------------------
________________ 264 EPIGRAPHIA INDICA. (VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Kali. Menn intercalated (adhika) lanar month, Saka. Chaitradi Vikrams. Meshadi solar year in Kollam. A.D. Southern system. Northern system. 4258 1117 1252 4297 1118 1253 1254 369-70 370-71 371-72 1194-96 1195-96 *1196-97 4298 1119 1120 1255 1187-98 4300 4301 1121 1122 1123 1124 1302 1808 1258 1257 1258 1259 1260 1261 1262 4304 1125 4805 1126 4300 1127 4307 1128 1263 4308 4309 4810 373-74 374-75 375-76 376-77 377-78 378-79 379-80 380-81 381-82 382-83 383-84 384-85 385-86 386-87 387-88 388-89 389-90 390-91 891-92 892-93 398-94 1198-99 1199-1200 *1200-01 1201-02 1202-03 1203-04 *1204-05 1205-06 1206-07 1207-08 *1208-09 1209-10 1210-11 1211-12 *1212-13 1213-14 . 1214-15 1216-16 *1216-17 1217-18 1918-19 18 Ananda . . 52 Kalayukta 49 Rakshasa 53 Siddharthin 50 Anals , i 54 Randra . 8 Karttikat. 51 Pingala . . 55 Durmati 52 Kilayakta 56 Dandubhi 58 Siddharthin 57 Radhirodgarin. 4 Ashidha 54 Randra 58 Raktaksha 55 Dormati 59 Krodhana 58 Dundubhi 80 Kshaya. i Chaitra 57 Radhirodgarin 1 Prabhaya 58 Raktaksha 2 Vibhava I 9 Margadins 59 Krodhana 3 Sukla . 80 Kshaya . . 4 Pramoda 1 Prabhava . 5 Prajapati 6 Bhadrapada. 2 Vibhava . 6 Angiras. 8 Sakla. . 7 srimukha 4 Pramoda 8 Bhava 2 Vaisakha 5 Prajapati 9 Yayan. 8 Angiras . . 10 Dhatri .11 Magha 7 Srimukha . 11 Isvara . 8 Bhava . . 12 Bahudhanya. 9 Yavan. . 13 Pramnathin . 7 Levina 10 Dhatzi . .14 Vikrams 11 livars 15 Vrisha . . 12 Bahadhanys 18 Chitrabhanu | 4 Ashadha 4311 1129 1284 1180 1265 1131 1266 11321287 1133 1268 1134 1269 11351270 1136 1271 1137 1272 1188 1273 1189 1274 11401275 11:41 1276 4512 4313 4314 4815 4816 4377 4918 1819 4820 Ee "Remarks," p. 215 al ove.
Page #292
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 265 XC-contd. COMMENCEMENT OF THE MEAN SOLAB YEAE. MBAN LUNI-SOLAB YBAR (MBAN SUNRISE OF THE CIVIL DAY ON WHIQI CHAITRA SUKLA 1 ENDS). KAIL Day and month, A.D. Time of Week-day. mean Mesha samkranti. Day and month, A.D. Week-day. a (heret, the index of the titho). 13 17 19 20 23 101-9708 4296 4297 4298 816-8255 192-0482 226-7307 102-4535 816-8083 4999 Thar. 4800 4801 4809 12-8587 227-2136 6 Thar. 3 Tues. O Sat. 6 Fri. .8 Tues. 1 San. Fri. . 4 Wed. 1 Sun. O Sat 4 Wed. 8 Tues. 1 San. 6 Thar. 4 Wed. 4803 102-9883 4804 4805 25 Mar. (84). 6 Fri. 26 Mar. (85). 1 San. 25 Mar. (85). 2 Mon. 25 Mar. (84) Tues. 26 Mar. (85). 26 Mar. (85) 25 Mar. (86). 25 Mar. (84) . San. 26 Mar. (85) . 3 Tues 28 Mar. (85) 4 Wed. 25 Mar. (85). . Thar. 25 Mar. (84). 1 Sun. 28 Mar. (85) . ! 25 Mar. (85) . 8 Toes 25 Mar. (84) *' .! Wed. 26 Mar. (85) 26 Mar. (85) Sat. 25 Mar. (85) San. 25 Mar. (84). Mon. 28 Mar. (85) Wed. 28 Mar. (85). 6 Thar. 25 Mar. (85) . 6 Fri. 26 Mar. (84). O Sat. 28 Mar. (85) 2 Mon. H. M. S. 23 44 16 24 Mar. (88) 24 14 Mar. (78) 33 2 Mar. (69) 4221 Mar. (80) 5110 Mar. (69) 0 28 Feb. (59) 17 Mar. (77) 18 7 Mar. (66) 27 24 Feb. (56) 88 15 Mar. (74) 8 Mar. (83) 54 22 Mar. (81) 819 Mar. (71) 1 Mar. (60) 19 Mar. (79) 8 Mar. (67) 39 26 Feb. (57) 18 17 Mar. (76) 6 Mar. (65) 21 86 6 24 Mar. (89) 8 47 15 18 Mar. (78) 8 Mar. (62) 33 21 Mar. (81) 10 Mar. (89) 36 61 27 Feb. (68) 8 Fri. 187-6188 13-3416 48-0289 262-3788 . . . 4306 4307 4308 4309 26 Mar. (85) Mon. 188-1017 4910 1 San 4311 4318 4813 Thar. 172-7840 48-5069 262-8617 297-5441 173.2669 207.9493 88-6720 298-0269 2 Mon. 1 Ban. 4815 4916 . 5 Thur. 8 Taos. 2 Mon. 4817 832-7094 208-4322 4318 4319 4320 3 Taos. 84:1561
Page #293
--------------------------------------------------------------------------
________________ 266 EPIGRAPHIA INDICA. [VOL. XVII. TABLE CONCURRENT YEAR. JOVIAX SAMVATSARA. Mon intercalated (adhika) lapar mouth. Kollam. A.D. Chaitrdi Vikrams Southern system. Northern system. 1142 1277 4821 4823 4828 1148 1278 . 12 Phalguns 1144 1279 1280 1145 4884 4896 1146 1881 . 9 Margasins . 4828 . 4887 1148 1149 1982 1288 1284 4888 . 6 Srivas . 4890 1980 1161 1288 1287 4881 1288 4882 4898 1153 1154 828394-96 1219-90 18 Pramathin 17 Subhana 895-98 *1 220-21 14 Vikrams . 18 Tarana . 896-97 1221-92 15 Vrisha. . 19 Pa: thive 897-98 1222-23 16 Chitrabhang. 20 Vyays . 898-99 1223-24 17 Subhana 21 Sarvajit . 899-400 1224-26 18 Tarans. 22 Sarvadharin 400-01 1225-26 19 Parthiva . 23 Virodhin 401-02 1228-27 20 Vyaya. 24 Vikrita . 402-03 21 Earvajit . 25 Khara . 409-04 1228-29 22 Sarvadharin . 28 Nandana 404-05 1229-8023 Virddhin 27 Vijays. 405-08 1230-31 | 24 Vikrita. . 28 Jaya 406-07 1231-82 25 Kbars . . 29 Manmatha 407-08 1232-8328 Nandans. . 30 Durmukha 408-09 1233-3427 Vijays . 31 Hemalamba 409-10 1234-86 28 Jaya . . 32 Vilamba 410-11 1235-86 29 Manmatha 33 Vikarin 80 Darmukha 84 sarvarin. 412-18 1987-88 81 Remalamba . 86 Plava . 418-141 82 Vilamba. 88 sabbakrit 414-16 1289-4088 Vikarin. 87 sobhana 416-16 1940-41 84 sarvarin. 88 Krodhin 416-17 1941-4985 Plana 29 Vivian 417-18 1942-48 86 Sabhakrit 40 Paribhavs 418-19 1948-49 87 sbhana 41 Plavatga . 2 Vaibik ba 1 10 Pausha 4884 4885 1289 1290 1291 1292 1208 1188 1157 4888 7 Asvins 4387 4888 1168 1169 1160 1161 1294 1296 4889 . 4 Aahadha 4840 1296 18917 4841 1162 19 Phalguna 4842 1298 1168 1164 4848 1299 1800 | 1166 9 Marguin 1166 1801
Page #294
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 267 xc-contd. COMMENCEMENT OF THE MBAN BOLAB YBAR. MBAN LUNI-BOLAB YBAR (MEAN. BUSRIES OF THE CIVIL DAY ON WHION CHAITRA BUILA 1 ENDS). Kuli. Day and month, A.D. Week-day. Time of mean Mesha-1 Bankranti. Day and month, A.D. Week-der a (heret, the inder of the tith). 13 14 17 19 120 28 118-8874 4921 2 Mon. O Sat. . 4822 5. Thur. . 389-1928 29-2427 243-6975 4323 Sat. 8 Taeg. . 4324 119-3209 4325 Mon. Fri. 4326 4327 Toes. Sun. 4328 . . O Sat. 4329 4 Wed. 4330 4331 . 28 Mar. (85) 26 Mar. (85) 25 Mar. (84) 26 Mar. (85) 28 Mar. (85) 25 Mar. (85) 28 Mar. (85) 28 Mar. (85). 26 Mar. (85). 25 Mar. (85) 26 Mar. (85) 28 Mar. (85) . 26 Mar. (85). 25 Mar. (85). 26 Mar. (85). 26 Mar. (85). 26 Mar. (85) 25 Mar. (85) 26 Mar. (85). 28 Mar. (85) 28 Mar. (85) . 25 Mar. (85). 26 Mar. (85) 26 Mar. (85) 26 Mar. (85) 164.0027 29-7256 844 0804 978-7628 164-4857 30-2084 64-8908 279-2467 818-9281 189-6609 85-8788 4382 H.M.S. 8 Tues. 10 48 0 18 Mar. (77) 4 Wed. . 17 9 7 Mar. (67) Thur. . 26 Mar. (84) 27 15 Mar. (74) Sun. 4 Mar. (68) 22 Mar. (82) 4 Wed. 11 Mar. (70) 5 Thur. . 81 Mar. (80) 6 Fri. 12 20 Mar. (79) Sat. 37 21 8 Mar. (68) Mon. 80 25 Feb. (58) 8 Tues. 89 18 Mar. (75) 18 486 Mar. (65) 6 Thur. 19 25 57 24 Mar. (84) 0 Sat. 8 18 Mar. (72) 1 Sun. 50 15 2 Mar. (61) Mon. . 2 24 21 Mar. (80) 8 Tues. 38 10 Mar. (70) 6 Thar.. 2 26 42 27 Feb. (58) 8 Pri. . 8 38 61 18 Mar. (77) 0 Sat. 14 0 7 Mar. (66) 1 San. 21 9 25 Mar. (85) 3 Tues. 8 16 18 14 Mar. (78) 4 Wed. . 9 27 27 Mar. (68) Thar. . 15 39 36 28 Mar. (88) . 1 San. O Sat. 5-Thur. . 4 Wed. Wed. 4833 4934 1 San. 4835 . 4336 100-0662 5 Thur. Wed. 2 Mon. 6 Fri. 4887 4388 814-4110 190-1838 4939 mm 16P 6 Thor. 224-8162 4840 . 2 Mon. 100-5891 4841 4842 1 Sun. 135.2214 6- Thur. 3 Tuos. Mon. . . 10-9448 225-2991 259-9816 1344 . 4346 2 0 2
Page #295
--------------------------------------------------------------------------
________________ 268 Kali. 1 Saka. 2 Chaitradi Vikrams. Meshadi solar year in Bengal. 8 8a CONCURRENT YEAR. Kollam. EPIGRAPHIA INDICA. 4 A.D. 5 JOVIAN SAMVATSARA. Southern system. 6 419-20 4850 4851 #1244-45 88 Krodhin 1245-46 39 Visvavasu 1246-47 40 Parabhava 1247-48 41 Plavanga #1248-49 42 Kiaka 1249-5043 Saumya. 1250-51 44 Sadharana 1251-52 45 Virodhakrit #1252-53 46 Paridhavin 1253-54 47 Pramadin 1254-55 48 Ananda 1255-56 49 Rakshasa 1256-57 50 Anala 1257-58 51 Pingala. 1258-59 52 Kalayukta 1259-60 58 Siddharthin #1260-61 54 Randra 1261-62 55 Durmati 1262-68 56 Dundubbi 1177 1312 4346 1167 1302 651 4847 1168 1308 652 420-21 4348 1169 1304 653 421-22 4349 1170 1305 654 422-23 1171 1306 655 423-24 1172 1307 656 424-25 4852 1178 1308 657 425-26 4858 1174 1309 658 426-27 4354 1175 1310 659 427-28 4355 1176 1311 660 428-29 4856 661 429-30 1178 1813 662 430-81 4358 1179 1314 663 481-82 4359 1180 1315 664 432-83 4860 1181 1816 665 483-84 4861 1182 1817 666 434-35 4889 1183 1318 667 435-36 4883 1184 1319 668 436-37 4864 1185 1320 669 487-88 4885 1186 1321 670 488-39 1263-64 57 Rudhirodgarin 4966 1187 1822 671 439-40 1264-65 58 Raktaksha 4867 1188 1323 1285-66 59 Krodhana 4368 1189 1824 1266-67 60, Kahaya 4869 1190 1825 674 442-43 1267-68 1 Prabhava 1191 1326 675 443-44 1268-69 2 Vibhava 4357 672 440-41 673 441-42 4370 * * Northern system. 7 42 Kilakat. 44 Sadharana 45 Virodhakrit 46 Paridhavin 47 Pramadin 48 Ananda 49 Rakshasa 50 Anala [VOL. XVII. 2 Vibhava 3 Sukla 4 Pramoda 5 Prajapati 6 Angiras. 7 Srimukha TABLE Mean intercalated (adhika) lunar month. 8a *** 5 Sravana ... 2 Vaisakha 10 Pausha *** 51 Pingala 52 Kalayakta 53 Siddharthin 54 Raudra * 55 Durmati 56 Dundubbi 57 Rudhirodgarin 12 Phalguns 58 Raktaksha 59 Krodhana 60 Kahaya. 1 Prabhava 7 Asvina *** ? 8 Jyeshtha *** 8 Karttika *** 5 Sravana 1 Chaitra +48 Saumva was suppressed in the north by the mean system. By the "true" system K.Y. 4346 (expired), A.D. 1245-46, was called "Faumya," 44 Nadharara being suppressed. The next year was 45 Virodhakrit by both systems of reckoning.
Page #296
--------------------------------------------------------------------------
________________ No. 15.] XC-contd. Day and month, A.D. 13 25 Mar. (85) 26 Mar. (85). 26 Mar. (85) 26 Mar. (85) 25 Mar. (85) 26 Mar. (85) 26 Mar. (85) 26 Mar. (85) 25 Mar. (85) 26 Mar. (85) 26 Mar. (85) 26 Mar. (85) 26 Mar. (86) 26 Mar. (85) 26 Mar. (85) 26 Mar. (85) 26 Mar. (85) MEAN SOLAR YEAR. 26 Mar. (85) 26 Mar. (80) + . * * . * . 26 Mar. (85) 26 Mar. (86) 26 Mar. (85). 26 Mar. (85) 26 Mar. (85) 26 Mar. (86) . " . THE BRAHMA-SIDDHANTA: MEAN SYSTEM. . Time of Week-day. mean Meshasamkranti. 14 6 Fri. 1 Sun. 2 Mon. COMMENCEMENT OF THE 3 Tues. 4 Wed. 6 Fri. 0 Sat. 1 Sun. 2 Mon. 4 Wed. 5 Thur. 6 Fri. 1 Sun. 2 Mon. 3 Tues. 4 Wed. 6 Fri. O Sat. 1 Sun. 2 Mon. 4 Wed. 5 Thur. 6 Fri. O Sat. 2 Mon. * . . * . * . * * 17 H. M. S. 21 51 45 3 54 10 16 3 * tth tth smy 16 28 12 22 40 21 4 52 30 11 4 39 17 16 48 23 28 57 6 5 41 11 53 18 5 24 0 17 33 6 29 42 12 41 51 18 54 0 6 9 7 18 18 O 17 15 13 30 27 19 42 36 1 54 45 8 6 54 + 14 19 10 to co 20 31 12 2 43 21 MBAN LUNI-SOLAR TEAR (MEAN SUNRISE OF THE CIVIL DAY ON WHICH CHAITRA SUELA 1 ENDS). Day and month, A.D. 19 11 Mar. (71) 28 Feb. (59) 19 Mar. (78) 9 Mar. (68) 26 Feb. (57) 16 Mar. (75) 5 Mar. (64) 24 Mar. (83) 13 Mar. (73) 2 Mar. (61) 21 Mar. (80) 10 Mar. (69) 28 Feb. (59) 18 Mar. (77) 7 Mar. (66) 26 Mar. (85) 14 Mar. (74) 4 Mar. (63) 22 Mar. (81) 12 Mar. (71) 29 Feb. (60) 19 Mar. (78) 8 Mar. (67) 26 Feb. (57) 16 Mar. (76) + Week-day. 20 6 Fri. 3 Tues. 2 Mon. 0 Sat. 4 Wed. 3 Tues. 0 Sat. 6 Fri. 4 Wed. 1 Sun. O Sat. 4 Wed. 2 Mon. 1 Sun. 5 Thur. 4 Wed. 1 Sun. 6 Fri. 4 Wed. 2 Mon. 6 Fri. 5 Thur. 2 Mon. 0 Sat. 6 Fri. a (here=t, the index of the tithi). 23 135-7043 11-4272 46-1096 260-4644 136-1872 170-8696 46.5925 81.2748 295-3297 171.3526 206-0349 81-7577 296-1126 330-7950 206-5178 241-2002 116-9231 331-2778 27-3283 241-6831 117-4060 152-0883 27-8112 242.1660 276-8483 269 Kali. 1 4346 4347 4348 4349 4350 4351 4352 4853 4354 4355 4356 4357 4358 4359 4360 4361 4362 4363 4364 4365 4366 4367 4868 4369 4370
Page #297
--------------------------------------------------------------------------
________________ 270 EPIGRAPHIA INDICA. [VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSABA. Mean intercalated (adhika) lunar mouth. Kali. Saka. Mesbadi solar year in Kollam. Chaitradi Vikrama. A.D. Bengal. Southern system. Northern system. 4371 4372 4973 444-45 445-48 446-47 447-48 448-49 449-50 4374 4375 4376 4377 450-51 4378 4879 4380 4381 4382 4383 1199 1327 1193 1328 1194 1329 1195 1330 1196 1331 1197 1332 1198 1333 1199 1334! 1200 1835 1201 1336 1202 1337 1203 1338 1204 1339 1205 1340 1206 1341 1207 1342 1208 1343 1209 1344 1210 1345 1211 1346 1212 | 1347 1269-70 3 sakla . . 8 Bhava. 10 Pasha 1270-71 4 Pramoda 9 Yavan . . 1271-72 5 Prajapati 10 Dhatri . . 6 Angirus. 11 Iivars 7 Agvina 1273-74 7 Srima kbs 12 Bahadhanya. 1274-75 8 Biva. . 13 Pramithin 1275-76 9 Yavan . . 14 Vikrama . 3 Jyeshtha 10 Dhatri. 15 Vrisha 1277-78 11 Ivars . 16 Chitrabbana | 12 Phalgum . 1278-79 12 Bahadhanya . 17 Subhana 1279-80 13 Prsmithin 18 Tarans. 1280-81 14 Vikrama 19 Parthiva . 8 Karttiks 1281-82 15 Vrishs . . 20 Vyays. . 1282-83 16 Chitrabhaua. 21 Sarvajit. 1283-84 17 Subhana 29 Sarvadharin . 5 Sravana 1284-85 18 Tarana . . 28 Virodhin 1285-86 19 Parthiva . 24 Vikrita. . 1288-8720 Vyaya. 25 Khara . . 1 Chaitra 1287-88 21 Sarvajit. 26 Nandans . 1288-89 22 Sarvadbarin 27 Vijaya. 10 Pausbs 1289-90 23 Virodhin 28 Jays . . 1290-9124 Vikrita . . 29 Manmaths . 1291-92 25 Khara . 80 Duratkha 6 Bludrapuda. 1292-93 26 Nandana | 31 Hemalamba 1288-9427 Vijaya. . 82 Vilamba 4384 4385 451-52 452-53 458-54 454-56 455-56 456-57 457-58 458-59 459-80 460-61 461-62 462-63 463-64 464-65 465-66 466-67 467-88 188-88 4386 4387 4388 4389 4390 4391 4392 4398 12131348 12141349 1215 1350 1216 1851 4394 4866
Page #298
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 271 XC-contd. COMMENCEMENT OF THE MBAN SOLAB YBAR. MEAN LUXI-BOLAB YEAR (MBAN SUNRISE OF THE CIVIL DAY ON WHICH CHAITRA BUELA 1 ENDS). Kali. Day and month, A.D. Time of Week-day, mean Mesbs Bankranti. Day and month, A.D. 1 Week.day. a (heret, the index of the tithi). 13 14 17 19 201 B3 M.S. 8 Tues 55 80 89 152-6712 187-2586 4871 4972 . 16 2 Mon. Fri. 62.9765 4878 Sat. 277-8818 4874 6 Mat. (64) 24 Mar. (89) 18 Mat. (79) 2 Mar (62) 11 Maz. (80) 10 Mar. (69) 27 Feb. (58) 17 Mat. (77) 4 Wed. Tues 312-0137 4875 187-7865 4976 Sat Wert. 68.4598 4977 4878 Tues. 6 Eri. Sun. 98-1417 812-4966 8.5470 4879 . 3 Tava. Wed. Thar. . 1 San. 2 Mon. . 3 Toes. . 5 Thor. . . . 1 Sun. . 8 Tues. 4 Wed. . 6 Thor. . . 1 Sun. 2 Mon. 3 T20. 5 Thur. o Sat. 6 Fri. 4880 4881 26 Mar: (86) . 28 Mar. (85). 28 Mar. (86). 28 Mar. (86). 26 Mar. (85) 26 Mar. (85) 26 Mar. (85) 26 Mar. (86). 26 Mar. (86) . 28 Mar. (85) . 28 Mar: (85) . 26 Mar. (86). 26 Mar. (85) 28 Mar. (86) . 28 Mar. (85). 28 Mar. (86) . 28 Mar. (85) 28 Mar. (86) 27 Mar. (86) 28 Mar. (86) 28 Mar. (86) 28 Mar. (86) 27 Mar. (86) . 28 Mar. (86) 28 Mar. (86). 4888 Wed. 1 Sun. O Sat. 4 Wed. 282-9018 986246 188-8071 9-0299 228-3847 4888 4884 4886 6 Fri. 28 2 Mon. 26 Mat. (84) 0 16 Mar. (74) 6 3 Max. (68) 11 18 22 Mar. (81) 17 27 11 Mar. (70) 1 Mar. (60) 4619 Mar. (79) 12 54 8 Mat. (87) 18 826 Feb. (56) O 84 12 16 Mar. (76) 8 48 21 6 Mar. (66) 24 Max. (88) : 1 Sup. 258-0671 4888 . 188-7900 4887 9-5197 4988 FIL 6 Thur. 2 Mon. 1 Ban. 6 Pri. 6 Thar. Mon. 6 FA. 44:1868 258-5500 293-2824 4880 4990 4801 Sat. 1 kg 80 1 Sun. . 4892 . 48 Tue Wed. 6 Thn.. 4899 168-9562 44-8781 79-8605 Mat. (61) 20 Mar. (80) 10 Mar. (89) 6 Tbar. 4804 4896 6 8 Tue 298-7162
Page #299
--------------------------------------------------------------------------
________________ 272 Kali. Saka. 1 2 Chaitradi Vikrama. 3 4396 1217 1352 4397 4398 4899 1220 1355 1218 1353 1219 1354 4400 1221 1356 4401 1222 1357 4402 1223 1358 4403 1224 1359 4404 1225 1360 4405 1226 1361 4406 1227 1362 4407 1228 1363 4408 1229 1364 4409 1230 1365 Meshadi solar year in Bengal. 3a 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 701 702 703 705 707 709 28 Jaya 469-70 1294-95 470-71 1295-96 29 Manmatha 471-72 #1296-97 30 Durmukha 704 472-73 1297-98 31 Hemalamba 473-74 1298-99 32 Vilamba 706 474-75 1299-1300 33 Vikarin. #1300-01 34 Sarvarin 710 712 713 714 CONCURRENT YEAR. Kollam. 4 715 EPIGRAPHIA INDICA. 4410 1231 1366 4411 1232 1367 716 484-85 4412 1233 1868 717 485-86 4413 1234 1369 718 486-87 4414 1235 1370 719 487-88 4415 1236 1371 720 488-89 4416 1237 1372 721 489-90 4417 1238 1873 722 490-91 4418 1239 1874 723 491-92 4419 1240 1875 724 492-93 1876 725 493-94 4480 1241 T A.D. 475-76 708 476-77 477-78 478-79 711 479-80 *1304-05 38 Krodhin 480-81 1305-06 39 Visvavasu 481-82 1306-07 40 Parabhava 482-83 1307-08 41 Plavanga 483-84 *1808-09 42 Kilaka. 1309-10 43 Saumya. 1310-11 44 Sadharana 1311-12 45 Virodhakrit #1312-13 46 Paridhavin 1813-14 47 Pramadin 1814-15 48 Ananda. 1815-16 49 Rakshasa 1816-17 50 Anala 1317-18 61 Pingala. 1818-19 52 Kalayukta See "Remarks," p. 215, preceding this Table. 5 JOVIAN SAMVATSARA. Southern system. 6 1301-02 35 Plava 1302-03 36 Subhakrit 1303-04 37 Sobhana . Northern system. 7 38 Vikarin 34 Sarvarin [VOL. XVII. . TABLE Mean intercalated (adhika) lunar month. 84 3 Jyeshtha 35 Plava 36 Sabbakrit 37 Sobbana 38 Krodhin 39 Visvavasu 40 Parabhava 41 Plavanga 42 Kilaka. 43 Saumya. 44 Sadharana 45 Virodhakrit 48 Paridhavin 47 Pramadin 48 Ananda. 49 Rakshasa 50 Anala 51 Pingala. 52 Kalayukta 59 Siddharthin 54 Raudra. 55 Durmati 58 Dandabhi 57 Rudhirodgarin. 8 Karttika *** 11, Magha 8 Karttika Ashadha ... 1 Chaitra 10 Pausha *** 6 Bhadrapada. 8 Jyeshtha 11 Magha ...
Page #300
--------------------------------------------------------------------------
________________ No. 15.] XC-contd. Day and month, A.D. 13 MEAN SOLAR YEAR. 26 Mar. (85) 27 Mar. (86) 26 Mar. (86) 26 Mar. (85) 26 Mar. (85) 27 Mar. (86) 26 Mar. (86). 26 Mar. (85) . 26 Mar. (85) 27 Mar. (86) 26 Mar. (86) 26 Mar. (85) . 26 Mar. (85) 27 Mar. (86) 26 Mar. (86) . 26 Mar. (85) 26 Mar. (85) . 27 Mar. (86) 26 Mar. (86). 26 Mar. (85) 27 Mar. (86). 27 Mar. (86). 26 Mar. (86) 26 Mar. (85) 27 Mar. (86). + . . . THE BRAHMA-SIDDHANTA: MEAN SYSTEM. . Week-day. 14 6 Fri. 1 Sun. 2 Mon. 3 Tues. 4 Wed. 6 Fri. 0 Sat. 1 Sun. 2 Mon. 4 Wed. 5 Thur. 6 Fri. COMMENCEMENT OF THE O Sat. 2 Mon. 3 Tues. 4 Wed. 5 Thur. 0 Sat. 1 Sun. 2 Mon. 4 Wod. 5 Thur. 6 Fri. 0 Sat. 2 Mon. * . * . . Time of mean Meshasamkranti. 9 MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF THE CIVIL DAY ON WHICH CHAITEA AUKLA 1 ENDS). 17 H. M. S. 19 59 15 2 11 24 8 23 33 14 35 42 20 47 51 3 0 0 9 12 15 24 18 21 36 27 3 48 36 19 Mar. (78) 10 0 45 8 Mar. (68) 16 12 54 25 Feb. (56) 22 25 3 4 37 12 10 49 21 Day and month, A.D. 17 1 30 23 13 39 5 25 48 11 37 57 17 50 6 0 6 14 24 12 26 33 18 38 42 0 50 51 19 27 Feb. (58) 18 Mar. (77) 6 Mar. (66) 25 Mar. (84) 15 Mar. (74) 4 Mar. (63) 22 Mar. (82) 11 Mar. (70) 1 Mar. (60) 16 Mar. (75) 5 Mar. (64) 23 Mar. (83) 13 Mar. (72) 2 Mar. (61) 21 Mar. (80) 9 Mar. (69) 27 Feb. (58) 2 15 18 Mar. (77) 7 Mar. (66) 25 Mar. (85) 14 Mar. (73) 4 Mar. (63) * . . . * Week-day. 20 O Sat. 6 Fri. 3 Tues. 2 Mon. O Sat. 4 Wed.. 3 Tues. 0 Sat. 5 Thur. 3 Tues. 1 Sun. 5 Thur. 4 Wed. 1 San. O Sat. 5 Thur. 2 Mon. 1 Sun. 5 Thur. 3 Tues. 2 Mon. 6 Fri. 5 Thar. 2 Mon. O Sat. . 169-4381 204-1205 79.8433 114.5257 328-8806 204-6034 239-2859 115-0087 329-3635 25.4139 239-7688 115.4915 150-1739 25-8968 60-5791 274-9340 150-6569 185-3393 61-0621 275-4169 310-0993 " 185-8221 220-5045 96-2274 310 5822 * . a (heret, the index of the tithi). . 23 273 Kali. 4396 4397 4398 4399 4400 4401 4402 4403 4404 4405 4106 4407 4408 4409 4410 4411 4412 4413. 4414 4415 4416 4417 4418 4419 4430 P 2
Page #301
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [VOL. XVII TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Mean intercalated (adhika) IUDAE month. Kali. aka. Meshidi solar year in Bengal. Kollam. Chaitradi Vikrama A.D. Southern system. Northern system. 4421 728 1842 1948 1428 1877 1878 1879 4493 194 4494 1880 4485 4498 4427 732 494-95 496-96 496-97 497-98 498-99 499-500 600-01 501-02 502-08 508-04 504-05 505-08 508-07 507-08 4488 4429 4430 4481 4483 4483 1945 1248 1881 1947 1382 1248 1888 1249 1884 1250 1885 1251 1888 1262 1887 1868 1889 1954 1889 1265 1890 1256 1391 1257 1892 1258 1898 1259 1894 1280 1896 1261 1898 1282 1897 1988 1898 1964 1899 1966 1400 1819-9058 Siddharthin 58 Raktakshs. *1980-81 54 Raadra 69 Krodhana 1821-22 55 Durmati 80 Kshays. . 4 Ashidha . 1882-23 | 58 Dundabhi . 1 Prabhsys . 1898-84 57 Badhirddgarin. 2 Vibhaya 1824-2558 Raktaksha . 8 Sukla . . i Chaitra. . 1885-86 59 Krodhana 4 Pramoda 1826-27 60 Kshaya. . 5 Prajapati 9 Margasira 1327-98 1 Prabhara 6 Angiras . . 2 Vibhava 7 Srimukhs 1 1329-80 8 Sakla . 8 Bhavat. 6 Bhadrapada. 4 Pramoda 10 Dkaisi. 1881-82 6 Prajapati 11 Israra .. 1882-89 6 Angiras . .12 Bahudhanya . Vaisakha 1938-34 7 Srimukha 13 Pramathis . 1884-95 8 Bhava. . 14 Vikrama 11 Mighs 1335-36 9 Yovan . 15 Vriska. I *1386-87 10 Dhatri. . 16 Chitrabhana. 1887-88 11 Isvara . . 17 Sabbana 7 Afvina 1888-89 12 Bahadhinya 18 Turans . . 1889-40 19 Pramath in 19 Parthiva. *1940-41 14 Vikrama 20 Vyaya , 4 Asbidha 1841-48 15 Vrishs 21 Sarvajit . . 1842-18 18 Chitrabbana .22 Sarvadlarin . 12 Phalgamas I 1848-41 17 Sabhang 93 Virodhin 4484 4485 4486 4437 4488 4440 508-09 509-10 510-11 511-12 512-13 813-14 514-15 515-16 516-17 517-18 518-19 ** 1986 + Ynvan was approved in the north by the mean system. By the "true" system K.Y. 4131 (expired), A.D. 1890-81, ww called " Yavan," and 10 Dhati ww suppressed. The next year was 11 Isvara by both systems.
Page #302
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA : MEAN SYSTEM. 275 295 Xc-contd. COMMENCEMENT OF THE MEAN BOLAR YEAR. MBAN LUNI-SOLAR YEAR (MBAN SUNRISE OP THE CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Kali. Day and mouth, A.D. Time of Week-day. mean Mesha Barnkranti. Day and month, A.D. Week-day. a (heet, the index of the tith:). 18 14 17 19 20 23 . . 6-6326 4421 27 Mar. (86) 26 Mar. (86) 3 Toes. 4 Wed. | 5 Thur. 220-9874 4422 . 5 Thar. Taev, O Sat. 6 Fri. Tues. 96-7103 4423 O Sat. 1 181.8926 H.M.S. 7 3 0 22 Mar. (81) 13 9 11 Mar. (71) 19 18 28 Feb. (59) 39 27 19 Mar. (78) 8 Mar. (67) 8 45 26 Feb. (57) 20 54 16 Mar. (75) 2 28 8 5 Mar. (64) 8 40 12 24 Mar. (83) 4424 1 Sun. 7:1155 4426 2 Mon. 14 1 San. 221-4703 4426 3 Tues. . 256-1527 4427 on 5 Thur. . 0 Sat. 4 Wed. 3 Taes. 4428 1318755 166-5579 8 Fri. 4429 14 52 O Sat. 422808 4430 . 256-6356 4481 5 Thur. 4 Wed. 291.8180 4432 27 Mar. (86) (86). (85). 27 Mar. (86) 27 Mar (86) 28 Mar. (86). (85). Mar. (86) . 27 Mar. (86) Sat. 1 San 3 Taes. 4 Wed. . 5 Thur. 6 Fri. . 1 San. Son. 1070409 4438 5 Thar. 42.7637 . 15 . 21 Wed. 4434 4435 77-4460 2 Mon. . 291.8009 4436 2 Mon. 1 Eun. 326-4833 4437 16 202 2062 4438 . . 77-9289 Thar. 2 Mon. 1 Sun. 6 Fri. 112-6114 57 27 Feb. (58) 17 Mar. (76) 7 Mar. (66) 24 25 Mar. (85) 88 14 Mar. (74) 42 8 Mar. (62) 51 22 Mar. (81) 012 Mar. (71) 29 Feb. (60) 30 18 19 Mar. (78) 42 27 8 Mar. (67) 84 36 27 Mar. (86) 4489 4440 4441 26 Mar. (85) * 27 Mar. (86). 27 Mar. (86). 28 Mar. (88) 28 Mar. (85). 27 Mar. (86) 27 Mar. (86) 326-9662 3. Taes. .4 Wed. 6 Fri. Jo Sat. San. . Mon. 4 Wed. . 5 Thur. . 11 17 .28 Tues 202-6890 Mon. 4443 . 6 Fri. 237-3714 113.0943 147-7767 4444 11 5 Thor. 4445 2 P 2
Page #303
--------------------------------------------------------------------------
________________ 276 EPIGRAPHIA INDICA. [VOL. XVI. TABLE CONCURRENT YEAR. JOVIAN SAMVATSABA. Kali. Mean intercalated (adhika) lunar inonth. Saka. Chaitradi Vikrama. Meshadi solar year in Kollam. A.D. Southern Bystem. Northern system. 4 4446 1267 1402 4447 1403 . 9 Margasira . 4448 1268 1269 1270 1404 4449 1405 1 . . 6 Bhadrapada. 4450 1271 1272 4451 4452 1273 1406 1407 1408 1409 1410 4453 520-21 521-22 522-23 523-24 524-25 525-26 526-27 527-28 528-29 529-30 530-31 531-32 532-33 . 2 Vaisakha . 4454 1275 4455 1411 11 Migha 4456 . 4457 4458 *1944-45 18 Tarana 1346-46 19 Parthiva . 1346-47 20 Vyaya . 1347-48 21 Sarvajit . *1348-49 22 Sarvadharin 1349-50 23 Virodhin 1850-51 24 Vikrita . 1351-52 25 Khara , *1352-53 26 Nandana. 1353-54 27 Vijaya. 1354-55 28 Jaya 1355-56 29 Manmatha *1356-57 30 Durmukha 1357-58 31 Hemalamba 1358-59 32 Vilamba. 1859-60 33 Vikarin. *1360-61 34 sarvarin 1361-6235 Plava . 1362-63 36 sabbakrit 1363-64 37 sobhana *1364-65 38 Krodhin. 1365-66 39 Visvivasa 1366-67 40 Parabhava 1367-68 41 Plavanga 1368-6942 Kilaka. 24 Viksita . . 25 Khara . 26 Nandana . . 27 Vijaya . . 28 Jaya . 29 Manmatha . 30 Durmukha 31 Hemalambs . 32 Vilamba . . 33 Vikarin. 34 Sarvarin 35 Plava 36 Sabhakrit 37 sobhana . 38 Krodhin . 39 Visvavast 40 Parabhava 41 Playanga 42 Kilaks . 43 Saumya. 44 Sadharana 45 Virodbaksit 46 Paridhavin | 47 Pramidin '. 48 Ananda. 7 Agvina . . 4459 4460 533-34 534-35 535-36 4 Ashaha 1276 1277 1412 1278 1413 12791414 1280 1415 1281 1416 1282 1417 1283 | 1418 1284 1419 1285 1420 1286 1421 12871422 1288 1423 1289 1424 1290 1425 1201 1420 4461 4462 . 4463 536-37 12 Pbalgana 4164 537-38 4465 4466 9 Margasira 4467 538-39 539-40 540-41 541-42 542-43 543-44 4168 4469 . 6 Srivas 4470 .
Page #304
--------------------------------------------------------------------------
________________ No. 15.] XC-contd. Day and month, A.D. 13 MEAN SOLAR YEAR. 26 Mar. (86). 27 Mar. (86) 27 Mar. (86) 27 Mar. (86) 26 Mar. (86) . 27 Mar. (86). 27 Mar. (86) 27 Mar. (86) 26 Mar. (86) 27 Mar. (86) 27 Mar. (86) 27 Mar. (86) 26 Mar. (86) . .... . . . 27 Mar. (86). 27 Mar. (86) 27 Mar. (86) 26 Mar. (86) 27 Mar. (86). 27 Mar. (86) 27 Mar (86) 26 Mar. (86) 27 Mar. (86) 27 Mar. (86) 27 Mur. (86) 28 Mar. (86). * . . * THE BRAHMA-SIDDHANTA: MEAN SYSTEM. . Time of Week-day. mean Methasamkranti. 14 COMMENCEMENT OF THE 6 Fri. 1 Sun. 2 Mon. 3 Tues. 4 Wed. 6 Fri. 0 Sat. 1 Sun. 2 Mon. 4 Wed. 5 Thur. 6 Fri. O Sat. 2 Mon. 3 Tues. 4 Wed. 5 Thur. 0 Sut. 1 Sun. 2 Moa. 3 Tues. 5 Thur. 6 Fri. 0 Eat. 1 Sun. . * . 8 8 15 14 20 24 kh waa bllo 17 H. M. S. 18 6 45 15 Mar. (75) 0 18 54 5 Mar. (64) 6 31 8 24 Mar. (83) 12 43 12 13 Mar. (72) 18 55 21 1 Mar. (61) 1 20 Mar. (79) 7 30 7 19 39 13 31 48 19 43 57 10 Mar. (69) 27 Feb. (58) 17 Mar. (77) 1 56 6 6 Mar. (65) 25 Mar. (84) 15 Mar. (74) 3 Mar. (63) 2 44 42 22 Mar. (81) 11 Mar. (70) 1 Mar. (60) 9 18 Mar. (78) 8 Mar. (67) 27 Mar. (86) 16 Mar. (75) 9 45 4 Mar. (64) 54 23 Mar. (82) 3 13 Mar. (72) 2 Mar. (61) 20 Mar. (80) 20 32 33 15 8 56 51 caa a p tth sii 21 21 0 3 33 18 MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF THE CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). 9 45 27 15 57 36 22 Day and month, A.D. 4 21 10 04 16 48 12 22 18 91 19 . Week-day. 20 2 Mon. O Sat. 6 Fri. 3 Tues. O Sat. 6 Fri. 4 Wed. 1 Sun. 0 Sat. 4 Wed. 3 Tues. 1 Sun. 5 Thur. 4 Wed. 1 Sun. 6 Fri. 4 Wed. 2 Mon. 1 Sun. 5 Thur. 2 Mon. 1 Sun. 6 Fri. 3 Tues. 2 Mon. a (here=t, the index of the tithi). 23 23.4995 237-8543 272:5367 148.2595 23.9824 58-6648 273-0197 148.7424 183.4248 59-1477 93.8300 308.1849 188-9077 218-5902 94-3129 808-6678 4.7182 219-0730 253-7554 129.4783 5.2011 39-8835 254-2383 129-9812 164-6435 277 Kali. 1 4446 4447 4448 4449 4450 4451 4452 4458 4454 4455 4456 4457 4458 4459 4460 4461 4462 4463 4464 4465 4466 4467 4468 4469 4470
Page #305
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. (VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAAVATSARA. Mean intercalated (adhika) lunar month. Kali. Mesbadi solar year in Rollem. AD. co Chaitridi Vikrams. Bengal. Sonthern system. Northern system. 5 1. 4471 1427 776 1428 4472 4478 1892 1998 1194 1895 1896 1997 1898 1999 1800 1801 4475 544-45 545-46 546-47 547-48 548-49 549-50 550-51 551-52 1429 1480 1491 1492 1488 1484 1435 476 477 478 4479 562-58 4480 1436 558-54 . 4481 554-56. 1802 1808 4482 : 1487 1488 1489 1440 4483 1804 1869-70 48 Saumya . 49 Rakshasa 1870-71 44 Sadharana 50 Anala . 2 Vaisakha 1971-72 45 Virodhakrit 51 Pingala . *1872-78 48 Paridhavin 52 Kalayakta 110 Pausba 1373-74 47 Pramadin 53 Siddharthin 1874-76 48 Ananda . 54 Raadrs 1875-76 49 Rakshass 55 Durmati 7 Asvina *1976-77 60 Anala . 1 56 Dandabhi 1377-78 61 Pingala . 57 Rudhirodgarin 1878-7962 Kalayukta 58 Raktaksha . 3 Jyeshtha 1979-80 68 Siddharthin 69 Krodhana . *1880-81 54 Randra . 80 Kshaya. . 12 Phalguns 1881-82 55 Darmati 1882-88 68 Dandabhi ? Vibhava . 1888-84 67 Radhirodgarin. 3 Sukia . 9 Margafira *1884-86 58 Raktaksha 4 Pramoda 1885-86 69 Krodhana | 6 Prajapati 1886-87 80 Kshaya . . 6 Angiras 1887-88 1 Prabhava 7 Srimukha *1888-89 2 Vibhavs .. 8 Bhava . 1889-90 8 sakla . . 9 Yuvan . 2 Vaisakha 1890-91 4 Pramoda ...10 Dbatri. . 1991-92 5 Prajapati 11 Isvara 10 Panaha *1892-98 6 Angiras . . 12 Babadhanya 1399-94 7 Brinakha .. 13 Pramathin 4484 1805 1806 1441 556-57 567-58 558-59 559-60 660-61 4485 4486 4487 . 1807 1442 1808 1448 4488 180: 561-62 5 sravana 1445 4489 4490 1446 1810 1811 1812 1818 4491 1447 . 4498 1448 562-68 588-84 564-66 566-66 666-67 567-68 668-69 4498 1814 4494 1816 1405 1818
Page #306
--------------------------------------------------------------------------
________________ No. 15.] XC-contd. Day and month, A.D. 13 MEAN SOLAR YEAR. 27 Mar. (86) 27 Mar. (86) 27 Mar. (88) 26 Mar. (86) 27 Mar. (86) 27 Mar. (86) 27 Mar. (86) 27 Mar. (87) 27 Mar. (86) 27 Mar. (86). 27 Mar. (86) 27 Mar. (86) 27 Mar. (88) . 27 Mar. (86) 27 Mar. (87) 27 Mar. (86). 27 Mar. (86). 27 Mar. (86). 27 Mar. (87) * 27 Mar. (86) 27 Mar. (86) . 27 Mar. (86) 27 Mar. (87) . . . . 27 Mar. (87) 27 Mar. (86). . THE BRAHMA-SIDDHANTA: MEAN SYSTEM. * Time of Week-day. mean Meshasamkranti. 14 8 Tues. 4 Wed. 5 Thur. 6 Fri. 1 Sun. 2 Mon. 3 Tues. 5 Thur. 6 Fri. O Sat. 1 Sun. 3 Tues. 4 Wed. 5 Thar. 6 Fri. 1 Sun. 2 Mon. COMMENCEMENT OF THE 8 Tues. 4 Wed. 6 Fri. O Sat. 1 Sun. 2 Mon. 4 Wed. 5 Thur. . . . . 17 H. M. S. 5 10 30 11 22 39 17 34 48 23 46 57 5 59 6 12 11 15 18 23 24 0 35 33 6 47 42 12 59 51 19 12 13 48 27 0 36 9 Mar. (68) 27 Feb. (58) 18 Mar. (77) 6 Mar. (66) 25 Mar. (84) 14 Mar. (73) 4 Mar. (68) 22 Mar. (83) 11 Mar. (70) 28 Feb. (59) 0 19 Mar. (78) 1 24 9 8 Mar. (68) 7 36 18 28 Mar. (85) 16 Mar. (75) 5 Mar. (64) 23 Mar. (83) 12 Mar. (71) 2 Mar. (61) 1.800 20 MEAN LUNI-SOLAR YEAR (MEAN SUNRISE OF THE CIVIL DAY ON WHICH CHAITRA SUKLA 1 ENDS). Day and month, A.D. 10 19 2 12 45 8 24 54 14 37 3 20 49 12 21 Mar. (80) 3 1 21 9 Mar. (69) 9 13 30 26 Feb. (57) 15 25 89 17 Mar. (76) 21 37 48 7 Mar. (66) 8 49 57 2 6 25 Mar. (85) 14 Mar. (73) * Week-day. 20 6 Fri. 4 Wed. 3 Tues. O Sat. 6 Fri. 8 Tues. 1 Sun. 0 Sat. 4 Wed. 1 Sun. O Sat. 5 Thur. 8 Tues. 1 Sun. 5 Thur. 4 Wed. 1 Sun. 6 Fri. 5 Thur. 2 Mon. 6 Fri. 5 Thur. 8 Tues. 2 Mon. 6 Fri. a (here-t, the index of the tithi). 23 40-3664 254-7212 289-4036 165-1264 199-8088 75-5317 289'8864 824-5689 200-2917 76-0148 110-6969 825-0518 21-1022 235:4571 111.1798 145-8623 21.5851 285-9399 270-8223 146.8452 22 0680 56-7503 271-1052 305-7876 181.5104 279 Kali. 1 4471 4472 4473 4474 4475 4476 4477 4478 4479 4480 4481 4482 4488 4484 4485 4486 4487 4488 4489 4490 4491 4492 4493 4494 4495
Page #307
--------------------------------------------------------------------------
________________ 280 EPIGRAPHIA INDICA. (VOL. XVII. TABLE CONCURRENT YEAR. JOVIAN SAMVATSARA. Mean Kali. intercalated (adhika) lunar month. saks. Meshadi solar year in Bengal. Kollam. Chaitradi Vikrama. A.D. Southern system. Northern system. 801 . 7 Asvins 4446 4497 802 4198 803 . 4499 1817 1818 1319 1920 1321 1322 1828 1452 1458 1454 1455 1458 1467 1468 569-70 1894-958 Bhava , 14 Vikrama 570-71 1896-96 9 Yavan . . 15 Vrisha 571-72 1396-97 10 Dhatri . . 16 Chitrabbana 572-78 1897-98 11 Isvars . . 17 Subhana 573-74 1398-99 12 Bahadhanya . 18 Tirana 574-75 1399-147018 Pramathin . 19 Parthiva 875-76 1400-01 | 14 Vikrama 20 Vyaya . 4500 3 Jyeshtba 1 12 Phalguns 4601 4602 807 .
Page #308
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 281 xc-concld. COMMENCEMENT OF THE MBAN BOLAE YEAR. MBAN LUNI-BOLAB YEAR (MEAN SUNRISE OF THX CIYIL DAY ON WHICH CHAITRA BUELA 1 ENDA). Kall Day and month, A.D. Wook-day Tiine of mean Meshssamkrinti. Day and month, A.D. Week-day. a (hoot, the index of the tiths). 13 17 20 23 57.2833 4496 4491 27 Mar. (86) 27 Mar (86). 27 Mar. (87) 27 Mar. (86) 27 Mar. (86) 27 Mar. (86) 27 Mar. (87) Fri. O Sat. 2 Mon. 3 Tros. . 4 Wod. 4408 M. S. 14, 15 3 Maz. (62) 24 22 Mar. (81) 88 11 Mar. (71) 42 28 Feb. (59) 51 19 Mag. (78) 08 Mar. (87) 27 9 % Mar. (86) .3 Toes. 2 Mon. . O Sat. 4 Wed. 3 Tnes. O Sut. 6 Fri. 91-9157 308-2704 181-9933 4499 216-8757 4500 4501 5 Thur. 928088 23 5 O Sat. . 1870810 4502
Page #309
--------------------------------------------------------------------------
________________ 282 Mean luni-solar month, ending after the second of the two solar samkrantis connected with it. 1 Chaitra DERATION AND COLLECTIVE DURATION OF MEAN SOLAR MONTHS ACCORDING TO THE BRAHMASIDDHANTA, WITH INCREASE OF G AT EACH SAMKRANTI. 2 Vaisakha 3 Jyeshtha 4 Ashadha 5 Sravana 6 Bhadrapada 7 A vina 8 Karttika 9 Margadira 10 Pausha 11 Magha 12 Phalguna 1. Chaitra (of fol lowing year). At the mean solar samkrantis. EPIGRAPHIA INDICA. Mina-samk. (of previous year). Mesha-samk. Vrishabha-sark. Mithuna samk. Karka-samk. Simba-samk. Kanya-samk. Tala-samk. Vrischika-samk. Dhanus-samk. Makara-sark. Kumbha-samk. TABLE XCI. Collective duration in time, and collective increase of a from mean Mesha-samkranti to the several samkrantis. Day. 0 30 60 91 213 Weekday. 243 273 304 334 Mina-samk. Mesha-samk. (of 365 following year). * (r) gyi ii gl ii iiEE 121 152 182 (0) (0) (2) 10 31 0 01 1 7 33 2+ 18 4 3 4 85 84 15 6 4+ 1 37 51 12 8 6 64 307-3492 614-6983 922-0475 1229-3966 1536-7458 1844-0949 2151-4441 2458-7933 2766-1424 3073.4916 3380-8407 (5) (0) 22 39 (3) 9 10 71 (5) 19 41 81 (1) 6 12 9 3688-1899 3 (4) 21 (2) H. M. S. (5) 0 0 0 (3) h a 2 [VOL. XVII. The duration of each mean solar month is 304 10 31 04: and in this time the mean moon's increase of distance from mean sun (our a), in measurement by 10,000ths of circle, is 307-349156595. A samkranti occurs at the moment when the mean san eutes a zodiacal sign.
Page #310
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM. TABLE XCII. CENTURY-TABLE. SUNRISE ON DAY OF VALUE OF a (=t) AT BEGINNING OF CENTURIES K.Y., i.e. AT MEAN OCCURRENCE OF MEAN MESHA-SAMKRANTI (MEAN SUN AT 0deg) IN FIRST YEAR OF CENTURY. [CENTURIES 38, 44, WERE DEFECTIVE; THE REST COMMON.] 31 30 29 28 27 Beginning Beginning Week of K.Y. century. in A.D. day. 26 25 24 23 22 58895 Interval of days from Weekmean Meshasamkranti day. day. 1 21 20 19 37 38 39 40 18 17 16 41 42 43 44 45 For odd years of centuries use the Siddhanta-Siromani Table LVII-B (above, Vol. XV). 2 10000 NO300 200030 599 699 TABLE XCIII. MEAN SUNRISE VALUES OF a (DISTANCE OF IMEAN MOON FROM MEAN SUN) IN 10,000THS OF CIRCLE FOR A MONTH PREVIOUS TO THE DAY ON WHICH MEAN MESHA-SAMKRANTI OCCURRED. (3) 799 899 (5) 999 1099 1199 1299 1399 (mean sunrise value). 8 9502-4085 9841-0404 179-6724 518.3044 856-9361 EUR90EUR 1195-5884 1534-2004 1872-8324 2211.4643 2550-0963 EUR0000 2888-7283 8227-3603, 3565-9923 3904-6243 4243-2568 4581-8882 HERRE CROTO BERRIO 15 Interval of days from mean Meshasamkranti day. 1 14 13 12 11 10 9 8 6 a ( t). 4 6228-4770 5100-3761 3633-6433 2505-5425 8 1377-4416 249-3408 9121-2399 7993-1391 6526-4063 2 Weekday. 2 00000 30000 NO3000 (mean sunrise value). 3 4920-5202 5259-1522 5597-7842 5936-4162 6276-0482 6613-6801 6952-3121 7290-9441 7629-5761 7968-2081 283 8806-8401 8645-4721 8984-1040 9322-7360 9661-3680 0-0 The use of this Table is explained in Example 2 of this article, and in Example 1 of article on the First AryaSiddhanta, mean system (above, Vol. XVI). 202
Page #311
--------------------------------------------------------------------------
________________ 284 EPIGRAPHIA INDICA [VOL. XVII. TABLE XCIV. TIME-EQUIVALENTS OF THE TITHI (a OR t), NAKSHATRA (n), AND YOGA (y) UNITS. In very close cases it is sometimes necessary to calculate the exact moment of the beginning and ending of tithis, nakshatras and yogas, with greater accuracy than can be obtained by the use of Table X, Indian Calendar, or Table LXX (above, Vol. XVI, p. 216), where the time-equi valent of the unit, respectively, is given only in hours and minutes. My general working Tables for several of the Hindu astronomical Siddhantas already published yield results, stated in measurement by 10,000ths of the circle, with an accuracy extending to four places of decimals, and the following Table enables the result to be translated into time down to a fraction of a second. It may be used for all astronomical authorities. The tithi-index unit. The tithi-unit is robooth of a mean lunation. The mean lunation, according to the Aryaand Surya-Siddhantas, occupies 29d 12h 44m 279. The unit, or 10,000th part of this, is 4m-2524046, or 4m 15-144279. The nakshatra-index unit. The moon's nakshatra, or her position in the heavens, mean or true, is found by adding the tithi-index, a or t, to the index of the sun's longitude, s, mean or true. Both these values are found in the ordinary course of calculation for a date. The mean nakshatra-value n 10,000 is reached in 274 7h 43m 12-3. In this period the sun's mean motion amounts, in 10,000ths of circle measurement, to 748-0087 (Table XLIV above (Vol. XIV)) and the moon's mean distance from mean sun increases (Table LIV A, B (Vol. XV)) to 9251-9913. Total 10,000. 274 7h 43m 12-3-39343m-205, and this divided by 10,000 fixes the time-equivalent of the nakshatra-unit as 3m-9343205, or 3" 56"-05923. The yoga-index upit. Similarly the yoga-chakra is estimated by the Surya-Siddhanta (Indian Calendar, p. 62, SS 113) as occupying 36605-116 minutes of time, or 25d 10h 5m 6-96.1 The yoga-unit therefore is 3m-6605116, or 3m 39-6307. 1 The yoga formula is y = (san's long.) + (moon's nakshatra), and, since n-s+a, y=28+ a. In the period noted it will be found by calculation, using Table XLIV (above, Vol. XIV), that the mean suns arrives, in 10,000ths of circle measurement, at long. 695-9511; and by using Table LXIV (Vol. XVI) that in the same period the mean moon has increased ber distance from mean san (a) by 8608-0964. Twice -1391-9022, and this + 8608-0964 (the value of a)-9999-9988, practically 10,000 exactly. Table LXIV was prepared according to the First AryaSiddhanta. Using Siddhanta-Siromani and Brahma Siddhanta estimates (Table LIV) the total amounts to 10,000-0015, I have as yet ro similar Table according to Surya-Siddhanta requirements; but from what has been said it may be assumed that its estimate of the time occupied by one yogo-chakra (-10,000) is correct.
Page #312
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 285 TABLE XCIV-A. TIME-EQUIVALENTS. TITHI-INDEX UNITS. ("Arg."= a ort.) H.M. S. Arg. H.M. S. Arg. H.M. S. Arg. H. M. 8. | 4 10 58-51 4 15 87 4 19 23-80 4 23 38-96 54.09 9-23 24-38 39-52 a 2 7 34:33 2 11 49.47 2 16 4.62 20 19-76 34-91 28 50-05 2 33 6-19 20-34 41 35-48 50-68 50 5-77 54 20-92 2 58 38-06 3 2 51-20 3 7 6-35 3 11 21:49 8 15 86-64 61-78 6 14 12-70 6 18 27-84 6 22 42-99 8 28 68-18 6 81 13-27 28:42 43-56 43 58-71 48 13-86 6 52 29-00 6 56 44:14 7 069-28 7 5 14:43 14.10 28-86 21 15 49.28 20 57-71 12-14 w 0 4 15:14 0 830-29 0 12 45-43 0 17 0.58 0 21 15-72 25 30-87 0 29 46-01 0 34 1.15 38 16-30 0 42 31:44 0 46 46-59 0 51 173 0 55 16-88 0 59 32-02 1 347-16 i 82-31 1 12 17:45 1 16 82-60 1 20 4774 1 252-29 1 29 18-03 1 33 33-17 1 37 48-32 1 42 3.46 1 46 18-61 1 50 33-75 1 54 48-90 1 59 4:04 2 8 19-18 = a 28-57 8-98 44 54-67 9-81 4 53 24.96 4 57 40-10 5 1 55-24 6 6 10-39 5 10 26.53 5 14 40-68 55-82 10-97 26-11 91 41-25 56-40 11:54 5 44 2669 648 41-83 58-98 6 57 19-20 6 1 27-28 6 542-41 6 9 57-55 36 41.00 58 41 55-48 68 479-85 70 62 24.28 22-07 37-21 38 52-36 3 41 7-50 8 45 22-65 49 37-79 8 63 52-94 3 58 8:08 4 223-22 46 88-37
Page #313
--------------------------------------------------------------------------
________________ 286 EPIGRAPHIA INDICA. (VOL. XVII. TABLE XCIV-B. TIME-EQUIVALENTS. DECALS OF TITHI-INDEX UNITS. First 3 decimals. First 2 decimals. 3rd and 4th decimals. S. 3rd and 4th decimals. S. 3rd and 4th decimals. 3-55 171 *0001 -0002 5-10 0-03 0:05 0-08 1.78 o 7-65 1.76 0 10-21 *0034 0085 0036 -0037 -0088 -0039 0.10 0-13 -0067 0068 0069 -0070 -0071 -0072 -0073 181 -0003 -0004 -0005 *0006 -0007 -0008 -0009 -0010 1 28-75 1 29.80 -38 1 81-85 -37 1 8440 -381 38-95 1.80-51 1 42-08 44-81 491 47-16 -481 40-71 1 52-28 461 54-81 1 67-87 89-92 O 1876 1.0 16-81 O 17-86 O 80-41 O 82-96 O 85-51 0 28-07 0 30-62 2 60-95 58-60 2 56.05 2 58-60 8 1:15 8 370 36-28 8 881 8 11-88 8 18-91 8 18:46 8 19-01 8 21-56 8 24:12 0-87 0-89 0-92 0-94 0-97 1.00 1-02 1.05 1-07 1.10 1.12 1.15 1:17 0041 0-20 0-23 -0042 -0010 0.26 0-28 *0011 1-94 1.96 1.99 0012 -0043 -0044 -0045 *0046 -0047 088-17 0-31 0-38 0-36 -0018 -0014 9:09 0 86-72 -0015 0-38 -0048 1.22 -0074 -0075 -0076 -0077 0078 -0079 -0080 -0081 -0082 -0083 -0084 -0085 0086 -0087 -0088 0089 -0016 -0049 0-41 0:43 0-46 1-25 1-28 2:12 -0017 -0018 -0019 -0020 2:14 *0050 -0051 -0058 -0053 0-48 22 0-51 0-54 0 58-58 O 66-18 0 58-68 061-28 18-79 1 8-84 25-02 27-67 10-12 2 12-88 9 1628 -54 % 17.78 562 20-88 2 22-88 -572 25-48 2 97-98 -592 80-54 2 88-09 8 86-87 3 89-48 8 41-98 *88 8 44-58 3 47-08 8 40-68 3 62-18 8 5478 8 67-28 0.56 0.59 -0021 -0022 0028 -0024 -0025 -0026 1-80 1-33 1-35 1-88 1:40 1.43 1.45 148 1.51 2.22 2:25 2.27 2-30 2-32 2-35 0-61 0090 -0091 -0092 -0054 *0055 *0056 -0057 *0058 -0059 -0060 -0061 -0062 -0063 0064 -0065 1 8-89 1.58 -0093 2:37 69-84 2-40 1 11:44 1 13-99 0-64 O-BR 0-69 0-71 0-74 0-77 0.79 0.82 0.84 1-56 1-58 -88 -0027 -0028 *0029 -0080 *0031 0032 -0098 1-61 288-19 2 4074 48-29 2 46.84 3 48 40 84 -0094 -0095 -0096 -0097 -0098 -0099 4-94 7-49 10-04 -811 19-09 -821 81-85 -83 1 2490 8-47 1-63 1-66 1-68 2-50 2:52 12-59 0086
Page #314
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-SIDDHANTA: MEAN SYSTEM. 287 TABLE XCIV.C. TIME-EQUIVALENTB. NAKSHATRA-INDEX UNITS. H. M. 8. Arg. H. M. S. Arg. H. M. S. H.M. S. 0 3 56-06 0 7 52.12 0 114818 15 14:24 2 1 57-84 2 558-90 2 949-95 2 13 46-01 2 17 42-07 2 21 88-18 2 25 84-19 40-80 38-36 5 58 1.39 8 1 57-45 6 6 63-51 8 9 49-57 6 13 45-68 6 17 41-69 6 21 37.76 6 25 33-80 6 29 29-88 6 88 25-92 13 6 5185 1940 17-78 80-25 238 26-31 2 87 29-37 2 41 18-43 945 1449 2 49 10-56 253 6-61 2 57 2.67 3 58-72 8 69 59-61 4 8 65-67 4 7 61-73 4 11 47-79 4 15 43.85 4 19 89-91 85-97 27 82-03 28-09 24:15 4 39 20-21 4 43 18-26 47 12:32 4 51 8:38 4 55 4:44 0-50 56-56 52-62 6 10 48-68 5 14 474 40-80 86-86 82-92 6 80 28-98 6 34 26-08 688 2109 42 17:15 6 46 13-21 6 60 9-27 5 6 38 27 32-41 28-47 24-58 20-59 18-85 12-71 8.77 0 56 483 059 089 1958-95 i 6 58-01 1 10 4907 1 14 45'18 1 18 41'18 1 22 87-24 1 28 88-90 1 80 29-86 1 84 8542 1 58 2148 1 49 1754 1 46 1380 509-86 64 672 54.78 60-84 3 12 48-90 42-96 89-02 8 24 85-08 81-14 32 27-20 3 36 28-26 19-92 8 48 8 52 856 11:44 7.40 355 1.78
Page #315
--------------------------------------------------------------------------
________________ 288 EPIGRAPHIA INDICA. (VOL. XVII. TABLE XCIV.D. TIME-EQUIVALENTS, DECIMALS OF NAKSHATRA-INDEX ONITS. First 2 decimals. First 2 decimals. First 2 decimals. 3rd and 4th decimals. 3rd and 4th decimals. S. 3rd and 4th decimals. 02:36 0-80 -0067 m m 2 38-16 2 40-52 2 42-88 0001 -0002 - 0034 -0035 -0086 0.88 0088 7-08 1.58 1-61 1.-63 1.65 0-85 -0069 1 20-26 22-62 24-98 -371 27-34 1 29-70 1 32-06 1401 3442 -0003 -0004 m 0-87 0-02 0-05 0:07 0-09 0-12 0-14 0-17 0-19 -0037 -0038 2 47-60 49-96 0-90 0-92 m 1-70 0 14-16 0 16-52 0-94 2 52-32 2 54-68 18-88 1 86-78 m -0070 -0071 -0072 -0073 -0074 -0075 *0076 0077 0078 -0079 57-04 -2005 -0006 0007 -0008 -0009 -0010 *0011 *0012 -0013 *0014 -0015 2 59-40 8 1-77 3 4:13 0-21 0-24 0-26 s 0-28 28-38 030-69 0039 -0040 -0041 0042 -0043 0044 0045 0046 0047 +0048 0049 -0050 *0051 -0052 s 0-81 14 1-72 1-75 177 179 1.82 1.84 1.86 1-89 1-91 1-94 1-96 1.98 2-01 0-33 -0080 33-05 0 35.41 0 37-77 040-18 s 3. 8-85 3 11-21 3 18-57 3 15-98 3 18-29 -0016 0-35 0-38 0-40 1 39-14 1 41.51 1 43.87 451 4823 1 48-59 -471 50-95 481 5381 49 1 55-67 -50 1 58-03 0-89 2 2.75 25-11 27-47 2 9-88 2 12.10 2 14:55 -68 16-91 919-28 2 21-64 s O4249 -0017 -0018 s 0-97 0-99 1.02 1.04 1.06 1:09 1:11 1.13 1.16 1.18 1.90 1-28 1-25 1-27 1-30 1.32 1-35 1-37 1.39 1.42 1:44 1:46 0-42 44-86 s 0-45 s 047-21 019-67 2:03 ss 0-50 -0019 -0020 -0021 -0022 -0023 -0024 s 0-52 0-54 s 0-57 51-98 -23 54-29 0 56-65 O 69-01 1 1.88 -271 3.74 -0058 -0054 -0055 -0056 -0057 *0058 *0059 0060 0061 -0081 -0082 -0083 -0084 -0085 -0086 -0087 0088 -0089 -0090 -0091 -0092 -0093 -0094 -0095 0096 -0097 0098 -0099 s 0-59 s 2-05 2-08 2-10 2-12 2.15 2.17 2.20 2.22 2-24 3 80-09 8 32-45 3 84-81 -92) 3 87-17 8 89-54 3 41-90 344-26 3 48-62 | 8 48-98 -98 8 61.34 8 58-70 0-61 -0025 *0026 -0027 -0028 0-64 24-00 s 0-86 *0029 0-68 0062 -0063 -0080 0.71 2-27 8.46 1 10-82 1 18-18 821 16.54 -831 17-90 2 26-36 28-72 31.08 2 8844 2 85-80 0-73 2-29 *0031 0032 *0083 -0064 -0065 1:49 1.51 1.53 1.56 -85 0-78 0-78 2-31 2-34 68 *0066
Page #316
--------------------------------------------------------------------------
________________ No. 15.] THE BRAHMA-BIDDHANTA: MEAN SYSTEM. TABLE XCIV.E. TIME-EQUIVALENTS. YOGA-INDEX UNITS. H. V. S. Arg. H. V. s. H. V. S. Arg. H. . s 0 0 8 968 1 1996 1 58 1 7 58-66 8:18 6 88 8-89 6 88 ha8-09 5 0 25-66 2 4 97M 2 8 7-7 2 11 481 8 48 amon ka 10 0 8818 8 64 16-86 8 61 6600 ke 1 86-88 5 5 15-28 4. 8 54-88 4 1 4 . che ja ana98 6 61 -5 5 66 6 68 4981 6 2 % 6 8- . ja 6*97 99 45-60 ma 2 98 2523 486 vdo 1 ke 19 5978 * 4 88 8841 1 | 18 18 aa 2 83 5 87 wha 1 1 - 4 80 8967 % 89-90 ja 45-88 1 0 10 6888 So is 8858 0 18 18:15 0 1 5778 0 25 1741 17:05 68-68 88-81 0 40 15-04 0 48 66.67 0 7 85-90 0 61 1488 0 546 0 68 3409 1 2 1872 1 5 58:35 1 9 88-98 1 18 12-61 1 16 624 1 80 81-88 1 in:51 1 # 51-14 1 81 80-in 1 100 1 88 50-09 1 48 99-68 1 46 98 1 40 499 4 1 51-68 ka kaMTha 31-19. 4 49 1098 2 8 964 2 56 427 1 69 zA-90 8 a 1-58 8 6 4-11 9 10 90-80 8 is 0MB 3 11 60-os 8 a 10-89 5 66 0-08 5 6 919 5 8 0-86 6 1 28-88 Tha in -81 88-95 1 36 18-68 6 18 5 99 5 86 -87 150 87-18 ika-21 87-88
Page #317
--------------------------------------------------------------------------
________________ 290 EPIGRAPHIA INDICA. (VOL. XVII. TABLE XCIV-F. TIME-EQUIVALENTS. DECIMALS OP YOGA-INDEX ONITS. First 2 decimals. M. S. First 2 decimals, M. S. First 2 decimals M. 8. 3rd and 4th decimals. 3rd and 4th decimals. 3rd and 4th decimals. 0-75 0-77 84 1 14-87 -35 1 1687 +36 1 19.07 21-28 1 28-46 0-02 0-04 0-07 0-09 0-11 0034 0035 -0036 -0087 0038 0039 0.13 -0040 -0001 -0002 -0003 -0004 0005 -0006 -0007 -0008 -0009 -0010 -0011 0012 2-20 Jo 4:39 06-59 8-79 10-98 06 O 18:18 07 016-37 -08 0 17.57 -29 0 19-77 10 0 21-96 -11 to 24:18 120 28-86 18 O 28-56 14 O 80-75 15 o 82-94 *16 8614 170 8784 TO 89-58 *19 041-78 48.98 48-12 48-82 60-62 -0041 0042 *0043 -0044 -87 2 27-15 29-35 31-56 33-74 35-94 38:13 40-33 42-53 44-72 46-92 49-12 51.31 2 53-51 -802 55-70 -81 9 57-90 0-10 888 2.29 -843 4:49 -853 6-89 8-88 11-08 19-28 0-79 0-81 0.83 0-86 0-88 0-90 0-92 0-94 0-97 0-99 1.01 1.03 0067 *0068 0069 -0070 -0071 -0072 -0073 -0074 0075 0076 0077 -0078 -0079 -0080 -0081 -0082 -0083 0084 1.47 1.49 1.52 154 156 1.58 1-60 1.63 1.65 1.67 1.69 1-71 1.74 176 1.78 180 1.82 1.84 1:87 0-15 0.18 0-20 0-22 0-24 0.26 0-29 0-31 0-88 0-35 0-37 0.40 0.42 0:44 0-46 0-48 0-51 0-58 27-85 1 80-05 82-24 84-44 1 86-84 1 88.89 -48 1 41-08 -47 1 43.28 -48 1 45-42 -491 47-62 -501 49-82 52-01 -521 64-21 -58 1 56-40 "58-60 0-80 2.99 5-19 7-89 9:58 2 11-78 18.97 16-17 18-87 20-56 22-76 2 24.96 -0045 -0046 -0047 -0048 -0049 -0013 -0014 *0015 *0016 -0017 0018 -0019 -0020 -0021 -0022 -0023 -0050 *0051 -0032 *0053 1.05 1:08 1:10 1.12 1:14 1.16 1.19 1.21 0085 0086 1.89 -0054 1-91 1-98 1.95 1-98 62-71 1787 0035 *0056 -0057 -0058 -0059 0024 54.91 19-86 -0025 67-10 82-06 0-55 0-57 0-59 1.25 1.27 1-30 1-32 1.34 1.36 -0026 -0027 -0028 -98 3 24-26 0060 -0087 0088 -0089 0090 *0091 0092 *0093 -0094 -0095 -0096 -0097 -0098 0099 2:04 2.06 8 28-45 28-85 -870 69-80 1.50 8-69 1 5-89 -31 1 8-09 +92 1 10-28 -88 1 12:48 0-61 0-64 0-66 -0061 -0062 -0068 2-09 1-38 2:11 0029 -0080 -0031 -0052 -0033 0-88 -978 88-04 85-24 -99 8 8743 2-13 -0064 -0065 -0066 0-70 0-72 2.15 2-17
Page #318
--------------------------------------------------------------------------
________________ No. 16.) VELVIKUDI GRANT OF NEDUNJADAIYAN: THIRD YEAR OF REIGN. 291 No. 16.-VELVIKUDI GRANT OF NEDUNJADAIYAN: THE THIRD YEAR OF REIGN. BY H. KRISANA SASTRI, B.A., OOTACAMUND. Sixteen years ago, when Mr. Venkayya in his Epigraphical Report for 1908 (pp. 50 ff) discussed with great ability the contents of the fourth of the early Pandya copper-plates discovered till then, he remarked : " The originals of these plates have not been traced. Tbe following account of them is based on a preliminary study of two excellent impressions belonging probably to Sir Walter Elliot's collections kindly placed at my disposal by Dr. Fleet in 1893." These duplicate impressions of the grant now in the editor's possession, are marked by Dr. Fleet "I-n-11" and must have been originally intended for publication in the Indian Antiquary. Mr. Venkayya, however, could not at once prepare an article on them, as the early Pandya chronology was then obscure. About the end of 1915, Dr. L. D. Barnett of the British Museum, London, sent me impressions of a copper-plate inscription preserved in that institution and wished to know if it had been published and what its contents were. Curiously enough, it happened that these were the very same impressions of which Mr. Venkayya was una ble to trace the originals. I wrote back to Dr. Barnett informing that the plates contained on them an important Pandya grant which had been already noticed in the Epigraphical Report for 1908 and asked for certain details about them. He says briefly: "There is no seal on the grant: the plates are held by a thin copper-ring, which has been cut." The detailed measurement of the plates and their number, consequently, remain to be what has been described by Mr. Venkayya, vis., these are ten copper-plates, of which the first seven are numbered on the left margin on their inner sides and the impressions measure 103" by 3}", the first and the last plates being written only on their inner sides. The writing on the plates is both in the Granths and Vatteluttu characters, the first being used in Sanskrit passages (ul. 1 to 30 and 11. 142 to 150) and in all Sanskrit words that occur in the Tamil portion of the inscription. The Grantha characters and orthography do not call for any special remarks except that in almost all conjunct consonants, where they are written one below the other, the upper or the first member of the compound letter is marked by the virama, following evidently the Tamil method of writing. The same influence is also observed in the pronunciation and spelling of Sanskrit words, e.g., parakan and purokan (l. 99). kritapatanan (1. 100) and kandakanishturan (1. 100 f.). In one particular case, the purely Tamil word antunar (1. 61) is written partly in Grantha and partly in Tamil. The use of tsha for ksha (1. 114), uma for tmu, dma for Ima and ri for fi or ru, in compound letters, also shows the same influence. Consonants coming after r are always doubled except in w in line 14 and far in line 17. The upadhmaniya and jihvamuliya symbols are used throughout in their proper places. The anusvara used in-varggansyudhi (1.14) and in samyati (1.28) is worth noticing. It denotes the anunasika forms of yu and ya and is shaped in the form of a crescent with a dot in it placed over the heads of these letters. In his commentary on Panini VIII-4-59 Bhattoji-Dikshita remarks that the anusvara in such cases changes itself optionally into the nasal form of ya. The Vatteluttu character so called, is an oblique form of Tamil (excepting certain letters) with a few angularities which on careful scratiny could be easily accounted for. The only four letters in the alphabet whose form cannot be explained with reference to Tamil are the vowel letters i( ) (see irakki(r) in line 40), ai n ) (see aimpadinuar in line 135) and the more frequently occurring na ( 3 and po ). In the matter of the Vattelutta palaeography of this inscription it might be noted (1) that the publi is correctly inserted throughout the inscription except in a few cases, e.g., volti- (1. 31), sttsrattum= (1. 47 f.), arram (ibid.), -avarku (l. 46) and volci? (1. 37); (2) that it is unnecessarily inserted over the vocalio 6 and 0 and even
Page #319
--------------------------------------------------------------------------
________________ 292 EPIGRAPHTA INDICA. [VOL. XVII. over the initial vowel letter o, as in mennum, chchor, (1. 34), korkai, korran, konda (1.35), dey (1. 38), goli (1. 43), nennuri (L. 45), rrennan (l. 46), kkolai, chcheliyan (1. 50), olgada (1.108 f.), ododa (1. 109), polil (l. 65), pporu (. 63), porutaga (1. 71); and (3) that it is omitted in a few cases. The shaping of the long d-sign in ru (l. 119), nu (1. 107) and lu (1.76) and the use of the Tamil alabedai (Skt. pluta) in kkoliya in line 97 for the purpose of completing the metrical quantity are worthy of notice. This alatedai according to the Tamil grammarians is to be used in (i) selling articles, (ii) calling people at a distance and (iii) in filling up the metrical quantity in a verse. Panini omits (i) and (iii). While in Sanskrit only vowels have pluta, in Tamil the consonants (nasals and sibilants) are also thus lengthened. The orthographical peculiarities such as the insertion of y after consonants with the e-sign (IL. 94, 97f); the substitution of the vowel i for yi (Il. 66, 115, 118, 140); the non-observance of euphonic rules in adding the suffixes win (1. 93), ul (1:59), in (1. 93) and odu (l. 46 f.); the Want of distinction between the long and the short i (except in the single instance nirod-atti in line 117) and between the long and the short o, are noteworthy. Puli-tur (1.58), omaiy-iruppai (l. 121 f.), chey-idai (l. 122), mani-imai (l. 81), kkali-araisan (l. 90), kurai-uru and nirai-urk (1. 102) are also cases of the omission of sandhi. Paramesvaranas-Velvikuli (l. 110) for 'nal Velvikudi and velirpatlu for relippatiu (11. 41, 49, 52, 88) are evidently wrong forms; sekkuri (1.120) for seykkuri and aimpadinuar (1. 135) for aimpadinmar may be regarded as colloquial usages : similar also may be the use of kudu (1.125) for kodu. The form iydu (1. 152) for idro through the intermediate form ihdu probably gives us the clue for thu correct pronunciation of the Tamil aydam-sign which is now pronounced as the jihvamaliya and the upadhmaniya forms of the visarga. The metre used in the Tamil portion of the inscription is the Agaval while in the Sanskrit portion the metres employed are: Vamsastha (vv. 1, 12), Anushtubh (vv. 2, 17, 20 and 23), Vasantatilaka (vv. 3, 9 and 19), Sardulavikridita (vv. 4, 5, 6 and 10), Malabharinit (vv. 7, 8, 15 and 16), Upendravajra (vv. 11, 14), Drutavilambita (v. 13) and Arya (v. 18). Paleographically, the Granthe characters of the Velvikudi grant differ from those of the Madras Museum plates of Jatilavarman, although for reasons stated in the sequel, both of these have to be attributed to the period of the same king Nedunjadaiyan. The difference is distinctly observed in the formation of the serif which in the first case is a plain horizontal line, whereas in the second, it makes a loop with the letter. The bottoms of letters like ma and ba and the top of the vowel i are bent at the bare line in the Velvikudi grant, whereas in the Madras Museum plates they either form one uniform curve, or are straight; the upadhmaniya and the jihramuliya signs are not used at all in the Madras Museum plates. The punctuation marks at the end of verses in the Velvikuli grant are the pillaiyar fuli (2_) whereas in the Madras Museum plates they are denoted by the so-called om symbol (9)*; anusvaras are more frequent in the Madras Museum plates than nasal conjuncts. The Velvikudi grant, in numbering the plates, uses the Grantha letter-symbols, whereas the Madras Museum plates use the usual Tamil numerals. In the Vatteluttu alphabet employed, however, the two grants do not seem to differ much, except in the case of the letter ya which in the Velvikudi grant as in the Apaimalai inscription, is unigeptate, while in the Madras Museum plates it is bipartite. This single difference in the characters of the Tamil portion which is the earlier, and perhaps constitutes the grunt proper in both, Deed not show that the two grants must belong to different periods. The 1 The scheme of this verness given in the Chhandoma nijari is :viSame samajA yadA gurucat sabharA na tu mAlabhAriNIyam / Ind. Ant., Vol. XXII, with Plate, pp. 67 ft. * The latest interpretation of this symbol is riddhih, success.' * Above, Vol. VIII, p. 317 1.
Page #320
--------------------------------------------------------------------------
________________ No. 16.] VELVIKUDI GRANT OF NEDUNJADAIYAN: THIRD YEAR OF REIGN. 298 insertion of the Grantha portion in the Velvikudi grant might have been somewhat earlier than that in the Madras Museum plates. The Sanskrit portion of the record commences with an invocation to Siva (verse 1) and goes on to refer in general terms to the Pandya kings and their race, of which the family priest was the sage Agastyal (vv. 2 and 3). At the end of the previous Kalpa, it is stated, there was a powerful king named Pandya who was ruling at the entrance into the sea (i.e., on the coast of a gulf) and that the very sa ne king at the beginning of the current Kalpa was born as Budha, the son of the Moon (v. 4). His son was Pururavas; and in his family, whose crest was a pair of fish, which shared with Indra, the lord of gods, half of his throne and his necklace and was a party in the puranic churning of the milk ocean, was born king Maravarman, a patron of the learned (vv. 6 and 8). His son was Ranadhira (v. 9) and his son Maravarman II Rajasimha (vv. 10 and 11) at whose presence the king P.llavamalla ran away from the battlefield (v. 12). This king Rajasimha married a Malava princess and by her begot king Jatile (v. 14), who was also called Parantaka (v. 17). Thus ends the short Sanskrit eulogy (prasasti) which was composed by the Sarvakratuyajin Varodaya-Bhatca (1. 30). We may now pass on to what the bigger and the more important part of the record, the Tamil prasasti, has to say, with the remark that the Sanskrit portion, by its brief notice and the very meagre historical material which it supplies in the form of a general introduction, could not have been contemporaneous with the Tamil portion. It was evidently added only later to give a dignified appearance to the grant proper which is in Tamil This Tamil portion begins with the mention of a past event, namely, that the kolvi-Brahmans' of Pagapur-Kurram seeing that one of their own community, named Narkortan, the headman of Korkai, who had contemplated the performance of a Vodic sacrifice, with the belp of the ruling Pandya king (adhiraja) Palyagamudukudumi Peruvaludi, placed his petition before the king and themselves standing in front of the sacrificial ball, blessed that spot to be thenceforth (?) called Volvikudi. The king granted the village to Napkorran and it was thus that the village came to be enjoyed by the latter for a long time. After this, & powerful Kali king, named Kalabhran, conquering many adhirajas, brought under subjection the whole Pandya country including, of course the village Velvikudi which was then resumed. Some time elapsed and after this sprang forth a powerful Pandya, named Kadungon, who reconquered the whole land from his enemies. His son was Avanichulamani Maravarman. His son was Soliyap Vapevap Banden and his son, Arikesari A.gamagaman Maravarman, who won a battle at Pali against his enemies; defeated a certain Vilveli at Nelveli; destroyed the Paravas and the people of Kuru-nadu; won a victory at Soppilam, conquered the Korala several times at the strongly fortified town of Puliyur; made many gifts and protected the Brahmapes and the invalids. His son was Sadaiyan, the lord of the Konga counter (Kongarkomin), who was possessed of the titles Tenga Vanava, Sembiyan, Salan and Madura-Karunatakan, won a battle at Marudur, Agastya is also sopposed to have been the founder of the Tamil language and the author of the Tamil grammar Agattigam montioned in Tamil literature. He is referred to as the family priest of the Pandyas also in Kalidisa's Raghuvania, VI. 61, and in the commentary on Iraiyanar. 4gapporul. Kalvi-andaralar may also mean learned Prihmapur Bat.blja sama.to be wed here in a technical sono. In inscriptions we find the word applied to a close of administrativo odors whose bainous was to carry the applications of petitioners to the hearing of the king. See also Ep. Ind, VOL III, P, 89, foot-pote 7. 81..., the village of the sacrifice. In the Tamil portion in l. 108 f. it is stated that the village had the name Ve vikudi given to it by king Madakudami. The significance of this title is not apparente Could it be that like Sombiyap and $6bap he could beve acquired it by conquering the Western Chalokyw who were lowo w Karnataka? Bat we know that there were too fue away from the reach of the Pandya. Another possible explanation is that the Pandym might have intermarried with the Chalokys and the imue of: soch an intermiscriugo might well be called the Swot Karnataka'! Agal. the identification of the Kalabhra wible Karnata by W. Vonkosyys ( below p. 906) som to gain in vignifionnce in considering the propriety of the titlo. Madarn-Farandako held by Wing fladalya
Page #321
--------------------------------------------------------------------------
________________ 294 EPIGRAPHIA INDICA. [VOL. XVII. defeated Ayavel in battles at Sengodi and Pudankodu, destroyed the Mahar:thas at the big town (Mahanagara) of Migalspuram and stamped the symbols of the bow, the tiger and the fish on the big mountain, viz., the Himalayas. This shows his supreme authority over the Chera, Chola and Pandya countries, whose symbols were the bow, the tiger and the fish, respectively. His son was Ter-Maran who routed his enemies at Neduvayal, Kurumadai, Mangi-Kurichchi, Tirumangai, Puvalur and Kodumbalur, defeated the P:llaval king and captured his elephants and horses in the battle of Kulumbur, crushed his enemies at Periyalur crossed the Kaviri (i..., the river Kaveri), subdued (the country of) Mala-Kongam, reached Pandi-! Kodumidi, worshipped Pasupati (i.e., Siva), contracted marriage relations with Gangaraja' and renewed the fortifications of Kudal, Vanji and Koli. His son was Parantaka Nedunjadaiyan, who drove the Kadava (i..., the Pallava) into the forest, after defeating him in the battle of Pennagadam on the southern bank of the river Kaviri and won a battle at Nattukkurumbu driving away the Ayavel and the Kurumbas to the forest. This king possessed a long list of birudas such as Srivaran, Sina-chCholan, Puna-pPaliyan, etc., enumerated in Il. 98 ff. In the third year of the reign of this last mentioned king, a man having arrived at Kidal with a loud complaint, the king himself enquired into the matter with kind words and hearing from him how his village Velvikudi in Paganir-karram, originally granted under that name by his ancestor, the great king (Parumesvaran) Palyagamudukudumi Peruvaludi, was resumed by the Kalabhra and had since then remained so even after the resumption of Government by tne Pandyes, he ordered the applicant to produce the necessary evidence before the nadu to prove that the village was his from early times and thus to get it back. The complainant proved his claim accordingly and the king renewed the grant to the applicant Kamakkani Narchingan, the headman of Korkai. The anatti of the grant WAS Madavikalan Marangari alias Muvendamangala-Pperaraiyan, the crest-jewel of the Vaidyakas and a native of Karavandepura, and a favourite of the king of kings (i.e., the Pandya king Nedunjadaiyan). It is stated of this Marangari that he fought bravely in the fight that ensued between the kings of the Eastern country (Purva-rajar) and Vallabha on the occasion when the daughter of Gangaraja (the Ganga king) was procured for Kongar-kon. Ll. 134 to 141 repeat that the owner of this brahmadeya (viz., Velvikudi) was Kamakkani Suvaran-Singan, the headman of Korkai, by which perhaps the Narchingan, just mentioned, must be referred to. The composer of the Tamil prasasti was the Senapati Enadi alias Sattap Sattan. This brings us to the end of the Tamil portion. The next Sanskrit verse speaking of the ajnapti of the grant says that he was Mangalaraja Madhuratara, & Vaidyaka and a master of the Sastras, & poet and an orator. Then follow four imprecatory verses which are expressly stated to be quoted from the Vaishnava-Dharma. A Tamil prose passage coming after this says that the king himself ordered the engraving of this copper-plate grant and that the engraver was a certain Yuddhakesari Perumbanaikkaran. In noticing these plates in his Annual Report on Epigraphy for 1908, pp. 50 ff., Mr. Venkayya has already made it clear how Kalpa-kshayat in v. 4 has to be understood with reference to the traditional account of the deluges or tidal wave in the Pandya country and to the survival of a king of the old Pandya line of the race of the Moon and in all respects corresponding," under the name Budha. Similarly also, the mythical boast of the Pandya kings to have engraved their crest on the top of the Himalayas and to have shared one-half of Indra's throne and worn the garland of the king of the gods, has been shown to occur frequently in the later Pandya inscriptions. Palyagamudukudumi-Peruvaludi is a historically famous Pandya king in whose honour 1 The name of this Pallava king, which begins with Se, is hopelessly damaged on the inpression. * Evidently the same mentioned in connection with the next king, his son Nodunjadaiyan. > Old Madura is supposed to have been washed away by the sea : see commentary on 4gapporul, p. 4.
Page #322
--------------------------------------------------------------------------
________________ No. 16.) VELVIKUDI GRANT OF NEDUNJADAIYAN: THIRD YEAR OF REIGN. 295 five poems are known to have been sung by three famous Sangam poets and included in the Tamil anthology called Purandnuru. In one of these he is stated to have captured the extensive forts of his enemies and to have destroyed and ploughed their streets with a team of white-mouthed asses. This way of dealing with the conquered countries seems to be a very old one. Dr. S. Konow points out that there is a reference to it in the Hathigumpha inscription of Kbaravela. It is mentioned also in some inscriptions of the later Pandya king Maravarmap SundaraPandya I. The Kalabhra occupation of the Madura country and the consequent interregnum are also noted by Mr. Venkayya with 'he remark that the Kalabhra may be the Karnata. After the interregnum came Kaduugon with whom the first academy (Sangam) of Tamil poets is supposed to have come to an end. The list of the kings that followed Kadungon to the donor Nedunjadaiyan is given in a genealogical table on p. 54 of the Annual Report on Epigraphy for 1908, together with further information supplied about them by two other sets of Pandya copper-plates secured from Sippamantr. Mr. Venkayya thinks that Nedunjadaiyan of the Velvikudi grant must be different from Nedunjadaiyap of the Madras Museum plates published by him in the Indian Antiquary, not only on the strength of certain palaeographical differences already noted above but also on account of the different engravers who in the one case Was Yuddhakesari Papdiya-Pperumbapaikkaran and in the other, Pandi-Pperumbapaikkarap alias Arikesari. He further identifies Nedunjadaiyan of the Volvikudi plates with Marajadai. yan of the Anaimalai cave inscription; for, between these two there is not only palaeographical similarity, but also it happens that the ajfiapti of the former is the prime minister mentioned in the latter, both being called Marangari Navendamangalapperaraiyap, members of the Vaidya (or Vaidyaka) family and natives of Karavandapura with the attributes Maduratara and Kavi. Consequently, the two kings Nedunjadaiyap and Maranjadaiyap, who both bore the same surname Parintaka, must be identical and the date of the Velvikudi grant must be about A.D. 769-70 which is the date of the Apaimalai inscription. About the military achievements of Nedunjadaiyap we learn from this inscription that he defeated the Kadava king at Pennagadam on the southerni bank of the Kavori river and grove the Ayavel and the Kurumbas in a battle fought at Nattukkurumbu. Again, a statement made about the ajnapti of the grant in lines 126-129, adds that Marangari rendered valuable service to his master Nedunjadaiyan by defeating a certain Vallabha at Venbai, on the occasion when the eastern kings secured the hand of the Ganga princess in marriage for Kongarkon. Here Kongarkon in order to suit the context, must be taken to be a surname of the Pandya king Nedunjadaiyan himself. This is not improbable, inasmuch as his grandfather. Sadaiyap is also called in the inscription (Text, 1.70), Kongarkoman, and his father Ter-mirap is stated to have contracted relationship with the Ganga king (Text, 1. 84). This latter event perhaps refers to the occasion when Marangari achieved the success mentioned above. In spite of what Mr. Venkayya thinks about the identity of the kings mentioned in the Velvikudi plates and the Madras Museum plates there are strong reasons to believe that both refer to the same king. For, the ruling king Parantaka. Nedunjadaiyan and his biruda. Panditavatsala, Virapuroga and Vikramaparaga occur in both. Further, the surname Srivaramangala given to the granted village Velangudi in the Madras Museum plates makes it clear that the king must have also had the hiruda Srivars' which we find actually given to him in the Velvikudi plates. The special mention of Mirti Eyinap in l. 136 of the Velvikudi platus u According to tradition there were three Sangame or old acadouni Twmi] Porte. The date of the last of these has been widely discussed. The latest pronouncement on the subject to that it must have come into existence some time after the 6th Century A.D. * Acta Orientalia, Vol. I, Part I, p. 238. These plates are under publication by me in the Epigraphia Indion. Mr. K. V. Subrahmanya Ayyar also sappone it to be so; oid, hin Sketches of Ancient Dokhan, pp. 108,
Page #323
--------------------------------------------------------------------------
________________ 296 EPIGRAPHIA INDICA. [VOL. XVII. one of the fifty Brahmana sub-donees marks him out as an important personage. From the Anaimalai inscriptions, we know that Eyinan was an epithet or surname held by Maran Eyinan, the younger brother of Marangari himself. Perhaps Maran Eyinan and Marti Eyinan were both younger brothers of Mag-ngari. The ajnapti of the Madras Museum plates was Dhirataran Marti Eyinan, who was one of the maha-samantas of the king. There is little doubt that Murti Eyinap of our plates and Dhirataran Mirti Eyinan of the Madras Museum plates are identical and that thus also the king Nedunjadaiyan mentioned in both these sets of plates is one and the same. If this identification is accepted the two allied plates together supply the full list of the military exploits of Nedunjadaiyan. By the third year of his reign (the date of the present grant) Nedunjadaiyan must have subdued the Ayavel and the Kurumbar and defeated the Pallavas south of the Kaviri; but before his 17th year (the date of the Madras Museum plates) he had carried his conquests right into the heart of the Kongu country and taken possession of it by defeating its king Adiyan and his allies the Pallavas and the Keralas. The conquest of the Kongu country and the desire to possess it seem to have been very strong with the Pandya kings. For, Sadaiyan, the grandfather of Nedunjadaiyan, held the title Lord of the Kongas and his father Ter-Maran actually crossed the Kaviri, subjugated Mala-Kongam and had invaded that country even as far as Pandi-kKodumudi. Nedunjadaiyan seems only to have followed in the footsteps of his ancestors in subduing the Kongabhumi, as far as the land of the Gangas. The information that a Ganga princess was married into the Pandya family is not mentioned in any of the Ganga records of this period which, falls into the reign of Sivamara I (755 to 765 A.D). The Vallabha or the Western Chalukya king who was defeated on this marriage occasion was probably Kirtivarman II who succeeded to the Chalukya throne in A.D. 746 or 747 and whose army is stated in his records to have defeated the army of the Keralas, the Cholas and the Pandyas. From what is stated of the countries of Kongu and Kerala in these inscriptions of Nedunjadaiyan, it is not difficult to see that the former was bounded on the east and perhaps also on the north by the land of the Gangas-the Gangavadi 96,000 of the Western Gangas of Talakad and that on the south it extended far beyond Kodumudi, as even to cover the northern portion of the later Rajasarya-Valanadu of the Cholas which included in it the present Musiri and the Trichinopoly talukas. Coimbatore was in the western division of the Kongu-mandalam. The king of the Northern (vada) Kongu, was Adiyan-the Adigaiman or Adiyaman of later inscriptions whose capital was at Dharmapuri, the ancient Tagadar, in the Salem district. The Kerala country was situated on the west coast beyond the Sahyadri mountains and may have included also the southernmost portions of the present Coimbatore district. In the 8th century, therefore, it looks as if the Konga king allied himself with the Pallavas in the north and the Kerelas in the south and tried to oppose the invasion of the Pandya Nedunjadaiyan. The Vallabha was defeated by the Pandya general and a Ganga princess was married into the Pandya family perhaps as a political measure. It is stated that Parvarajar put to flight Vallabha. Marangari also fought on the same occasion. Perhaps the Pirvarajar were the chiefs of Gangavadi subordinate to the Western Ganga king who contracted marriage relations with the Pandyas. Mr. Venkayya observes again in his Epigraphical Report that the title Arikesari occurring in text-line 62, was borne by a certain Nedu-Maran who is mentioned in the commentary of Nakkirar on Iraiyanar-Agapporul. This latter work, as tradition says, was made available for the public by Nilakandanar of Musiri eight generations, i.e., about two hundred years, after the actual date of Nakkirar: Mr. Venkayya seems to have gone wrong in identifying Nedu-Maran of literature with Ter-Maran of the Velvikudi plates where, however, the characteristic title Arikesari is not given to him. The other titles, too, are not applied to him and the See remarks on his Namakkal inscription in the Madras Epigraphical Report for 1905, p. 75 f.
Page #324
--------------------------------------------------------------------------
________________ No. 16.] VELVIKUDI GRANT OF NEDUNJADAIYAN : THIRD YEAR OF REIGN. 297 battles fought by him as described in the commentary under reference, are not found in the eulogy of Ter-Maran given in the Velvikudi plates. On the other hand, Maravarman, the great grandfather of the donor Nedunadaiyan, is not only called Arikosari but is also stated to have fought victorious battles at Pali, Seppilam and Nelveli which same are mentioned of him in the commentary on the Agapporul. This mention, therefore, of the very same battles both in the plates and in the commentary, sufficiently warrants our identifying Nedumasan of the commentary with Maravarman, the great-grandfather of Nedunjadaiyan and not with Ter-Varan. Nakkirar has sung also of Nedunjeliyan in Puranawuru, and it is not impossible that this Nedunjeliyan is identical with Seliyan, the father of Arikesari Maravarman. Of the six ancestors of Nedunadaiyan mentioned in the Tamil portion of the inscription and the three immediate ancestors mentioned in the Sanskrit portion, we learn nothing more than that the first king Kadungon who came to rule after the Kalabhra interregnum was a Pandy-adhirEje, that the next Maravarman bore the title Avanichaamani and that the third Sendan, also called Seliyan and Vanavan, was probably identical, as stated above, with Nedunjeliyan of the Purananuru fame. The fourth king, whose military achievements are given in detail, was Sri-Maravarman Arikesari Asamasaman, who in addition to the victorious battles mentioned already, destroyed the Paravas and the people of Kuru-nadu. The fifth Sadaiyan, also called Ranadhira, was the lord of the Kongas, fought battles against the Ayavel at Marudur, and with the Maharathas at Mangalapura ; and the sixth, Ter-Maran or Rajasimha, defeated Pallavamalla, perhaps at Kulumbar, and fonght battles at Neduvayal, Kurumadai, Marnikurichchi, Tirumangai, Pavalar, Kodumbalar and Periyalur and subjugated the country of Mala-Kongam as far as Pandi-k Kodumiti. He contracted relationship with Gangaraja, marrying the daughter of the Ganga prince to bis son Nedunjadaiyan, himself having married the daughter of the king of the Malavas. The fact that he defeated Pallavamalla shows that Ter-Maran must have been a contemporary of that king and lived about A.D. 710-760. As regards the territorial terms and village names that occur in the inscription, Pagapurkurram is identical with the division of that name in which the village Solavanda near Madura was included. Malava is identical with Mala-nalu. Kusu-nadu, and the granted village Velvikudi, and the villages Nagarur, Korranputtur and Payal mentioned in the description of the boundaries of the latter cannot be identified. Korkai is the well-known seaport of that name in the Tinnevelly District. Of the villages Nelveli, Sennilam, Puliyur in Kerala), Marudar, Mangalapura, Neduvayal, Kurumadai, Mapnikapichchi, Tirumangai, Pavalor, Senguli, Pudangodu, Kodumbalor, Kulumbar, Periyalur, Pandikkodumiti, Kadal Vanji, Koli, Pennagadam, Nattukkurumbu, Karavandapuram and Venbai, -Nelveli is Tinnevelly; 1 Ibid., pp. 129 ff. 2 Describing the several grades of ralers, the Kamikagama states that an adhiraja-adhiraja is the form which the inscription uses throughout the Tamil portion-holds the second rauk among kings: catummamudraparyantaM pRthivoM yaH prpaalyet| cakravarNI samAkhyAtaH saptarAjyaM prapAlayet / adhirAjamamAkhyAta: (Hindu Iconography, Vol. I, Part 1, p. 29 n.) * Melava is identical with the old Mala-nida ur Rajasraya-Yalanidu (sve 8. I. I, Vol. II, Introduction, p. 24, and Historical Sketches of Ancient Dekhan, p. 129). * Udayachandra, the general of Nandivarman Pallavamalla, also claims in the Udayondiram grant to have defeated the Pandya at Mannaikkudi (S.I.T., Vol. II, p. 868, Text, 7. 60 f.). Perhaps we may have to identify Mannaikkudi with Mappikurichchi which is mentioned in the Tamil portion (Text, 2. 73 f.) as one of the place where Ter-Maran was victorious, No. 127 of the Madras Epigraphical Collection for 1910. * See above noto .
Page #325
--------------------------------------------------------------------------
________________ 298 EPIGRAPHIA INDICA. (VOL. XVII. Marudor is perhaps Tiruppudaimarudur near Ambasamudram; Mangalapuram of the Maharathas might be Mangalore; Kodumbalur is in the Pudukkottai State ; Pandikkodumidi is the village Kodumudi near Karur a station on the South Indian Railway; Kadal is Madura; Vanji is Karur'; Koli is Woraiyur near Trichinopoly ; Pennagadam is in the Tanjore District; and Karavandapuram is the modern Kalakkad in the Tinnevelly District. TEXT. First Plate. Svasti [ll*] 1 Sriyan-chiram vaf-sibir-ansu-fokharas-Siva[b] srit-artti-pratibandha-kiranam [deg1 tangtu sauvarna-kapa2 rdda-sundarak-kudarppa-Kandarppa-mada-pramarddanah 2 [10] Visvambhari bhara-Granta-sesha-visrama-karaoam [1] .3 kalp-antam=bhuvi sthejad=anvayah-Pandya-bht bhritam 2 [2] Astambhayat kshiti-dharam-pravijrimbhamanam-ambha48-samastam-apibaj-jaladhos=cha yas-sah ["! Kumbh-odbhavo bhavati yasya munih-purodhas-sa sri-nidhi5 reijayati Pandya-narendra-vamsah 2 [3] Asthad=apratima-prabhava-mabitah Pandy-abhidhano nidhe6 r@vvaradhvari "mahipatis-tribhuvane line-pi kalpa-kshayat [1] Dhatra srishta vata punasasa 7 jagatam raksharttham-abhyarthitas-tejasvi tanayatvam etya sasino namna Budh akhyo-bhavat 2. [4] Second Plate; first side. 8 Putras-tasya Purarava bhuja-bala-pradhvasta-daityah-prabhus=tad-Tambe Sikharin-- dra-mastaka-si9 la-vinyasta-anatsya-dvayo [1] Sakr-arddh-asana-hara-bhaji Sarand visvasya vif Vambhara-geha10 svamini saivato yadhi jit-atesh-amar-ari-prabhau 2 [5*] Datibhtta-divokasi: kshitidhara-kshu11 bdh-sbhisanksbobhita-kshir-odanvati Kumbha-sambhava-kara-prapt-abhisheka-kriyo [lo] isht-artth-arppana12 tarppit-artthi-janat-iptirnpa-kshama-mandalo janm-avapa jaga-tray-archchita-guns[b'] frt-Maravarmma ni 1 Pandit Baghara Aiyangar of Ramnad has proved from copious references to literature that the earliest Vaiji in Karur. But an inscription at Dbirapuram mentioes the town Kongu-Vaji, suggesting thos, another Vaji which was perhaps the earlier and the capital of Chora. ? From two es allont impressions supplied by Dr. Fleet to Mr. Vonkayya in 1893 and another sapplied by Dr. L. D. Barnett to be in 1915. * There wo ayllables are written on the left margin of the plate. * Bendraras dari, Rond -dipaukari. . Read jagat.
Page #326
--------------------------------------------------------------------------
________________ Velvikudi Grant of Nedunjadaiyan: the 3rd year. veelpail a pm ceengk Ha577 ctm ppppuk :- kaacai **peettga12 ptaak vtntpaapu taall 534303286plm: ktaikaivngk ll aatip ptikttppaavaak sareanxpkk ppootu JAIT | 8 taakmkkukkntm 34 - irupptu HTTI22 2GUNASE ai * km : oo73 kaatu mnnntu knnnkvlltu pi3tnnnkklaa 10 jyteevptkaaraapuuloocl2 tppul ptppttintiy j X MPUaicuv tllnnn 7755. paaey HK ktkllaivllaittt 2 mkaameetkai 2,778 SUSTAIt 335 . 14 16 tk t k cipaa aatil *' t 2653712/anurad kaattaayBER *Pa57 TO 213-11 - 1U tiru 11. ilaikllaak tik-t-2 | til ptpti veetvaannn 773 13:5172 TTAtittrr paatikkaat paan 20 ktirttu 15 kaakm as - kttk taiy tderated 3-12 t l 31. t aaeetai SIS prutt 58255 vtnnntu aaOress Srens hni8 TURNS ttaakpootiruntu 9: klUXyaapteett 675 to 15136 ttppt 0:eyyaaltttu utHITAS D EAT SOaavk cynnnm 28 U- 75 CUS: HT 1. ulkppookaappum veppm itil klaaytti30 kuvaak paal upaataiy TODAVUTH t p ku gre). p .500ERU ai0731 * *tl paOaa' 80a eNes / SSSS.pttivonar1048 SASTv lppnnnttknnnaatmttum oANDRNESS G3 tittumairkyaa klaamtlai ttipnnn moot 36 F. W. THOMAS| WHITTINGHAM & GRIGGS, PHOTO-LITH. SCALE ONE-HALF
Page #327
--------------------------------------------------------------------------
________________ hr nmz myN H md w yh sr jlq zdkh ( dr t hrn mdt dr mh 88 1`dd mn bh lhjh md shd w dr dr w n dhd dh w w` n m dhn dhd bh hdr dd dy mh drh dr dh m m | dwd ph wjh dh dh rh wh nh dhd | mrdh r `h rh bh dr mrHd rwdhndh . 2 ( dr dhh dHh 25 `ddy 20 8830 y mhdy 3dnh wh bh 2.2 wynwrwz Hd Hdh wmjdr@ bwdnd w hr jhwdh nd w bh wy d d trdd w nh fhmh nh dh nh mwjwd@ bh bh bd n kh mh khh yn mdh G11lnkh khlkh 125 k k 42 hdyh y nh th w khn w b l khh ddh 6:Hd@ 5 d hr hdyh nn wr dr ddnd khh 5h@ hkh w mrwr my khrdnd. bhd. bh ddh krdnd bh nwzdhm drdy khh dndh ry khy dd khh 2 khhn dydn khyr dr khwh dhrh wjhh fl shrh Hdh S g 2 y khh bh khlh rHm l lh lrHmn jh ny 8 0 0 0 1 3 250 60 drjh l l l l " w mm mydn * * qd 6 f`l 1998 fyh k lm s 2822265 dl rw 1 h k dh 22( . 2 byd br rw y bdn z qly dkhnd 1 25 z bqyh dndh wrdh/hr `wydhn bh lmrwr 2336 231wh hwh y khh hdf dhd wytHd d dddddd 86 ) dh fh th * * 507 twnd bh w`d wdy@ 775* *** l t hyh | sndwy rwy ddh w bh dnd nh nd dh lhjlh bh mdt dwrh dwm 8r53`ddy hh w h dhyd . h bh mrHlh dhh ` wjhh jwnd zdn dh dhd . ld y@ w15 m dh rh wh bh lwlh h dn n hn Hdwd dh nfrh 6 ty dydny ddn wh w d dh f k h nh wh rh qh mh kh w mdh d dn d dyd khh dr dmh drd kyt wyndwz 10 dhr@ 2013 bh dndn w dr`yh " dwd 2 hn jdyd ndym bh hr ykh bh dkhn dhywj` `n hj@ wjwd yn kh l lh . dh r nh hnr bh yh nh nhwnd ddh w bh dh 74 bj wrz dhyd. bh d dwhb@ b`dd 3 8 5 * bwdnd r h jbhh rH n dwnh y my khrdnd 78 wy r bh mdt 2010 11: 5) hmyn ln dhndh mdry . d`wt b h hrh khw dwd/th nd khh dyd khh my dwnh nndnh d rwddh dh mwdh yh dfh bwd w nmwnh yhdd khnndh dwh drnh ndr@ mHdd b 34 hnd w pyh dhm d@wyhh Hd nh.10 d hhhwn bldm w` dw khmd dhdhnm th ddd mdd dddd hn wn hh yh thdd 823 w dn nhyN yh dw`dny w qhwh qhryh hdyh y lyy@w@ w fyjy (2 * 3 * 222 b
Page #328
--------------------------------------------------------------------------
________________ No. 16.) VELVIKUDI GRANT OF NEDUNJADAIYAN: THIRD YEAR OF REIGN. 299 13 Pah 2. [6] Dharani-valayam samastam=etan-nija-dorddanda-mah-drag pa . bibhrit1 [lo] aharat-sa bha 14 jangam-Adhibhartas-chira-kal-odvahana-klaman=dharyah 2. [76] Adhiruhya tulam-a-mitra-varggam-yudhi ji Second Plate ; second side. 15 tv-Amrita-garbbhato janitva [1] Sudhiyim-adhipas=suvar na-rifim vidhivat-sa pratipadayam-babhtva [ [8*] Tasy=k16 nmajas-taruna-bhaskara-tulya-teja raja babhuva Ranadhira iti pratitah [*] yo lilay=aiva bhuvana17 sya babhara bharam haram yath=asya guravas=suranayakasya 2 [9*) Patras= . . tasya Purandara-pratikfitir=bhu18 sundart-vallabho namr-agesha-narendra-veshtana-mani-vrat-avpit-imghri-dvayah[l*] asit-satya-sakhab-pa19 rakrama-dhanah-patm sanayab-patir-vvidy-ichara-vibhashana[ho] sruta-[dha]ra[ho] fri-Maravarmm=abhidhah [10*] Sa Raja20 simhas=sarasirub-aksho bhayam bhuvi prana-baritam=apasya [] raraksha dakshah kshapit-ari-paksha21 kshamitalarh kshmi-patir-akshat-djnah 2. (11") Naro nu Raksho nu Haronu Parushah-paro nu sakrd nu Third Plate ; first side. 22 sarosham-agatah [io] iti (sma] . matva yudhi yam-bhay-a[rddi]tah-[pr]layata [Pellava]malla-bha pa23 tih 2 [12] Kanaka-garbbha-klita-prasavah-punas=samadhiruhya tulam=atulam= api [l*) akira(t-a]24 rttham-apakrita-kalmasho dvija-daridra-sur-ayatane=shu ya 2 (13) Maha: kulinam-Malav-endra-[ka]25 nyim & Maravarmma sadrasim-uviha (1) ajayat-syam Hara-sdnu-kalpo jagad-dhitartthan-Jati26 l-abhidhauah 2. [14] Afishat=sa dharam=ahina-sarah=kshitipal=kshalita-7 kalmash-anushamgam [lo] nata-ra27 jaka-mauli-ranna-rasmi-prakar-abhyarchchita-pada-patma pithah 2 (15*) Khalaye sa gunan-adat=Ksitasya 28 sva-bhujabhyam sura-padapa-svabhavam [19] abhayam Saranagata-prajabhyas=sn divam samyati sa 1 Rend bibhrat. * Read pakshah kahamao. Read kahitipah kahdo. * Resd maja Read Maha. Read ratne. * Rend padma. * Read sadsifie * Read pudna.
Page #329
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. (VOL. XVII [] agiya Third Plate ; moond wishe. 29 tru-partthivobhyah 2. [16] Rajatam mahfpala-kirit-arppita-sasanah Rajasimha-suto - 30 ja chiram=urvyam=Paradtakah - [178] I-prasasti Sarvvakratu-yaji Varodaya-Bhattapar=che31 yyappattada lill- Kol-yanai-palav=0tti-kkuda-mappar-kulan-tavi32 rtta Palyaga-Mudukudumi-pPeruvaludi eppum Pandyadhirajana= 33 Daga-mi-malar-chcholai-nalir-gipaimigai-vand-alambum Pagapur34 kkurraml-eppum palapa-kkidakkai-nir-nattu-chchorkappalar-lo35 lappatta srutimarggam-pilaiyada Korkai-kila-Narkorrap kop36 da velvi murruvikka kelvi-andapalar mupbu kocka epr-edut Fourth Plate ; Arst side. 37 t-uraittu volvifalai-mugbu ninru Velvikudi opr-a-ppadiyai-chohi38 roda tiru-valara-chcheydar (*) Vondap-appoludoy nirod-atti-kkoduttamai39 ya-pidu-bhakti Sattapipn[Il"]=Alav-sriya Adhirajarai agala nikki agal-idattai40 kKalabhrep-eppan-Kali-araisap kaikkopd=adapai ipakkiyapin [ll] Padu-kadan-mulai 41 tta paradi-pola Pandyadhirajan velirpattu vida-kadir-avir-oli vilaga virri42 runda velai-sulnda-viyal-idatta-kkdvus=kafumbum pavadan marukki=chche43 nikol=ochchi vep-kudai-nilar-rang-oli-nirainda Tarapi-mangaiyai-ppipar44 palaurimai tiravidi=nikkittappal-urimai napgapam=&maitta mapam-pe45 rtta-tapai-vendapp=odungs-manpar-oli-nagar-asitta Kadungon-epnun-kadi46 r-ver-Rennen [ll] Mart-avarku magan-agi mahitalam podu-nikki Malar-mangai(y)-o Fourth Plate ; second side. 47 da mapan-ayarzda arram-il-adar-ver-rapai-Adhirajan Avapiohalimapi etti48 sattum=igal-alikku=matta-yanai Maravarmman [ll] Marr-averka maruv-iniya oru-magan-149 gi Map-inagalai masu=kkadinda vikramattin velirpatta vilangal-vel-poBO ri<Page #330
--------------------------------------------------------------------------
________________ Velvikudi Grant of Nedunjadaiyan : the 3rd year. dib. ekhrng 303 308 343 94 9 5 49.23 593853352525 epn 3-0 29/561 26/S6 3933359+ aiA9555350SS eln NS -5045-32 2685092565 125. 25 N3642484%22N5 466 46933856333\\ng 5998395% SSC230A 1020983352 3 4 5 6 ng30243-325960x6D~ 32359 braa maalaa 902135 235/6294 -0g2js. 19 20 2523 2522 222/535 253586-6 29 J1day (n 5842952 1 5394 325 3n/16ng 232335643-833 ch.32. CS335) 0-261329 299325274353- 2. ainkhw3523)S- 485 S5 5am`ng it 4. 3-4 -9498330398335554855199 1n 13 + 116 595 32.5-sVR5n5n99.$8fg8E 48hUj5 aid dii 7 air Taaw 5 5% nch &aab.c7hh6hNx5 100 386 8++ 5 6 5 7 23. 59 -30 6 5 kh`ngbaang chaa ai`n aidthii 28-076 esaa 2217 aid 172 6 10 Jejaeng1 3 aid bn 56 5 1364053-430096 2495 29 203333 128 802012 9 22- 2 548 8438,39,3. 5555 khaa4 235, 38.4 395 3 102 viib. 108 84383x2033922645483992929:33 na3 43.3 8 104 phuuaichngaanekh.5. 25153529883325 khn 936855 ch.34 533549989355-25x25 3 25332 g3 5 daaw % 294-02939 r23/8 29 318 chan 0313-3/ S5, 39:394535 2533 2522, 0324 49999%89 2390 , 0g5G dng 3. 33 & 20x302054 235 33 /4749.230 A%%932685390T 96MS 4529249085595394) 10 4 22953 195 book 339 390 3-2 (2.33%-- 3 thaang2.54303003485332-2539 ch . 95-2525 2525 24 25 260500 g/4w59 - 12/2555 * * 0*62-310 -26 29 29 9 3 231 200-3528 229 :32:9933312 303 3042SNR0384-502 40 px *294 292332 ) x 3" 19-12205.*8/59qyv993 1339798 269 2521 322 323 334522233 chaang - 18 523 13:589521654213323(N)*192921329330330 S-866 2434 28568533 23447352Nx2+12120 pkhaang392533 aib 28.ng`ngn532ngkng- m.33533-10-09 Gir daan doa 40 45 5 2 * 51 52 4 4 39 40 4199553154237vr 122 2 / 6. `ngphuukhaay20 g 23 23UV ybbOS 6.3 SS59xJ9wng 53n+ 210kngyng500.93.2w1v2993Hw+22 o++98 29903634aaichngai3 chngngngngbw/ae16992w9:))~ ainhn ngng) 5.5.393535235790 559,034- 45naa22 #565289207772, 3, chii, 5 air 452 34 3 5 53 rawm 35 40 45 52308089535396Je35, 1 50o93/13) `aa~02-2591795%e044653555 2 2. S.A009 2009 2) 2535aphngmngchnwm34 khn F. W. THOMAS SCALE ONE-HALF WHITTINGHAM & GRIGOS, PHOTO-LITH
Page #331
--------------------------------------------------------------------------
________________ 1x 4 07-512-2552 raya 20 2354-5598-324-3 (2) N912 kh n 33. 3x3xU1ad0G4 25 2546 25x25 2558 232 132 5 295 tang3n~ow 134 136 - SS2 t`n rawangraang Page #332
--------------------------------------------------------------------------
________________ No. 16.) VELVIKUDI GRANT OF NEDUNJADAIYAN: THIRD YEAR OF REIGN. 301 Fifth Plate; first side. 57 [ta]ni-chcheakor-Keralanai-ppala-mu[raiyum-urimai]-obohngram[od-avar-ya]nai. 58 [y]um purilai-mmadir-Pulicyjfir-ppage-naligai ir[v]Amai iga[1-6]. 59 li[*]u! veglu kondam vel-Ali[y]um viyap-parambam=elimaisen60 r=erind=alittum Hiranyagarbhamun-Tulabharamun-darapimilai-ppala soy[du] 61 antanarkkum asaktarkkum vand=apaiga epr=itt=alitta makarikai-api-mani62 nedu-mudi-Aribesari Asamasaman ari-Maravarmman [1] Marr=avarku magap agi=kkopra-ve63 1 valan-endi-pporud-trun-kadar-rapaiyai Maruduruq mapb=alitt-Ayave. 64 lai agappada ey=ennamai erind=alitta=chChengodi[y]um Pudap [ko]t 65 tun-cheru vepr-avar-sipan=tavirttu-kkoog-alarun-narum-polilvay-kku66 [*]i[lo]du ma[*]ilagavu-Mangalapuram=eppum mahk-pagarun Maharatharaz e Fifth Plate ; oond ride. 67 rindalitt=agai-kadal-valagam poda-moli agarri-chchilai[y]um puli[yjam 68 kayalun-chepru nilaiy-amai-nedo-varai-ldava[y]ir-kiddy mamp=igid-apda 69 tapp-ati-chchenkor-Bappe=Vansvap Sembiyan Solan manpar-mappe[n] madu70 ra-Karunadagan kop-gavinsa neduzehndar-ver-Kangar-koman koepbObadaiyan 71 Masr=avarku putrapay Map-magaladu porattaga matta-yapai selav=undi mapa72 vel valap-ondi-kkada-visaiyal=edirndavarai Neduvayalvay nigar-ali73 ttu=kkaruv-adainda mapattavarai-kKurumadaivay-kkirpp-alittu Ma74 ppikurichohics*Jun-Tirumangai(yju-muppinravar muran-alittu mevalo75 r-kadar-xapaisy*]od=orr-ediroy vandavarai-pPuvaldr-ppuran.gandun76 kodum-purisai-nnedua-kidangir-Kodumbalur-kkadar-kadum-pari Sixth Plate ; first side. 77 [y*Jun-karun-kaliran-kadir-velip=kaikkondun=Cheva... [ka]dada Pallavapai-k 78 Kulumburut-tai-aliya epp-iranda mal-kalijum-iva[liga]lum pala kavarn79 dum tariyalarayattaritta varsinp Periyalir-ppid-4 littom paviri[y]a80 m-polir-cholai-kKfviriyaakkafandig-slepamainde var-bilai[y]in Mala-ko81 ngam-adippadutto mind-oliya-mapi-imaikkum-eilamainda nedum-pu82 risti-pPannikkodumidi topx-eydi=pPalapatiyadu panma-padam papind=e. 83 tti=kkanaka-raki ()*]un-kadir-mapi[y]um mana-magnlal-kkudattittuoskonga84 r-van-narud-kappi-kGanga-rajagodu sambandhanuebeydum eppipandapa Gs. 85 sahasramum Hiranyagarbhamun-Talabharamam mapninmisai-ppala Meydu ma86 fai-navipor kurai-tirttan-Kidal Vafiji Koli eppu-mida-ma-madi Sixth Plate; second side. 87 1 pudukkisy"Jum=arai-kadal-valaga:=kuraiyad-inda mappar-mappa[6]-Rennara. marngaRead magifs. Read kanga. 2 T 2
Page #333
--------------------------------------------------------------------------
________________ 302 EPIGRAPHIA INDICA. [VOL. XVII. 88 mana-ven-kudaimin Ber-Marap [IN] Marr=avarku magan-agi Mal-uruvip velirpa89 ttu=kkorra-mupr=udap=iyamba=kkulir-ven-kudai man kappa Pa-magalum Pu90 la-magalum Na-magalun=nalan=etta=kKali-araisap vali talara=ppolivinodu vi91 frirundu karua-kadal-udutta perungan-nalattu nar-perum-padai(y*]um pa92 pada-pparappi-kkarudadu vand=edir-malainda Kadavanai-kkad-adaiya=ppi-vi93 ri[y]am-punar-kalani-kKaviri[y*]in=renkaraimor-rann-agam-malar-chcholai94 pPennagadatt-amar veprun=ti-vay-a[y*]il=endi=ttilaitt=edirey van95 d-irutta Ayavelai[y]un-Kurumbarai[yjum-adal-amarul-alitt-otti-kkattu96 [k]kurumbu bepr-adaiya Nattukkurumbir-cheru v[e]orum=arai-kadal-vala Seventh Plate; first side. 97 gam=oru-moli=kkoliiya silai-mali-tada-kkai Tenpe=Vanavan avane98 y Srivaran Sri-mandharan Sinachoholan Punappuliyan vitakan mashani 99 vinayavisrutan vikramaparakan virapurokan marudbalan minyasasanan Manupaman 100 mardditaviran giristhiran gitikinnaran kripalayan kitapatanan Kalippagai kanda101 kanishturan karyadatshinan karmukha - Partthan Parantakan Panditavatsalan pariparnnan pa102 pabhiru kurai-uru-kadar-padai-ttagai- gunagrihyan gudhanisiranayan nirai-upu-mala103 r-mani-nin-mudi-Neriya[ro]kon-Nedufijadaiya[no] [118] Matr-avanran rajyavatsalam7 magra Seventh Plate ; second side. 104 vadu selanispa ang=oru-nan=maca-ma-madir-Kadar-palu ninravar s105 krddhik kaakkopravaney marr=avarai-tterrena nangu kavi enney nub-kurai 106 epra mapnaga-ppapitt-arala mo-pa-pin-kuravarar-pan-murai[y*]in va107 lavimai magan-toy-malar-chcholai=pPagapur-kkurrattu-ppaduvadu 108 alva-tapai-adal-vendoy Velvikudi eppum piyar-udaiyadu 0109 Igada vor-ragai[y]od-oda-veli udan katta Palyaga-Mudukudumi110 Peruvaludi eppum Paramesvarapkr Valvikudi epnappattada 111 kolviyir-sarappattadanai=ttulakkam-ill kadar-rapaiy-dya Kalabhra112 r&l-irakkappattadu epru pipravan vijnapyan=cheyya napru naprzepra 113 musuvalittu natta=pin palamaiyadal kattini [ko!gav=en]na natt[]x-ran Eighth Plate ; first side. 114 palamaiyadal kattinap-ang-appoluddy katta ma-na!=e[i]-kura115 varar=panmuraisy*]ir-rarappattadai emmalan-tarappattad=epra de116 mmind-avan-edutt-aruli vir-kai-ttada-kkai-viral-vondan Korka-kila117 Kimakkani Narshingarkuetter-oduu-kadar-rapaiyag-pirod-attik[ko]118 duttamai[y]in marr-idarku-pperu-nang-ellai terrena viritt-araip119 pir-pagar-aru-polip-marang-adatta Nagartir-ellaikkum mokkum marr-idarku. Read kacmaskan. . Read withiran, * Reed pidha virnayas. The original bus the impossible combination oilsiutan. * Read karyadakshinan. Rand karanka'. Road atsaran. . Read mal,
Page #334
--------------------------------------------------------------------------
________________ No. 16.) VELVIKUDI GRANT OF NEDUNJADAIYAN: THIRD YEAR OF REIGN. 308 120 ttfeln ellai Kulandaivan-Kolvandai-gesylkkun-Kalandai-kkulattilaalukksul 121 vadakkum marr-idarku mel-ellai arram-illa=kKorrapputta(r)r-Odumaiy-i122 ruppai-chchey-idai morralai=pperuppirku=kkilakkum marr-idazku vadapa Eighth Plate ; second side. 123 l-elslai kaya]lat-kamalam malarum Payalu! vadapalaiepperuppirku=t124 tepkum ivvaiyait[ta*] peru-nang-ellaiyir-patta pumi karanmai miyatchi 125 ull-adanga mel-en-guravaras=kudukkappatta parisey emmalnn-[ko]duk126 kappattadu i Marr-idark-anatti kurram-inri-kkarunkalai-kkongar-van-na127 run-kanni-kGingarajan du kanya-ratnam Kongarkorku-kkunandu koduppa arp128 p-ara-adar-ranai-pPurvvarajar pugaprelundu vil-viravun-kadar-ranai-[Vajllabhanai 129 Venbaivay al-amara!!=clind-oda va!-amaru!=udan=vavviya ena-pporio 130 igal-amaru!=idi-urum-ena valan-enda (malai]tta-tanai-Madavikalan mappar-ko131 -arulir-perrun-kol-valaikkum-ver-ranai-ppal-valai-kkon kunara Ninth Plate ; first side. 132 ppattu=ppor-Vandavar-madan=tavirkkun-Karavandapurattavar-ku[la-t]topral mav=en133 dun = kadar - rapai - Muvendamangalapperarai(ya]n - agiya Vaidyaka-sikhaman! Maranga - 134 ri [ll] I-ppiramadeyam-udaiya Korkai-kilan Kamakkani Suvarad-Jingan i135 dana! mupril-onrun-tapakku vaittsirandu-korum aimpadinvar Brahma136 narkku nirod-atti-kkoduttap [1] Idanu! Murtti Eyinap savai[y]od-o 137 ttadu nang-arai-ppalagaram-udaiyapa [19] Idapat=tapakku vaitta oru-kufrilu. 138 n=tambimarkku nangunutan-chirrappanar-makkalukku arum sa139 bhai[*]od-otta padagaran=koduttap [*] I-pprasasti padina Senapa. 140 ti Enadi a[y]ina Sattan-Chattarku mupru korsarum-ayat141 tangalod=otta nangu padagara;=koduttar | Ninth Plate; second side. 142 Asits - Mangalardjo Madhuratarah sastravit-kavir-vvagmi[l*] ajnaptir=asya Vaidyah Karavandapur-.143 dhivastavyah 2 [18] "Ratshan-narah parakritau vidadhita vidvan=pada hi Dharmma yasasah para144 masys labdhash"] [18] Dhatr=aiva Trashtam-akhilam bhuvanan=tath-api ratshantri punyaratayah 20prathivin=narendra[h] || [19] !! 145 Na hi bhumi-pradanad=vai danam=anyad-visishyato [lo] na ch=api bhumi-haraydt papa146 m-anyad-vidhiyate 2 [20] Data das-anugrahoatill yo harodadasa banti cha [1] atit-anagata * Read & Kanga. 2 These two syllables are written over an erasure, * Read vikalas. . For the ornainental form of the punctuation, see Plate. Read Asins, . On the use of tsha for ksha, see above, p. 1. * Read erishfame. . Read bhunanan. . Read Onti. 10 Pead pri'. ! Read gri,
Page #335
--------------------------------------------------------------------------
________________ 301 148 m 1.7 ni-ha kulani kula-nandana 2 [21] Sva-dattam vasundhara [*] na tasya Bahubhir vvasudha EPIGRAPHIA INDICA. 149 datta bhujyate h[i] tasya ta [VOL. XVII. para-dattam va yo hardta [na]rakat-ghorad-vidya nishkritih kvachit 2 [22*] Staradhipaib [*] yasya yasya yada bhim[i]s=tasya chatvarah ime Vaishnave Dharme slokah ||3 150 da phalam [23] 151 Marr-i[da] pai-kkattar malar-adi en mudi mela enru korravaney pani152 tt-aruli-tterrena-ttamra-sasanan-cheyvittan - Iyd-eludi 153 na Suttakes ri-pPerumpapaikarapukku perumakkal aralar-perra 154 du or oru illa-valavam iraudu ma-chchey [y]um oru punchey [y"]u155 m perran ivai Yuddhakesari-pPerumbanaika[ra*]p-eluttu [II] Tenth Plate. TRANSLATION. (Verse 1). Hail! May Siva, whose head ornament is the cool-rayed (moon), who is the (primeval) cause for the cessation of the sufferings of the devoted, who is beautiful with matted hair of golden hue, and who orushes the mischievous pride of Kandarpa (Cupid), grant you perpetual happiness. (V. 2). May the line of Pandya kings, the cause of rest to (the serpent) Sesha who is fatigued by bearing the burden of the Earth (on his heads), prosper on this earth to the end of the kalpa. (V. 3). Victorious is the race of Pandya kings, the mine of prosperity, whose family priest is the sage (Agastya) born of the pitcher, who stopped the rapidly growing mountain from (further) growth, and drank all the water of the ocean. (V. 4). There was (ruling) at the entrance into the sea a king famed for his matchless prowess, named Pandya, who, even after the three worlds had disappeared at the end of the kalpa, was requested again to rule the worlds by the Creator who created (these) anew, and was born as the splendid son of the moon and named Budhs. (Vv. 5 and 6). His son was Pururavas, who crushed the kings of giants by the strength of (his) arm; in his family which had engraved the pair of fish (its crest) on the topmost rock of the lord of mountains (i.e., Mera); whose (kings) shared with Sakra (i.e., Indra) half of his throne and his necklace; which was the asylum of the universe; which was the husband of the carth; which was everlasting; which in battles defeated completely the powerful enemies of the gods; whose messengers were the gods; who stirred and churned the milk ocean by the mountain (Mandara); the crowning ceremony (of whose kings) was performed by the hand of the pitcher-born (age Agastya); and which had filled the eirole of the earth with supplicants whose hearts were gladdened by the granting of their desires, was born the glorious king Maravarman, whose virtues were praised by the three worlds. (V 7). Bearing on his big serpent-like shoulder the whole circle of this earth, he removed the fatigue of the lord of serpents (ie., Besha), (which had been caused) by the carrying of the earth for a long time. Read rakad= 2 Read dha. For the ornamental form of the punctuation, see Plate.
Page #336
--------------------------------------------------------------------------
________________ NO. 16.) VELVIKUDI GRANT OF NEDUNJADAIYAN : THIRD YEAR OF REIGN. 305 (V. 8). He, the patron of the learned, conquered enemy crowds in battles and ascended the scales ; came out of the nectar womb (of the cono); and according to rale, gave away heaps of gold? (V. 9). His son was the king called Ranadhira, whose prowess was equal to that of the youthful sun and who bore the burden of the earth as sportively as his ancestors wore the necklace of (Indra), the chief of the gods. (V. 10). His son was the glorious king named Karavarman, << counterpart of Purandara (Indra); the dear lord of the beaatiful lady, earth, whose pair of feet WAS surrounded by the collection of gems in the crowns of all kinge bowing in obeisance; whose friend was truth; whose wealth was prowess; the lord of the goddess of prosperity (Padmana); who was an ornament of learning and good conduct and a depository of mored knowledge. (V. 11). That lotus-eyed Rajasimha, the king of the whole earth, driving away the fear of created beings on earth, ably protected the earth anopposed (after) destroying the allied enemies. (V. 12). "Is he Nara (i.o., Arjuna); is he & giant ; is he Hara (i.e., Siva); is he the Primeval Man (Vishnu); is he sakra (Indra) come with anger ?" thus thinking of him, in the battle-field, the frightened king Pallavamalla runs away (from him ). (V. 13). Who being made to be born of the womb of the golden (cow) and having again ascended the matchless scales, was freed of (his) sins and showered freely (his) wealth on Brahmans, beggars and temples. (V. 14). This (king) Maravarman unitably married the daughter of the Malava king of high birth; and from her was born, for the good of the world, (the ling) namad Jatila almost equal to Skanda the son of Siva. (V. 15). That king of great strength ruled the earth clearing it of (all) associations of corruption; the footatool of his lotus feet was worshipped by the great lustre proceeding from the game on the growns of prostrating kings. (V. 16). I imagine that he lent (his) virtues to the Krita (golden age); (he lent) to the celestial tree its nature, from his hands; to the subjects who bought refuge (in him), his promise of protection; and to the enemy kings on the battle-field, heaven. (V. 17). May he be long glorique on earth, king Parantaka, the son of Rajasimha, whose commands are borne on the crowns by rulers of earth. (L. 30). This praiasti was composed by Yarodayabhafta who was a performer of all sacrifices (Sarvaknatwydjin). (L. 81). Napkorran, the headman of Korkai, who never transgressed the path of the Srutis as interpreted by the highly learned (men) of the division called Pagantr-kurram, #well-watened land of extensive paddy fields, where the beetlas buzzed on cool buds in groves blooming with the Naga and the mango (trees),-being desirous of completing & (Vedic) sacri. fice begun (by him), through the favour of) the Adhiraja of the Pandya onlled Palyagamud ukadumi-Peruvsludi, who dispersed the crowd of the enemy kings by leading numbers of ferocious elephants (againat them), the kelus-Brahmanas, in presence of the king) saying These are the gifts which kings are expected to make on their coronation or on obtaining conspic aous victory in battles. They were also expiatory in character. See below, v. 13. The nature of the celestial tree is to give whatever is wanted and the hands of the king were giving away gifts on a very liberal scule. To give enemy kings heaven means to fill them on the battle-field and by so doing to send them to heaven.
Page #337
--------------------------------------------------------------------------
________________ [VOL. XVII. "Please hear (O king)" explained the petition (of Narkorran), stood in front of the sacrificial hall and blessed that spot to grow in prosperity under the name Velvikudi.1 (L. 38). The king at once gave it with libations of water and it was since long (80) enjoyed. (L. 39). Then a Kali' king named Kalabhran took possession of the extensive earth driving away numberless great kings (adhiraja) and resumed the (village mentioned) above. 806 EPIGRAPHIA INDICA. (L. 40). After that, like the sun rising from the expansive ocean, the Pandyadhiraja, named Kadungon, the lord of the South of sharp javelin who wore (the cloak of) dignity and was the leader of an army, sprang forth, occupied (the throne), spreading round him the brilliant splendour of (his) expanding rays (prowess), destroyed the kings of the extensive earth surrounded by the sea together with (their) strongholds and (their) fame, wielded the sceptre (of justice) and removed by his strength the evil destiny of the goddess of Earth whose splendour deserved to be under the shade of (his) white umbrella, by terminating by his strength the possession of her under others and establishing her in his own possession in the approved manner and destroyed the shining cities of kings who would not submit to him. (L. 46). Then came his son Avanichulamani Maravarman, who removed the common ownership of the earth (by making it his own), who was wedded to the goddess (born) of the flower (i.e., Lakshmi), the leader of a faultless army of fighting spearsmen, and the infuriated elephant who destroyed by all (possible) means the power (of enemy kings). (L. 48). Then came his son, a lovely one and incomparable, the just ruler, Seliyan Vanavan, Sendan, the lord of the hill-chiefs who throw weapons (dexterously), who removed the spot from the goddess of the earth, who became well known by his prowess and who possessed long hands (holding) the bow, and furious elephants. (L. 51). Then to him (was) born, a son, Arikesari, Asamasaman eri-Maravarman. whose high jewelled crown was adorned with ornamental hangings; who, like the brilliant Sun from the middle of the eastern mountain, came out spreading his rays, causing the quarters to tremble; won the battle at Pali by driving into the field of battle caparisoned elephants; conquered the ocean-like army of Vilveli" in the battle of Nelveli; destroyed the Paravas who did not seek refuge by approaching him; annihilated the race of the people of Kuru-nadu where crowds of beetles abounded on all sides; won a victory at the battle of Sennilam by driving into battle (a herd of) elephants of strong trunks; conquered many a time during the day, in the terrible battle-field of Puliyur of strongly fortified walls, the Kerala (king) whose matchless sway (extended) over the whole earth together with (his) near relations and their clephants and captured them alive?; marched against, attacked and destroyed unopposed the sea of weapons, and the high mountains (of that country); performed many times on earth (the gifts called) hiranya-garbha and tulabhara, and gave (the same) with pleasure to Brahmans and the infirm inviting them to come and assemble. 1 In blessing it, they actually suggested that the king might grant the village to the Brahman Narkograp under the name Velvikudi. Mr. K. V. Lakshmana Rao, M.A., has suggested in an article entitled The Kopparam Plates of Pulakesin II, contributed to the Annals of the Bhandarkar Institute, Vol. IV, Part I, pp. 48 to 54, that Kali-kula occurring there in text-l. 8 is possibly a reference to the Kalabhras. He seems to be right; for the phrase Kalabhran=ennun= Kali-araisag in l. 40 of the Volvikudi Plates properly translated means 'a Kali king named Kalabhra.' Tiravidin is interpreted by Pandit R. Raghava Aiyengar of Ramnad to mean by his strength." As usual this spot of the earth is her being in possession of kings other than himself. Dr Winslow gives under vali, the phrase valittonral in the sense of a son." Dr Krishnaswami Aiyyangar holds the view that Vil-veli means a hedge of bows,' but here it must refer to a nume. 1 The word -igavamai is explained by Pandit Raghava Aiyangar of Ramnad to mean ' in a moment.'
Page #338
--------------------------------------------------------------------------
________________ No. 16.] VELVIKUDI GRANT OF NEDUNJADAIYAN : THIRD YEAR OF REIGN. 207 (L. 62). Then came) his son King Sadaiyap, the lord of Kongas, whose javelins were Jong, brilliant and destructive, who was (also called) Tennap Vagavan, Sembiyan, solan,' king of kings, the beautiful Karunatakan, who with the victorious javelin in his right (hand), fought and destroyed the glory of the ocean-like army that came forth at Merudur and captur. ing Ayavel, attacked and destroyed him completely gained victories in battles at Sengodi and Pudagkodu and brought his (i.e., Ayavel's) anger to an end ; at the great city called Mangalapura, where the peacock danced with the cuckoo near tanks perfumed with opening flowers, attacked and destroyed the Maharathas ; removed the word "common property " (with reference to the country (bordering) on the roaring sea ; administered justice tempered with mercy and ruled the earth with love,'having reached the slopes of the high and permanent mountain (Meru) and cut on the broad face of it the bow, the tiger and the fish. (L. 71). Then came) his son Ter-Marap (i.e., Mafan of the horse-chariot) the king of kings, a member of the Pandya (Tepnavar) family, the proud possessor of the white parasol, who in order to acquire the goddess of the earth, carried in his right hand the awe-inspiring javelin and driving (forth) mast elephants (into the battlefield), defeated straightway at Neduvayal his opponents, who had rushed in great haste (against him); suppressed the rage of those whose minds were filled with anger (against him), at Kurumadai; destroyed the power of (the enemies) who confronted him at Minnikufichchi and Tirumangai; saw the backs of the insubordinate (chiefs) who advanced towards him with an ocean-like army, at Puvalur; captured the fiery steeds, the black elephants and the sharp missiles of enemies at Kodumbalur which had high ramparts and deep trenches (round it); deprived the splendour of the Pallava (king) ........ at Kulumbur and took numberless huge elephants and horses; humbler at Periyalur the greatness of those who had come to cut him asunder not bearing (to see his greatness); crossed the Kavici (with its) groves (of trees) and tanks of budding flowers; subjugated M919-Kongam with (the help of his) beautiful long bow ; proceeded and reached Pandikkodumiti of high fortifications, beautiful with the lastre emanating from brilliant gems; prostrated at and worshipped the lotus feet of Pasupati (Siva); gave away with great pleasure heaps of gold and lustrous gems; contracted relationship with Gangaraja, who wore garlands of sweet-scented flowers; and performing on earth countless (gifts of) Gosahasra, hirinyagarbha and tulabhara, relieved the distress of the Brahmanas) who studied the Vedas; renewed the palaces and the high ramparts of the capital towns) named Kudal (i.e., Madura), Vanji (Karir) and Koli (Uraiyar) and ruled the whole earth (bounded) by the roaring ocean. (L. 88). Then (came) his son Nedun jadaiyan, the king of the Neriyar (i.e, the Cholas), who wore) a high crown covered with flowers and gems, who kept (his) council secret, who was respected for his virtues (and possessed) an army of battalions (as extensive) as the rising noisy ocean, who was afraid of (committing) sins, who had no wants, who was the lover of the learned (Panditavatsala), death to his enemies (Parantaka), a Partha (i.e., Arjuna) in (wielding) tie bow, clever in his designs, cruel to the wicked, the enemy of the Kali (age) (Kalippagai), the performer of noble deeds, the abode of mercy, a Kinnara in music, firm as mountain, the smasher of heroes, he who equalled Manu, whose commands were obeyed, who was strong as 1 The king having conquered the Chera and the Chola, apparently appropriated their crests also, vie., the bow and the tiger and their titles Vanavan, Sembiyan and Solan. The woni zyennamai is translnte: tentatively. * Sen-godi and puda-koffu may have to be interpreted in the sense of brilliant flag and brand new drain.' (?), whics perhaps were the boast of the Ayave. . 1.e. made it a!l his own. . We must understand after eum, some word like nagarahgalin. But it is also possible that mada-mamadol is & recognised term (rudha-nama) for a capital town with palaces and fortifications of the term as it occurs in l, 104. 2 V
Page #339
--------------------------------------------------------------------------
________________ 808 EPIGRAPATA INDICA. [Vol. Xvit wind, the foremost of the valiant, master of heroism, renowned for good behaviour, free from () blemish, Punappaliyag, Sinachcholen, Srivara, the paramour of Srt (ie., Lakshm), the Teppan (.e., Pandya) and Vanavap (i.e., Chera) whose long hand holds the bow and whose one word (of command) was accepted by the earth (bounded by) the noisy oh, who appeared in the form of Vishnu with victory thrice-told , protecting the earth under his cool white umbrella, well praised by the goddess of the flower (i.e., Lakshmi), the goddess of the earth and the goddess of the tongue (i.e., Sarasvati); who began his rule 60 brilliantly that the strength of the lord of Kali was weakened; who, in the battle of Pennigadam (stroended by) an expanse of water and flowery groves and situated) on the southern bank of the Kavori of blooming flowers and well-watered paddy fields, defeated the Kadave (loing), who inconsiderately came and attacked him) with his four-fold big army spread on all sides of the extensive earth girt by the black ocean, and drove (him) into the forest; and who crushing and driving in a fierce battle the Aye-Vel and the Kurumbas that came and attacked (him) in great numbers, advanced with fiery spears and gained a victory over them in a battle et Natukkurumbu (i.e., Kurumbu-nada) (80 that they) sought shelter in forests for: (their) fortifications. (L. 103). While the third year of the reign of this (king) was current, one (partioular) day bystander of Kudal (i.6., Madura) (the city of) Mansions and high ramparts, having cried ont (by way of complaint)', the king himself at once called him mildly and was pleased to ask him first " what is your complaint." The bystander submitted thus "Oh! Mighty king of powerful army! Formerly without swerving from the pure (path) prescribed by law, (the village) called Velvikudi included in Pagapur-kurram, whose flowery groves touched the sky, was designated Velvikadi and was granted through the kelvi (Brahmans) by your ancestor, the great lord known as Palyagamudukudumi-Peruvaludi, who protected (the earth) girt by the ocean with an army of spearsmen who never miss their aim). It has since been resumed by the ignoble (yet) ooean-like army of the Kalabhras." The king gently smiled and said: "Very well, very wen, prove your antiquity of the gift) by (a reference to the district (assembly) and receive (it Maak)." He (the supplicant) proved then and there, the antiquity of his claim) by (a reference to the district (assombly). Thereupon the powerful king, of long arms holding the bow, being overjoyed was pleased to declare "what was granted formerly by my ancestors according to rule, is also granted by U," and so saying he, of (many) chariots and ocean-like army, gave (it) with libations of water to Kamakkani Narohingap, the headman of Korkai. (L. 118). The four big boundaries of this (village given in full detail are :-(The eastern boundry is) to the west of the boundary of Nagarur surrounded on (all) sides by faultless flower. gardens. The southern boundary of this is to the north of the field (called) Kalyandai-sey of Kulandevan and of the banyan tree in the Kalandai-pond. The western boundary of this (io) to the east of the mound (peruppu) on the western side of the field (called) Odumaiyiruppai-soy of the faultless Korrapputtor. And the northern boundary of this (is) to the south of the mound on the northern side of the village of) Payal where lotuses grow in canals. (L. 124). The land included within the four big boundaries thus described is also given away by us, inclusive of kara mai and miya_chi, in the same manner as it had been given formerly by our ancestors. (L. 126). The dpatti of this (grant) correctly described is Yadavikalap, Mirangari, the crest-jewel of the Vaidyaka family entitled Movendamangalappararaiyap who was favoured by the king of kings, whose army fought powerfully like a thunderbolt, in battles where See foot-note 1 on p. 807, above. korrrr muunnnrruttnnniymp cork not kntilactorily integrated. I have taken &krodik ba to stand for thiths from south with No prefr a se Naiakshake . 1, v. 81, where a-kruidata is explained cried out in order to expor a mistake committed.'
Page #340
--------------------------------------------------------------------------
________________ No. 16.) VELVIKUDI GRANT OT NEDUNJADAJYAN : THIRD YEAR OF REIGN. 909 machines shaped like wild hogs (onapport) killed (the enemios) in (close) fight with (drawn) swords when the kings of the east (Porvarajar) possessing clamorous battalions of fighting mea rose up, and put to flight with great) loss in an infantry attack at Venbai, the Vallabha of a vast army of archers, on the occasion when the excellent daughter of Gangaraja who wore #garland of highly scented flowers (dribbling) honey was secured and offered to Kongarkop (i..., the Pandya king)', who was a prince of the race of Karavandepurattavar, who posressed powerful and big army that crushed the pride of those who came to fight being thither) brough, together by (ie, under the leadership of) kings wearing many bracelets and possessing an army of spearsmen who wielded deadly weapons. (L.)34). Kimakkani Suvarap Singap, the headman of Korkai, who owns this brahmadaya reserving for himself one-third of this village), gave the remaining) two parts to fifty Brikmapas with libations of water. In this are included the four and a half padagoras (of land) of Marti Byinin approved by the (village) assembly. And in the part reserved for himself in this (village) he gave with the approval of the (village) assembly four padagaras to his younger brothers and six padagaras to his younger paternal uncle's children. And the owners of the three parts with their united approval gave four padagaras (of land) to the general (Senapati) Anadi alias Sattan Sattap, who composed this eulogy (prasasti). (V.18). The ajnapti of this document) was Mangalargja, the very sweet (madhuratara) poet (kavi) and orator, well versed in the sciences, & Vaidya and a resident of Karavandapura. (V. 19). Oh! Dharma! A (learned) man must render protection to the deeds of others. Indeed these are the feet acquired by (i.e., on which stands) great fame. The world was all created by Dhatri (Brahman). Still kings desirons of merit protect the earth. (V. 20). No gift is greater than the gift of land; nor is there a greater sin enjoined (on man) than that of) resuming land (already given). (V. 21). Oh! Gladdener of your l'ace! He that makes a gift on this earth blesses (his) ten generations past and future, and he that takes away (that which has boon given) destroys ten generations past and future. (V. 22). To him that robe land given by himself or by others, there is no expiation anywhere except iu the dreadful hell (V. 28). Lands have been given away by many. Different kings are ruling (them). The fruit (of protection) belongs to him whose land it happens to be (at the time). These four are verses in the Valhar. Dharma (L. 151). "The flower-like feet of those who protect this charity) shall be on my crown." The king himself was thus pleased to say and caused a copper-plate grant to be executed at opoe. (L. 152.). Sattskokari-pPerumbanaikkaran who engraved this document), and to whom were allotted through the favour of the great men (of the village) one house site, two ma of (spot) field and one dry field received the aboda). This is the signature of YuddkakeartPerumbana ka[ra]. See shore, p. 807. If we took Kongeloop w referring to the king of the Longes, the w o tor Marburi taking part with the Kogu king will have to be explained. So far as we know, the Kohga kirg ww An caemy of the Pin:ys and was on several occasions obed by him. I The word pidime that the composition wwa la voru Perhaps the mo. 2u ?
Page #341
--------------------------------------------------------------------------
________________ 310 EPIGRAPHIA INDICA. [VOL. XVII. No. 17-THE NALANDA COPPER-PLATE OF DEVAPALADEVA. BY HIRANANDA SHASTRI, M.A., M.O.L., OOTACAMUND. This copper-plate was unearthed by me at Nalanda during the course of my archeological explorations of the well-known Buddhist site there in 1921. As I have already stated in my annual progress report for the year 1920-1921, where1 I have given a tentative account of the document, the plate was found in the antechamber of the so-called monastery B which has yielded many interesting antiques testifying to its past glory. The debris round it and its encrustation showed that the plate must have suffered from the conflagration that destroyed the building in whose remains it lay buried for so many centuries. Fortunately, it has escaped destruction, and excepting a slight injury here and there, the whole of the record together with its seal is practically intact. It has been very carefully treated by the Archeological Chemist and has now become fairly readable. The plate bears forty-two lines on the obverse and twenty-four on the reverse, each measuring about 1' 4" long, excepting the last line on the second side which is only 4" in length. The inscription is written in early Devanagari script and its language is Sanskrit. The formal part of the grant which it registers is in prose and the rest is in verse, excepting the words om svasti and tatha cha dharmanusansanaslokah, written at the commencement of the first and the second.. side respectively. The seal, which the accompanying fac-simile illustrates, is soldered to the plate and bears the legend Sri-Devapala devasya meaning "of the illustrious Devapaladeva ", written below the emblem of the dharmachakra placed between two gazelles as in the seals of other Pala kings. The wheel or dharmachakra symbolizes Gautama Buddha's unfolding the Law and the diffusion of knowledge to the world that was groping in darkness and the deer refer to the Mrigadava forest which is now represented by Sarnath near Benares where the 'Great Sage' turned the wheel' for the first time while delivering the great sermon to the five monks or 'Panchavaggiyas'. That the Palas adopted this symbol is but natural for we know that they were staunch Buddhists and patronised learning. The introductory portion of the inscription, consisting of the first twenty-five lines, is identical with the similar portion of the Mungir (Monghyr) copper-plate grant of the same king that has been edited by the late Professor Kielhorn. It enables us to remove the few doubts the said scholar had in his reading of the record. As is shown by the dates given in the two documents, the Nalanda grant is posterior to the other by some six years though both were issued from the same place, viz., Sri-Mudgagiri-samivasi-srimaj-jayaskandhavara or the victorious camp at Mudgagiri, the modern Monghyr in Bihar. The inscription was written and engraved with considerable care; still a few inaccuracies are to be noticed in it. These have been pointed out in the footnotes added to the text below. As regards orthography, it resembles very much the other grant from Monghyr and there is, perhaps, little to be added to the remarks which Kielhorn made about it while editing the latter document. As to his statements that "the only passages about which I am at all doubtful, and in which the rediscovery of the plate may prove me to have gone wrong are the words suvinayinah in line 5; rajakuliya-samasta in line 40 and karahiranya in line 45",-on the authority of this epigraph, I may say that his reading suvinayinam should be treated as wrong though the translation is right. This plate gives sati kritinam which must have been 14. R. Central Circle, 1920-1921, rp. 87, Ind. Ant., Vol. XXI, pp. 253-258, Ibid, p. 253.
Page #342
--------------------------------------------------------------------------
________________ No. 17.] THE NALANDA COPPER-PLATE OF DEVAPALADEVA. 311 the reading in the other document also, the sense being that as this king furnishes a living example people have to believe in the bistorical reality of the ralers like Prithu, Sagara, eto. The remaining two words, as is shown by this plate where they occur in line 35 and line 42, respectively, were correctly read by him. The charter was issued by the devout worshipper of Sugata or Buddha, the Paramesvara Paramabhattaraka and Maharajadhiraja, the illustrious Devapaladeva, the son aud successor of Dharmapala, who is regarded to have been the most powerful of the Pala kings of Bengal. As I have just stated, its introductory portion is identical with that of the other grant and gives the genealogy of the donor which has already been discussed by scholars. The formal part of the grant, which the inscription registers, is worth considering. The wording is the same as we find in the other document. The officials mentioned are also similar, including the " Pramati" and the "Sarabhariga ", excepting the Prantapala" who is left out, though the order in which they are named is different. Amongst the names of the countries mentioned in line 35 of the Mungir (Monghyr) plate, this inscription puts Odra in place of Gauda and omits Lata altogether. Herein we are told that Devapaladeva at the request of the illustrious Balaputredevs the ruler of Suvarnnadvipa, made through an ambassadoz, granted five villages, four of which lay in the Rajagriha (Rajgir) and one in the Gaya vishaya (district) of the SriNagarabhukti (Patna Division) for the increase of merit and fame of his parents and himself for the sake of income toward the blessed Lord Buddha, for various comforts of the revered bhikshus of the four quarters and for writing the dharma-ratnas or Buddhist texts (i.e. for the three jewels) and for the upkeep of the monastery built at Nalanda at the instance of the said king of Suvarnnadvipa. The endowment, being entirely Buddhist, forms a distinctive feature of the grant and amply justifies the epithet of parama-Saugata applied to the donor. The four villages granted in the Rajagriha vishaya wero .Nandivanaka, Manivataka, Natika and Hastigrama and the one in the Gaya vishaya was called Palamaka. As is usually the case in such grants, this part of the document ends with the date of the endowment which is the 31st day of Kartika of the (regnal) year 39 and is written after the orders of the royal donor demanding regalar payment of all the revenues due for the purposes noted above. The second side of the plate first gives the well-known imprecatory and benedictory verses and, thereafter, introduces Balavarmman who acted as the dataka in this meritorious undertaking' and whom it describes as the overlord of Vyaghratati-mandala, ever ready to fight his foes indepondently.' Evidently he was the official of the King of Magadha entrnsted with all arrangements to be made in connection with the grant. Then the inscription supplies, though unfortunately too meagre, an account of Balapatradeva, the king of Savarnnadvira at whose instance the endowment was made giving, also, some information regarding his ancestry. It is mainly in this connection that this document is specially interesting and possesses considerable international value. We learn that the dynasty to which Balaputra belonged was that of the gailendras, who wore Buddhists and held the island of Java under their sway about the eighth century of the Christian era or the Saka year 700. The latter fact about the Sailendras is already known from the Kalasan inscription which has been published by Dr. (now Sir) R. G. Bhandarkari and Dr. J. L. A. Brandes. But this Nalanda copper-plate introduces to history for the first time sri-Balaputradeva, the Sailendra King of Suvarnnadvips together with some of his relations, as well as the dutaka (of the grant), namely, Balavarmman. The illustrious Maharija Balaputradeva, our inscription tells us, was the overlord of Suy. arnnadvips. His mother was Tara, the daughter of a King Dharmasetu of the lunar race and Journal of the Bombay Branch of the Royal Asiatic Society, Vol. XVII, Part II, for 1887, Art. I. The Tydsorift voor de Taal,-Landen Volkenkunde van Nederlandsch India, XXXI (1886), p. 20..
Page #343
--------------------------------------------------------------------------
________________ 912 EPIGRAPAJA INDICA. (VOL. Xvit, the queen consort of she mighty king who was the son of the renowned ruler of "Yavabhumi." The latter, we are told, was the ornament of the Sailendra dynasty and his name we conform able to the illustrious crusher or tormentor of bis brave enemies'. Though the epigraph gives high praises for all these rulers, yet it contains no other information regarding their identity. The nume of the father of Balaputradeva is not given at all but the name of the grandfather is said to have been something like Sri-vira-vairi-mathana', meaning the illustrioas destroyer of heroic foes'. This would lead us to surmise that the name must have been one like Param arddi-deva, Satrassjaya, Arimarddana, Arindama, etc., but what it really was I am not in a position to find ont. The Yavabhumi and the Suvarnnadvlpa are evidently identical with the Yavadvipa and the Suvarnnadvipa islands spoken of in Sanskrit works like the Ramdyanal or the Kathasaritsagana and are unquestionably the modern Java and Sumatra. While speaking of Balapu tradeva as the king of Suvarnnadvipa and his gravidfather as the ruler of Yuvabhami, the author of our inscription, apparently, took both the islands as one considering them practically united. As M. Duroiselle kindly tells me, the consensus of opinion, arrired at by scholars like Barth and Kern, is that Suvarnandrips and Yaradvips are the same, that is Java-Sumntra. The doonment goes to confirm the view that Yavad Ipa is Juva proper and that Suvarnnadvipa is properly Sumatra. This Suvernnadvipa, however, is different from the Suvaranabhumi, which, as M. Daroiselle has kindly informed mo, in its most extended sense refers to Indo-China, but, particularly, to the country extending beyond the eastern and northern coasts of the Bay of Bengal or Remannadesa (i.e., lower Burma). Now the question which would present itself for solution is, who were the Sailendras mentioned in thu plate ? There are only two Javanese inscriptions in Nagart, known to me, which were issued by a king of the Sailendra dynasty. One of them, to which I have alluded above, commemorates the foundation of a temple of Tura, the well-known Goddess of the Mahayana pantheon, the setting up of her image, and the building of a monastery in the year 700 of the Saka era during the prosperous reign of a king of this dynastys whose name to our regret is not forthcoming. The other inscription is not yet published and the following information regarding it I owe to the courtesy of Dr. Bosch, Director of Archaeology in Netherlands-India. It comes from Klurak, a site between the Prambanam and Sewu-temples in Central Java and belongs to the Saka year 704, the object being to commemorate the erection of an image of Manjuri, another noted divinity of the Mabay na pantheon. In one of the lines of this inscription Dr. Bosch reads: rajna dhrita dhritimata dharanindrandmnd and finds the king's name to be Indra, though one could take it to be Dharanindra (earthly Indra) as well. Yet another inscription I know of, which is connected with this evasive race of the Sailendras, comes not from Java but from India and, like our Nalanda inscription, records the erection of a monas tery and an endowment for it. It is engraved on twenty-one copper-plates now preserved in the Leyden Museum in Holland and belongs to the reign of the Chola King Rajaraja-Rajakesarivariman (985-1013 A. D.). This highly interesting document telle us that the illustrions king Maravijayottushgavarmman of the Sailandra dynasty and the lord of Srivijaya caneed to Canto IV, Chap. XL., St. 30, and the IVlaka commentary on these verses. Here we find that Java in remote antiquity formed a large principality which counprised not less than seven minor states Tarunga, 67; Str. 98, 134, 173, etc. ital GT : Rouge fag , Dr. Bhandarkar read in the sixth Mine of this inscription Sailindra. varmatanujanya and thought that Sailandrararwin was the proper name of the father of the donor whose name be took to be Panamkaraya. The correct reading, however, as the late Dr. J. L. A. Brandes bas shown, must be Saiiandra va mafutila kaaya. Except these two inscriptions there exists a number of fragments of inscribed slabs, which recording to Dr. Poach, night be attributor to the Sailendra Tuce but they are all too weather-worn to be deciphered. Dr. Haltsach takes Sir Vllaiya of Tamil Sacriptions as the equivalomb of Sri Vishaya (alors, Vol. IX, 1.231),
Page #344
--------------------------------------------------------------------------
________________ No. 17.1 THE NALANDA OOPPER-PLATE OF DEVAPALADEVA. 313 bo built a lofty and very beautital monastery at Nagapattana, the present port of Negapatara1 and that it was endowed by the Chola king Rajaraja, thus farnishing an exact parallel to the N hands monastery of our plate. This Srivijaya is the same as the Ban-fo-tai of the Chinese Annals and, acoording to M. George Coedes, must be identified with the kingdom of Srivijaya or Palembang, which is a residenvy of Samatra, The Leyden gnat says that Maravijayottangavarmman was the overlord (adhipati) of Srivijaya who, while extending the kingdom of Katkha, caused that monastery to be beilt in the name of his father. Thus on the authority of this invaluable record it becomes clear that, about the end of the 10th century A. 1)., Sumatra was governed by the Sailendra dynasty to which king Wirevijayottuagavarmman or his father Chademanivarmman belonged. That both Sumatra and Java were under the sway of the Sailandras about the ninth century we glean from the Nalanda copper-plate inscription. That they were governed by the same dynasty in the seventh century of the Christian er we learn from the two inscriptions to which I have referred above, In one of the inscriptions engraved on the south wall of the well-known temple at Tanjore we find that Rajondra-Chola caught a king of Kadaram, named Sangramavijayottungavarmman, and took his vehicles as well as acoumulated treasure. This king of Kadarm in the light of the Leyden grant was, probably, the successor of Maravijayottungaramman, the Snilendra king of Srivijayi spoken of in it. If the Tanjore inscription is to be trusted-I do not think there is any reason why it should not be we can say thnt RajondraChota, while capturing the king, sacocoded in conquering the kingdom of Srtvijaya or Palembang. The Leyden platem telts that he confirmed the grant made by his father Rajaraja for the monastery built by the Sailendra king Maravijayottangnvart man or the predecessor of the very ruler whom he caught and dispossessed of heaps of troures. This would lead us to warmise that Sangramavijayottungavartman proved refmotory and the Chola King bad to take the extreme step to bring him roand. Here it may be romarked that in the documente, known at present, these Sailandrs or the rulers of Srivijaya aru ZIO where mentioned as the foudatories of the Cholas or other Indian kings. Building convents or pihanas in pre's territory does not necessarily indlonte tratelnge thonghe does show friendship or mutual regard. That the Sailendras founded monasteries in India at Nalandis or elsewhere certainly signifies their being ferpent Beddhists. These viheras, Kilce the one founded at Bodh Gaya by Meghavaron of Ceylon daring the Gupta epoch, gur shelter to their own people w well others. Devapiladovs was ostatnah Buddhist. He andowed the moonstery, which Bklepatrndert, the Japanese King, founded Nalanda, at the latter's express request, commanionted to him through s databa or ambasador. But this fact slope RROT imply that the ruler of Jaya was a pausal of the King of Magadhe. Though the capture of the King of Kadiram by Rajendra-Chola in later days indicates rabaision no doubt, yet I think, to show that the Sailendras were really the feadatories of the Cholas, proof is still wanting. Under the existing circumstances what we can safely usume is that the molations of these Kingo wote Mather based on trade and tradic and were of penseful nature. 1 It was probably this structure, which, as the late Mr. Smith has wid in bis Burly History of India, 3rd ed., 466, survived in a ruinous condition until 1867, when the remains of it were palled down by the Jesuit fathen And utilised for the construction of Christian buildings. The splendid content built by King Moghavangs of Ceylon at Bodb-Gay moat the holy Mdhidruma about the your A. D. 800 with the permission of Battdragapta, the Grant, afforda another hanteoop of this kid. For a brief spcount of it so Smith's Ancient History of India, S od., p. 387 Encyclopaedia Britannica, XI ed., Vol. XXVI, p. 73. For mention of Setrijaya In an old Malan bahoription probably of the 7th Century A. D., lately found in Palembang, mo Mh. 8. Yan Rynkeb's potice in the Aota Orienta. wia, Vol. II, Part I, p. 11. * South Indian Inscriptions, Vol. II, pp. 106 ft. . The late Mr. Venkayy (4.8. R., 1911-19, P. 176), apparently, youmed that the window wore fondatory o te Che King,
Page #345
--------------------------------------------------------------------------
________________ 314 EPIGRAPHIA INDICA. (VOL. XVII. That close relationship must have existed between Coromandel and the Far East dnring the earlier centuries of the Christian era is pretty certain. The part played by Tamaralipti or Tamlak as an important port in those days for the sea-borne trade between India and the Archipelago will similarly associate Bengal with the Far East. These Sailendras were staunch Buddhists to whom all the magnificent Baddhist buildings which we find in Central Java, like the one which probably contained the Tari image mentioned in the Chandi-Kalasen inscriptions spoken of above, owe their origin. Now, the question is whether they were emigrants from India or were indigenous people of Java-Sumatra, who embraced Buddhism in preference to Hinduism. The Yopa inscriptions of King Molavaraman from Koetei or East Borneo or other early epigraphical records, which have been brought to light from Champa, Cambodia or Indo-China by eminent French or Datoh savants, would show that India has had a considerable share in the colonization of the Far East. The Yupa inscriptions, as Dr. Vogel has already pointed out in his very learned brochure, inform us that the erection of the sacrificial posts on which they are engraved was due to the twice-born priests or Brahmans, who had carried their ancient civilization and religion to Borneo, as well as, to Java and Sumatra and that on these priests King Malavarmman conferred rich grants of gold and land; a fact showing that as early as about 400 A. D. high caste Brahmans or Vipras migrated to the Far East and settled there. Fa-Hian found Brahmans settled in Ye-poti (Java or perhaps Sumatra). Sumatran civilization and onltare seem to be of Hindu origin. Samatra was probably the first of all the Archipelago to receive emigrants from India. The names like Coliya, Pandiya, Meliyale, by which some of the tribes that have settled in Wert Sumatra are known, and the fact that emigrants from India are designated by the term Keling or Kling, which is clearly derived from Kalinga, would show that Southern India, including the Telugu country, had ample share in the colonization of the island or the Far East, as Dr. Vogel has already stated in his paper. The matrimonial alliance mentioned in onr Nalanda charter, which the father of Balaputradeva had with a mighty king of the Lunar race, would, perhaps, lead us to trace the origin of the Sailendras of Java-Sumatra to India. If & conjecture can be hazarded, these Sailendras were emigrants from Kalinga or say Southern India. I am not a ware if the term Sailendra was over applied to any of the dynasties which ruled iu the south or any other part of India. It will be going too far to convect it with the Snilavama or the Bailodbhavas or other dynasties like the Silabara having somewhat similar appellations. It may be pointed out, however, that the name of Malaiyaman, which is an exact Tamil rendering of the Sanskrit word Sailendra, meaning the lord of mountain or mountains, is to be met with in some of the inscriptions discovered in the South Arcot and Salem districts of the Madras Presidency where it is applied to some chieftains, who flourished about the 10th century A. D. Tamil literature, however, knows of the Malaimans, who might be attributed to the 7th and 8th centuries A. D. These chieftains were called Miladudaiyar or the rulers of Miladu, a contracted form of Malaiya-nadu or hill-country, and they claimed 1 The Yipa inecriptions of Kiny Yilatarman from Koetei (Kast Borneo), p. 202. Encyclopaedia Britannica, Vol. XXVI, p. 74. It inny be incidentally pointed out that the statement made bera in the Encyclopedia to the effect that Sumatra was called the first Java was caused by wrong realing, as I learn from Prof. Krom through Dr. J. Pb. Vogel, and requires correctiou. The Fipa inscriptions, etc., pp. 195-6. * The Late Mr. Venkayya (4.8. Ry 1911-19, p. 178) was inclined to connect them with some part of Orissa apparently on account of the similarity of Daines like Sailayanis and Sailendravamia, pp. 42 ff. For Ssilavamba, me Ep. Ind., Vol. IX, p. 288 and J. B. A. 8., Vol. LXXIII (1904, p. 2 282 f.) Rp. Ind., Vol. VI, p. 42. .Ibid, Vol. XI, p. 283.
Page #346
--------------------------------------------------------------------------
________________ No. 17.) THE NALANDA COPPER-PLATE OF DEVAPALADEVA. 315 connection with the Chedi family! It is also noteworthy that sometimes their names end in tarmwan? From the records noticed above we find that the names of the Sailendras of JavaSumatra or Srivijaya ended in varmman. The name of th, Sailendra ruler given in the Nalauda plate on the other hand ends in deva. This looks rather strange. The name Balaputza itself, signifying 'young son 'is curions. This ending of deva, however, occurs only in the prose and formal portion but not in the other or metrical portion, wbich describes and eulogises these Sailendras. This would go to suggest that the suffix was left out because the metre did not require it, or possibly b. caure, it did not form an integral part of the name and would have been replaced by varmman, a general suffix or surname of the ruling caste or the Kshatriyas. The name, however, is pure Sansk it as is the name of Tara the mother of Balaputradeva, or Dharmasetu, her father, and would point to emigration from India. Had the names of the two ancestors of Balaputradeva, that is to say, his father and grandfather, been given, we c uld be detinite in the natter, for, if tbeee names were un-Indian, as in the ca-e of Kunilinga, his son Asvavarman and grandson Mulavarman of Borneo, we could conclude that the Sanskrit names must have been taken after conversion to Binduism, cr ratber Buddbism. But in none of the names of the Sailendras do we find any foreign sound at all, suggesting that they were the na ives of the islands originally and came into the fold of Buddhista afterwards. The names of the Paja kings and other personages mentioned in the introductory portion of this grant have been dealt with by Kielhorn or other scholars in connection with the cuutents of the Mungir copper-plate inscription. So I need not notice them here. But, besides them and the Sailendras, our record speaks of two more persons and they require special mention. One of them is Dhermasetu whom the inscription describes as a scion of the Lunar race and the father of Balaputradeva's mother, namely, Tala. To our regret it does not supply any other particular regarding him and it is hardly possible to identify him or to say Mr. K. V. Sabrahmanya Ayyar, to whom I am indebted for this information, has kiudly given me the foilowing note on the Malaiyamars : * Ancient Tamil works mention tho names of a number of Malaiyaman chiefs, who might be attributed to the 7th and Sth centuries A. D. Some of these are :-(1) Malaiyoman Tirumudikkari, (2) Malaiyamas Siliya-nadi Tirokannay. (3) Maladar-koman Meypporn! Sayapar and Nurafinga Munniyarriyar of Tirumunaippidi. Their capital was Trakoilur, the bend-quarters of a taluk in the South Arcot district and a railway station in the Katpadi-Vilappuram section of the South Indian Railway. It is said to have been situated within the Chedi country. The Malniyaman cliefs appear to have been reudering belp to one or the other of the principal powers of the Bouth, ie, the Chera, Chola, Pandya and the Pallave. Narasingamunaiyaraiyar was contemporary of the Saiva saint Sundara-Murti-Nayanar. of the 8th centnry A. D.: he is counted as one of the canonised 63 Saiva devotees of the Tamil country. In the account given of No. 3, in the Tamil hagiology. Periyapurana figures a Tatton, whose name may be regarded as a variant of Datta. Besides, one of the poems of the Tamil authology, Pattuppaffu was composed in honour of a certain "Arya King Piragadattan (Bhriga-Datta)". It may be noted that the Malaiyamin chiefs belorged to the Bbrigu roce as is evidenced by their inscriptione Epigra, hical reference to Narasimhainnaiyaraiyar is found in the Tanjore inscriptions of the Chola King Rajaraja I (A. D. 985-1013). In an early stone record of Rajakerivaridan found at Tiravagosvsram near Kumbakonam, of about the 9th century A. D. mention is made of Miladudulyar-palli. It is interesting to note that the Inter members of the Malaiyanin family, who figure in numerous stone inscriptions, call themselves invariably Chediyariyas (C) e lira jas) and they are mostly sabordinates of the Chole of the 10 h to the 13th centuries A. D. The appellation Chidiyarayan, nuwed by almost all the chiefs, if it is not a mere accident, as it could not be, must indicate that they were the rulers of the Chedi country. This fact taken with the names like Datta would make one infor a colonisation at some remote past of a branch of the line of Chedi Kingy, in the South Arcot district, where we find them." * E. Hultzach, Ep. Ind., Vol. VII, pp. 185 and 145. Dr. Vogel in the aforesaid publication (page 194) remarks :-"Considering that among the dynasties of Indis proper there is a great varioty of sucb royal surnames, as aditya, gupe, chandr, dipapala, rafa, wardhana ha, and sing, the almost universal omployment of name in raroman in the Per Enelu certainly very romarkshle." The instance of our Balnputradeva will furnish an exceptiou.
Page #347
--------------------------------------------------------------------------
________________ 816 EPIGRAPBIA INDICA. [Vol. XVII. whether he was an Indian king or some ruler in the Far East. The name whether it is read as Dharma or Varma-retu appears to be new. The other interesting name occurring in the document is that of Balavarm man the ruler of Vyaghratati-mandala, who acted as dataka on behalf of the Magadhan king. As to why be was selected or what special connection he bad with the ruler of such a remote island as Sumatra or Java, and whether he had been there or known personally to that king our inscription makes no mention. Apparently, there was no direct political relationship between the two; for, we know from the Khalimpurl plate of Dharmapaladeva that the Vyaghratatimandala lay within the bhukti of Pundravardhana, which was under the sway of the Pals king Dharmapala and, evidently, of Devapaladova after him. Pundravardhana is the same as Paundravardhana-Pundra and Paundra being synonymous--which is the modern Rajshahi district of Bengal'. The use of the word adhipati would indicate that in this instance at least the term mandala connotes a larger area than Dishaya, which in the majority of cases seems to include a mandala During the reign of Devapaladoya, Vyaghratati was governed by a distinct ruler called Balavarmman. The way in which he is praised in this epigraph, as the right arm of the Emperor, would show that he had a high rauk even though he was one of the feudatories of Devapaladeva. As, however, our plato gives no genealogy or particulars about him his personality is very vague. A few homonymous rulers are known to have flourished about that time but they appear to be quite different personages and even their dates will not agree with that of this plate. It looks curious that though the charter mentions the dataka of the King of Magadha yet it leaves the ambassador or ambassadors of the Japanese King unnamed altogether. Tbe vagae manner in which the inscription describes the rulers of the Far East or Sumatra-Java and their relative king of the lunar race would show that its anthor did not kuow much of them. He knew of Bilapotradeva and his mother Tard. The latter he coropared to the goddess of that name. It is not improbable that the grant rogistered in the epigraph was made chiefly at her instanco. Oor plate mentions reveral places calling for remarks. Out of these, I have already noticed three, namely, Suuarumnadripa, Yarabhums, and Vyaghrataft. Of the remaining ones Kaland. is the most important. The way, in which this record speaks of it, would show that it continued to be as important a centre of Buddhist lore as it was during the time of Hinen Teang'o visit. The spelling of the name given in this document is Nalanda which is the torrect way of writing it. The same spelling is given in a votive inscription on the image of D. Inch, Vol. IV, PP. 248 ff. J. B. R. 4. S., LXIII (1894), PP. 89 ff. Smith Early History of India, p. 878. As has already been stated by Cunningham (4 8. R., Vol. XV, PP. 112 M.) Kantara 18 another name of Pundne or Paepdm, ie, garn, and the Mahakintans of the Allahabad bucription of Bamndragupta, the Great, ww probably an older name of this provinoo wbieb, about the middle of the fourth century of the Chrhulan ers, was governed by King Vy gbra. Thus it does not appear to be improbable that the district of Vydgaratan or the tiger's precipiorunlew of course wahre is taken in the sense of castor oil in wbich on the word Vyaghratani would be the slope marked or overgrown with castor planta, named after this tiger king. 1 This would rather show that Do mistako w made in the text of the Khalimpur grant sud tut Kielhorn's statement in the Ep. Ind., Vol. IV, p. 368, footnote 3 that it ww, will be obviated. "Por instance we know of Balavarman, the lord of Prigiyotinha (Gauhati or Assam) from the Nowgong copper-plate (Dr. A. 7. Hoornle, J. B. 4. 8. LXVI, pp. 886 11.) and another of Karusha or rather Brihadgriha (Klolborn; Iad. Ant. Vol. IX, pp 188). On palmogmpbis grounds the former of the two has been signed to the last quarter of the 20th century or may nearly one centary later than the date of Devapilader. The other too Hetle known to admit of identification. The third raler of the name, who will synchronise with our docu. mant, me the futbol Ayaatharmaa II, who wu the foudatory of Yahandrapila of Kansui (cir, 600 A. D.). To think Identity ug him with the Belawarman of the Naledi plate will be altogether areasonable, for be vw the role of Kathfaww, or Pannlicher and fondatory of the formidable rival of the monarch of Bengal
Page #348
--------------------------------------------------------------------------
________________ 317 No. 17.] THE NALANDA COPPER-PLATE OF DEVAPALADEVA. Sankarshana which was dug out of the same site and the newly discovered statue of Tara. It again occurs not only in some Jaina writings but such an old work as the Dighanikayas. However, it seems to be noteworthy that none of these works called Nalanda a university but only a prosperous town though Hinen Tsang describes it as if it were a University. The way in which it is described in our plate would'sbow that it was really a centre of Buddhist learning. As to the remaining place-names mentioned in this document, I think, Srinagara or Srinagara-bhukti inust be identified with modern Patna, which as a district, includes Rajagriba (Rajgir) and, as a division or commissionership, comprises the district of Gaya, even now. It is true that in the Khalimpur grant of Dharmapaladeva, which has been referred to above, the name given for the city is Pataliputra and not Srinagara or Nagara, still, I think, there were two designations, the one, viz., Pataliputra, which meant the whole town and the other, viz., Srinagara, the main part of it, like the Bankipore of to-day. Nagaia means the chief town generally, but in this case it meant the town, the prefix Sri implying prosperity or wealth of the town. In other words Patalipatra was the pattana and the seat of Government, especially in earlier days during the supremacy of the Mauryas or the Imperial Guptas, lay there, and Srinagara was its principal portion where the office of the bhukti or division was situated. One was concerned with the whole government but the other only with eight hundreds villages coming in its jurisdiction or bhukti. Thus Srinagara must have been a part of the whole which was termed Pataliputra. That, apparently, is the reason why the latter and not the former appellation of the town is to be met with in literature. That Rajagriha and Gaya are respectively the Rajgir and Gaya of to-day requires no demonstration. The latter is a district still, though the former has now dwindled into a ruined town of the Bihar subdivision of Patna. Regarding the villages which formed the object of the grant or endowment registered in the charter, we are told that Nandivanaka and Manivataka were situated in the Ajapura-naya subdivision, Natika in the Pilipipka, and Hastigrama in the Achala-naya or subdivision of the Rajagriha vishaya or district, and that Palamaka was situated in the Kumudastra vithi, a subdivision of the Gaya district. If similarity of sound can be depended on, I would propose the following identifications to which proximity of Nalanda will lend a great support. The Ajapura 'naya' or subdivision of the inscription may possibly be represented by the Ajaipur village in the Ajai Hisse Chaharam Mauza in the Bihar Thana and the two villages Nandivanaka and Mapivataka, granted in it, would be the Nediune or Naunvsn and Manianwan villages of these days, which are included in the Bihar Thana. Pilipinks I am inclined to identify with the Pilkhi or Pilkee Mauza and the Natika village with the Nsi Pokher of to-day, both lying in the Silao Thana. Though I am unable to offer any identification for the ancient Achala yet, I fancy, the village Hasti or Hastigrama of the grant might be the Hetboa Bigha village of the Bihar Thana if not the Hathi Tola of the Maner Police subdivision. The old village directory of the Gaya district available to me does not, apparently, give any name 1 See my Annual Report of the Central Circle, (Patna), for 1921, p. 6 and J. B. B. O. R. S., Vol. X, pp. 30 ff. Vol. I. pp. 1 & 211-12. 6 . '; Bharata quoted in the Sabdakalpadruma under Nagara. 1. Cf. palanaM yata rAjadhAnI sthitA and nagaramadhyatacAnamadhye taddvyavahArasthAnam : Yasodhars in his Jayamangaldon the Kamasutra of Vatayayana (N. 8. Edition), p. 44. Even in the Kbalimpur grant the frimejjaya skandhatara, or royal camp or headquarters' lay at Pataliputra. For the meaning of this expression ef. V. Smith; Early History of India, p. 898 and footnote & Similarly, I would identify the magara-bhukti of the legend on the seal, which, Dr. Spooner discovered during his explorations of the site (see his A. P. R. (E. C.) for 1916-17, p. 48) with the Srinagara-bhukti of this document. 1 Village Directory of the Presidency of Bengal, Vol. XXVI (Patna District). Village Directory of the Frseideney of Bengal, Vol. XXVII (Gaya District). 2 x 2
Page #349
--------------------------------------------------------------------------
________________ 318 [VOL. XVII. resembling the Kumudasntra (or snu) or the Palamaka of our record and I refrain from offering a conjecture regarding their identity. In connection with these place-rames, it is interesting to note, that our document supplies one or two territorial terms, which appear to be new. The term mandala, as I have remarked alove, is here used, as in the grant of Amma II, in the sense of desa, of which rishaya was a subdivision. The word 'vithi', which generally signifies a market, road-way or the like, appears to have been used, in this charter, in the sense of a division smaller than vishaya. Similarly the term 'naya seems to imply a like division. The use of these terms would show that bhukti was divided into mandalas which were subdivided into vishayas, the latter being again portioned into vithis or nayas. It is noteworthy that our document employs the term naya in the case of Rajagriha vishaya and vithi in the case of Gaya vishaya. The former occurs regularly after (1) Ajapura, (2) Pilipinka and (3) Achala, which lay in the district or vishaya of Rajagriha, while the latter term is to be found in connection with the district or vishaya of Gaya only. This would indicate that in the two vishayas, which were so contiguous to each other, there were, probably, different subdivisions made, apparently, for revenue purposes, Rajagriha being subdivided into nayas and Gaya into vithis. Thus, we can say that the villages Nandivanaka and Manivataka lay in the subdivision or naya of Ajapura, Natika in the naya of Achala, all these falling within the Rajagriha vishaya. The village of Palamaka, on the other hand, which belonged to the district or vishaya of Gaya, lay in the subdivision of Kumandasutra, i.e., Kumudasutra-vithi.3 EPIGRAPHIA INDICA. TEXT. Obverse. Metres used: Sardilavikriditam in vv. 1, 7, 8, 13, 14, 30, 31, 32, 33; Praharshini in vv. 2, 26; Vamsastha in v. 3; Upajati in v. 4; Indravajra in v. 5; Aupachchhandasikam in v. 6; Arya in vv. 9, 11, 22, 23; Harini in v. 10; Kathoddhata in vv. 12, 15; Anushtubh in vv. 16, 17, 18, 19, 29; Vasantatilaka in vv. 20, 24, 25, 27, 28; Pushpitagra in v. 21; Sragdhara in v. 34. 1 'oM svasti / siGghArthasya parArthasusthita 'matesmanmArgama[bhya] 2 siddhimiddhimanuttarAM bhagavatastasya prajAsu kriyA yastaidhAtukasatvasiddhipadavI ratyugravIryodayA nirvRtimAsasAda sugatarvArthabhUmojara:- [10] saubhAgyandadha datu ciyApA 3 5 farar svata [*] gopAlaH patirabhavasundharAyAH [*] 1 Ind. Ant., Vol. VII, p. 16; cf. Fleet, C.I.I., Vol. III, p. 32, footnote 7. It may be noted here that the term rithi is also used in the sense of a division in the Ghughrahati plates of Samacharadeva which have been edited by Mr. R. D. Banerji, in the August 1910 number of the Journal of the Asiatic Society of Bengal. Mr Bhattasali, who is re-editing the grant for this journal, seems to take the word ir its nenal sense, but, in the light of this Nalanda document, his rendering cannot hold good. The reading can also be s Kxpressed by a symbol. Kiethorn has for.
Page #350
--------------------------------------------------------------------------
________________ No. 17.] THE NALANDA OOPPER-PLATE OF DEVAPALADEVA. 80 STAnte sati jatinAM sugandhi yasmin akSayAH pRthusagarAdayopyabhUvana [url] vijitya yenA jaladharvasundharAmvimocitA modhaparimahA iti| savASpamubASpavilocanAgapunarvaneSu va(ba)ndhUndahazamatAjAH [3 // "] camatva. namtaSu va(ba)leSu yasya viSabharA yA nicitaM rajobhiH / pAdapracArakSamamantaricamviAmAnAM suciramva(mba)bhUva [*] zAstrArthabhASA calatonubhAva varNAgapratiSThApaya tA khadhammeM[*] zrIdharmapAlena sutena sobhUtvargavitAnAmavRNaH pitRNAm [5 // "] pacaleriva jAmayedoyevicalakhiridaiH kadaya'mAnA / nirupanavamamba (mbara prade zaraNaM raNanimena bhUtadhAco [*] vedAra vidhinopayuktApayasAM gaMgAsametembu(mbu)dhau / ' gokaparNAdiSu cApyanuSThi tavatAntIrtheSu dhAH kriyAH [1] bhatyAnAM sukhameva yasva sakasAnudRtya duSTAnimAnlokAnsAdhayato[*]nuSaGgAjanitA sidiH paracA.. pyabhUt // [ ] 'testai digvijayAvasAnasamaye saMpreSitAmA paraiH satkArarapanIya khedamakhilaM khAM khAM gatAnAM muvam [*] chatvaM bhAvayatAM yadIyamucitaM prItyA supANAmabhUt sovaLaM udayaM divagyutavatAM jAtisrANAmiva [*] zrIparava(ba)bakha duhitaH citipatinA rA prakUTa tilakasya / rapaNAdevyAH pANirjarahe ehamedhinA tena // [en"] tatariyaM banIH sAkSAsthitinuM garIriNI / kimavanipate: kIrtima. 1 Two strokes in place of one. Symbol for at the end of pada is peculiar, * Kinlhorn has samevA. * This dapda could be left out. * Kielborn has ar at which cannot be correct. * The way of writing the letter i poealiar. This daude could be left oqt.
Page #351
--------------------------------------------------------------------------
________________ 320 15 16 17 18 19 20 21 22 23 24 EPIGRAPHIA INDICA, [VOL. XVII. rttAthavA gRhadevatA [] *] iti vidadhatI zucyAcA [ rA ] vitarkayatI: prajA: prakRtigurubhiryA zuddhAntaDuberakarodadhaH // [10 // * ] vAdhyA pra ( pa ) tivratAsau mu tAratvaM samudrazaktiriva / // [ 11 // ] nirmUlo manasi vAci sthitaH zacI [["] zrIdevapAla devamprasava sutamasUta saMyataH / kAyakarmani (Ni) ca yaH rAjyamApa nirupaplavampiturvI (ba) dhisatva iva sogataM padam | [ 12 // *] bhavAmyadbhirvijayakrameNa / " karibhistAmeva vindhyATavI muddAmanavamAnavA (bA) Syapaya[mo] dRSTAH puna (ba)' ndhavaH [1] kambo (mbo) jeSu ca yasya vAjiyu [ va * ]bhirdhvastAnyarAjaunaso heSAmizritahAriheSitaravA: kAntAzciraprINitA : ' // [ 13 // * ] ya: pUrva va (ba) linA kRtaH kRtayuge yenAgamadbhArgava - tretAyAM prahataH priyapraNayinA karNena yo hApare / vicchinnaH kalinA zaddiSi gate kAlena lokAnta rama yena tyAgapatha eva hi punardiSTamunmIlitaH // [ 14 // * ] zrA gaGgAgamamahitAsapatna zUnyAmAsetu (toH)' prathitadazAsya ketukotaiH [*] urvvamA varuNaniketanAtha sindho rA lakSmIkulabhavanAtha yo vu (bu) bhoja // [ 15 // *] sakhala bhAgIrathopathapravarttamAnanAnAvidhanauvATaka saMpAdita setuva (ba) ndhanihita [zai]lazikharazreNivibhramAt niratizayaghanaghanAghanaghaTTA (TA) zyAmAyamAnavAsara lakSmIsamArabdha (ba) saMtata jaladasamaya sandehAt udIcInAneka narapatiprAbhRtIkatAprameyaha yavAhinIkharakhurorakhAtadhUlIdhUsaritadigantarAlAt paramezvara sevA samAyAtA zeSajaMbU (bU) ddI - pabhUpAla pAdAtabhara namadavanaH zrImudragirisamAvAsizrImavayaskandhAvArAt paramasaugataparamezvara paramabhaTA (DA) rakama 1 This danda conld well be omitted. 3 This danda is unnecessary. * Kielhorn gave bAndhavA: Kielhorn has fert ferar: Kielhorn read : and remarked that the lithograph he used gave setu (or bhetu). This inscription removes the possibility of bhetu. The readin must be it: * Road mAnie. 1 Rend "hAdudoSo
Page #352
--------------------------------------------------------------------------
________________ No. 17.] THE NALANDA COPPER-PLATE OF DEVAPALADEVA. 321 hArAjAdhirAjayodharmapAladevapAdAnudhyAta: paramasaugataH paramezvaraH paramabhaTA(hA)rako mahArAjAdhirAjaH zrImAndevapA ladevaH kuzalI / zrInagarabhuto rAjagrahaviSayAntaHpAti ajapuranayaprativa(ba)khasamva (mba) DAvicchibatalopeta / nandivanAka / maNi vATaka / pilipikAnayaprativa(ba) naTikA / pa. calAnayaprativa(ba) [sti grAma / gayAviSayAntaHpAtikumudasU pavauthIprativa(ba)ha pAlAma kagrAmeSu / samupagatAma(na) sarvAneva rAjarANaka / rAjaputra / rAjAmAtya / mahAkArtAkatika / mahAdaNDanAyaka / mahApratIhAra / mahA sAmanta / mahAdauHsAdhasAdhanika / mahAkumArA[mA ]tya [1] pramAva / zarabhA[] rAjasthAnI / yoparika' / viSayapati [*] dAyAparAdhika / caurohara Nika / dANDika [*] dANDapAzika [*] zaukika [*] [gau]smika / kSetrapAla [*] koTapAla / khagaDarakSa [*] tadAyuktaka / viniyuktaka / hastyazvoSTanauva(ba)lavyApa taka[*] kizoravaDavAgomahiSyadhikRta / dUta[SaNika / gamAgamika / pabhitvaramANaka / tarika / tarapatika / podra(Da)-mAlava-khaza-kulika / karNA Ta []Na / cATabha[Ta sevakAdInanyAMcAkIrtitAn khapAdapanopajIvinaH prativAsinazca vrAmha(bAbA) NottarAn mahattamakuTumbi(mbi)purogamedAndha ka / caNDAlaparyantAn samAjJApayati viditamastu bhavatAm yathoparilikhitakhasamba(mba)hAvicchivatalopeta nandivanAkagrAma / maNivATa kagrAma / naTikAgrAma / hastigrAma / pAlAmakagrAmAH khasImAtu caraparyantAH satalA: soddezA: sAmamadhUkAH sajalastha khAH soparikarAH sadazAparAdhAH sacauroharaNA: parihatasarca(pIDAH) pacATabhaTapravezA pakiMcitprayA[hA rAjakulIya : 1 The synibol which has been rend se may bid * The dayda between of audy was meant to be put after y to separate the word t'roun the following uparik,
Page #353
--------------------------------------------------------------------------
________________ 329 EPIGRAPHIA INDICA. . [VoL. XVII. samasta pratyAyasametA bhUmicchi. dvanyAyanAcandrArkakSitisamakAlam pUrvadattabhuktabhujyamAnadevava(ba) pradeyavarjitAH mayA mAtApitrorAtmana[ca] puNyayazobhivRddhaye // suva[gaNa hopAdhipama[hArAjazrIvA(bA)laputradevena dUtakamukhena vayavijJApitAH yathA mayA yaunAlandAyAmvihAraH kAritarUtra bhagavato vu(bu) ibhaTTArakasya prajJApAramitAdisakaladharmanetrIsthAnasyAyAthai tAMtra (tri) kavo(bo dhisatvagaNasyASTamahApuruSapulasya cAtuhiyAryabhikSusAsya va(ba)licarusatracovarapiNDapAtazayanAsanaglAnapratyayabhe SajyAdyartha dharmaravasya lekhanAdyartha vihArasya ca khaNDa sphuTitasamAdhAnArtha zAsanIkRtya pratipAdita[1]: yato bhavadbhiH sarvereva bhUmenapAla[na*]gauravAdapaharaNe ca mahAnarakapAtAdibhayAhAnamidamabhyanumodya pAlanIyaM prativAsibhirapyAnnAtha vaNavidheyathAkAla samucitabhAgabhogakarahiraNyAdipratyAyopanayaH kArya prati // sambat 18 ka(kA)rtika dine 21 Reverse. tathAca dharmAnuzansanazlokAH va(ba)hubhirvasudhA dattA rAjabhiH . . sagarAdibhi:[*] yasya yasya yadA bhUmistasya tasya tadA phalam // [16 // ] khadattAmparadattAmvA [yo] hari]ta vasundharAM / sa viSTAyAM kami tvA pitRbhiH saha pacyate / [17* paSThimbarSasarasA]Ni svarge modati bhUmidaH / pAhA cAnumantA ca tAnyeva ___ narake vaset // [18* // ] panyadalA mijAtibhyo yatnAdaca budhiSThira / mahoM mahImRtA zreSTha dA. Kleltorn gave lyuretand sogatud valguga. Terhrps sifen: in the reading intended.
Page #354
--------------------------------------------------------------------------
________________ No. 17.] THE NALANDA COPPER-PLATE OF DEVAPALADEVA. 323 48 nAcchreyo nu pAlanam // [18] asmatkulakramamudAramudA[1]ragiranyaizca dAnamidamabhyanumodanIyaM / lakSmayAstaDitsalilavuhu(buDu)da[] calAyA dAnaM phalaM parayazaHparipAlanaM ca // [20] iti kamaladalAmvu(mbu)vi(bi)ndulolAM zriyamanucintya manuSyajIvitaM ca [*] sakalami damudAhRtaM ca vu(bu)[dhvA] na hi purUSaiH parakIrtayo vilopyAH [21] dakSiNabhuja iva rAnaH parava(ba)ladalane sahAyanirapekSaH / [*] dUtyaM zrIva(ba)lavAM vidadhe dharmAdhikAra''smin // [22*1] asmin dhArambha dUtyaM baudevapAladevasya / vidadhe zrIva(ba)lavarmA vyAghrataTImaNDalAdhipatiH // [23] pAsIdazeSanarapAlavilolamaulimAlAmaNidyutivivo(bo)dhitapAdapanaH / zailendravaMzatilako yavabhUmipAla: zrIvIravairimathanA nugatAbhidhAnaH [24*1] haryasthaleSu kumudeSu mRNAlinISu zalendukundatuhineSu padandadhAnA / niHzeSadinukhanirantaralabdha(dha) gItiH mUteMva yasya bhuvanAni jagAma kItiH // [25] bhUbhaGge bhavati nRpA sya yasya kopAni[bhi]bAH saha hRdayahiSAM thiyopi / vakrANAmi ha hi paropaghAtadacA jAyante jagati bhUSatiprakArAH [2] tasyAbhavavayaparAkramazIlamAlI rAjendramaulizatadurmalitAki yugmaH / sUnuryudhiSThiraparAzarabhImasenakArjunArjitayazAH samarAmavIraH / [27*1] uttamamva(mba)ratalAgha(dyu)dhi saJcarantyA yatsenayAvanirajaHpa- .. TalaM padotyam / karaNAnilena kariNAM zanakamvitINagaNDasthalImadajalaH samayAmva(mba)bhUva [28] prakRSNapakSamevedamabhUjavanamaNDalaM / 1 The use of avagraha may be marked. . Thia dendaisunnecessary. * Read bha symbol for this used for thatoti, .Or caurasa. . It is better to read TRC 27
Page #355
--------------------------------------------------------------------------
________________ 924 EPIGRAPHIA INDICA. (VOL. XVII. kulandaityAdhipasyeva yadyazobhiranAratam // [28] paulomova murAdhipasya viditA sAlpayoneriva [prItiH] zailasuteva manmathari polakSmIrmurArariva / rAjaH somakulAnvayasya mahata: zrIdharmasetoH sutA tasyAbhUdavanobhujo'gramahiSI tAreva tArAyA // [3.n] mAyA yAmiva kAmadevavijayI zuddhodanasyAtmajaH skando nanditadevavRndAdayaH zambhorumAyAmiva / tasyAntasya narendrandavinamatpAdAravi. ndAsanaH sarborbopatigarbakharcaNacaNaH zrIvA(vA)laputro'bhavat [31] nAlandAguNavRndalubdha(ba)manasA bhaktyA ca zauhodanevu (buvA zailasarittaraMgataralA lakSmImimAM kSobhanAm / yastenovatasaudhadhAmadhavalaH sahAmiSatriyA nAnAsaguNabhikSusajhavasatistasyAvihAraH kRtaH // [32] bhattyA __tatra samastapatruvanitAvaidhavyadIkSAguru kalyA zAsanamAhitAdaratayA yammAya duutairsii| mAmAna paJca vipacitopariyathoddezA nimAnAtmanaH pitro[o]kahitodayAya ca dadau zrIdevapAlaM nRpaM // [33* // ] yAvasindhoH prava(ba)ndhaH pRthulArajaTAcIbhitAGgA ca gaGgA gurvI dhatte phaNIndra: pratidinamacalo helayA yAvI / yAvazcAstodayAdrI ravituragakharoSTacUDAmaNI stastAvatsatkotireSA prabhava tu jagatAmsarikrayA ropayaMtI [14] TRANSLATION. Lines 1-25 are translated in the Mungir grant edited by Kielhorn in Indian Antiquary, Vol. XXI, pp. 257-258. Ll. 26-33. In the Srinagara-bhukti, at the villages falling within the district (vishaya) of Rajagriha, namely, Nandivanaka and Manirataka, which come within the territorial subdivision (naya) of Ajapura, together with the undivided lands connected therewith; Natika which comes within the subdivision (naya) of Pilipipka and Hastigrama which comes within the 1 Both those letters are donbtful. Sankalpayoni, i.e. Kamsdeva has four wives, M stated in the Vishudharw. mdttariya, III,73,21, namely, Rati, Priti, Bakti and Ladasakti. Either of the two maines Priti and Sakti will it is, bat the former seems preferable. May be rend s et slao. . The use of the avagraha may be marked.. *Ditto.
Page #356
--------------------------------------------------------------------------
________________ No. 17.) THE NALANDA COPPER-PLATE OF DEVAPALADEVA. 898 subdivision (naya) of Aghall and the village of Palamska whioh comes under the subdivision (urthi) of Kumudastttra (or Kumudastida), that falls within the limits of the district (vishaya) of Gazi-Devapaladeva, being in good health, isades commands to all the persons who have assembled here,-the Rajaranakal, the Rajaputraka, the Rajamatya, the Mahakarttakritika, the Mahadandanayaka, the Mahapratihara, the Mahastnanta, the Mahadquhedhasadhamika, the Mahakumaramatya, the Pramatri, the Sarabharga, the Rajasthaniya, the Uparika, the Vishayapati, the Dasaparadhika, the Chaurdddharanika, the Dandika, the Dandapafika, the Saulkika, the Gaulmika, the Kshetrapala, the Kotapala, the Khandaraksha, the Tadayuktaka the Viniyukta ka, the Hastyasuoshtranaubalavya pritaka, the Kifora-vadavi-go-mahishy dhikrita, the Datapraishanika, the Gamagamika, the Abhitvaramanaka, the Tarika, the Tarapatika, the Odras (men from Orissa), the Malavas, the Khasas, the kulikas, the Karnnatas, the Hinas, the Ohatas (or village officers), the Bhatas, the servants and others, dependent on his lotusfeet, who are not named here, and the residents, the Brahmanottaras, the village-elders, householders, the purogas, the Medas, the Andhrakas down to the Ohandalas LI. 33-87. Be it known to you that the above mentioned villages, namely, the village of Nandivanaka, the village of Manivatakan the village of Natili tha village of Hasti (or Hostigrama) and the village of Palamaka, together with the undivided lands attached to them, unbroken up to their boundaries, grees and pasture-lands, with their grounde, places, mango and madhuka (Bassia Latifolia) trees, with their water and dry lands, uparikaras, dasaparadbal, chauroddharanas, free from all troubles, exempt from the entry of the chatas (village officers), and bhatas, with all taxes due to the king's family or court, with nothing of these to be recovered, according to the maxim of bhumichchhidra, to last as long as the moon and the sun and the earth shall endure, excluding the gifts to gods, and the Brahmans, which were granted before and were enjoyed or are being enjoyed Ll. 37-42 are granted by us for the increase of the spiritual merit and glory of my parenta and of myself. We being requested by the illustrious Maharaja Balapatradeva, the King of Suvarppadvipa through a messenger "I have caused to be built a monastery at Ndanda". granted by this edict toward the income for the blessed Lord Buddha, the abode of all the leading yirtues like the pra jnaparamita, for the offerings, oblations, shelter, garments, alms beds, the requisites of the sick like medicines, etc., of the assembly of the venerable bhikshus of the four quarters (comprising the Bodhisattvas well versed in the tantras, and the eight great holy personages (i. e. the ariya-puggalas), for writing the dharma-ratna, or Buddhist texts and for the upkeep and repair of the monastery (when) damaged ; therefore, this grant should be approved and preserved by all of you out of regard for the merit of protecting gifts of land and because in the confiscation of the same there is a fear of falling into the great hell and the like. The residents also should be obedient to the order on hearing it and 1 Mapy of these designations hardly admit of translation. They all ocour in soveral grants and have already been noticel by scholars. So they are left untranslated here. nugranit is usnally so translated and fe is practically loft untranslated. . Dr. Thomas is of opinion that the term Bodhisattes is need here to indicate the monks and would read tatraka in place ot tantrako. He further thinks that Buddhablaffarakanya depends on ethanarya. The term dharmant neenn in the Saddharmapundarika, 1, 10, 79; II, 108; XI, 6, 7. Barnouf translated it: "la regla de la loi," ie the rule of the Law." For ashfa ... pudgalasya roo Childers, Pali Dictionary under ariyapuggalo and pwagalo Dr. Krom of Leiden also thinks that the meta sent by Balapath to Davapila is only contained in the words : " Sri-Nalandayan dihara Karitas"; for, If we assume that the mesage includes the whole penge w far win (49) it is not clear who are meant by the word bharadbki narvaindva (1. 10). These words cannot be applied to King Dovapala. Evidently they refer to that king's oficiala mentioned previously. There remarks appear to be justified but then we would require itt after karitas. 29
Page #357
--------------------------------------------------------------------------
________________ 326 EPIGRAPHIA INDICA. [VOL. XVII, should bring to the donees at the proper time the due revenues such as bhagabhogakara, gold, etc." Samvat (year) 39, Karttika, day 21. Ll. 43-50. In pursuance thereof are the (following) verses (nos. 16-21) announcing duties (regarding grants)? V. 22. The illustrious Balavarmman who was the right hand of the king, as it were, and who never depended on others') help for crushing hostile forces, acted as messenger in this religious function. V. 23. In this religious undertaking Balavarmman, the illustrious ruler of the Vyaghratati-mandala, acted as a messenger of the illustrious (Emperor) Devapa ladeva. V. 24. There was a King of Yavabhumi (or Java), who was the ornament of the Sailen. dra dynasty, whose lotus-feet bloomed by the lustre of the jewels in the row of trembling diadems on the heads of all the princes, and whose name was conformable to the illustrions tormentor of brave foes (vira-vairi-mathana). V 25. His fame, incarnate, as it were, by setting its foot on the regions of (white) palaces, in white water-lilies, in lotus plante, conches, moon, jasmine and snow and, being incessantly sung in all the quarters, pervaded the whole universe. V. 26. At the time when that king frowned in anger, the fortunes of the enemies also broke down simultaneously with their hearts. Indeed the crooked ones in the world have got wuys of moving which are very ingenious in striking others V. 27. He had a son, who possessed prudence, prowess, and good conduct, whose two feet fondled too much with hundreds of diadems of mighty kings (bowing down). He was the foremost warrior in battle-felds and his fame was equal to that earned by Yudhisthira, Parasara, Bhrmasena, Karnna and Arjuna. V. 28. The multitude of the dust of the earth, raised by the foet of his army, moving in the field of battle, was first blown up to the sky by the wind, produced by the (moving) ears of the elephants, and, then slowly settled down on the earth (again) by the ichor, poured forth from the cheeks of the elephants. V. 29. By the continuous existence of whose fame tho world was altogether without the dark fortnight, just like the family of the lord of the daityas (demons) was without the partisanship of Krishna V. 30. As Paulount was known to be the wife of) the lord of the Suras, (i.. Indra) Ratit the wife of the mind-born (Cupid), the daughter of the mountain (Parvate), of the enemy of Cupid (i.6. Siva) and Lakshmi of the enemy of Mura (i.e. Vishau) Bo Tara was the queen consort of that king, and was the daughter of the great ruler Dharmasetu 6 of the lunar race and resembled Tara (the Buddhist goddess of this name) herself. V. 31. As the son of Suddhodana, (.e. the Buddha) the conqueror of Kamadeva, was born of Maya and Skanda, who delighted the heart of the host of gods, was born of Uma by Siva, 80 was born of her by that king, the illustrious Balaputra, who was expert in crushing the pride Here come six imprecatory and benedictory stanzas, too well-known to be translated. The stanza wataary wife: gift which is given in the Mangir grant is here left out. The eyebrows become crooked in frowning and the poet by way of arthantura-nyasa draws a general inference from it. Pun on the words Krishna and paksha. Fame is white or bright cf. mifen af 99 a fe ya yererat: Sahityadarpana, VII-28. * The exact word which certainly has only two letters is not distinct. It may be either Priti or sakti noted above, f.n., p. 324. That Rati is meant is absolutely clear from the context, This pame can be rond u Varmasetu alao,
Page #358
--------------------------------------------------------------------------
________________ No. 18.] MATTEPAD PLATES OF DAMODARAVARMAN. 827 of all the rulers of the world, and before whose foot-stool (the neat where his lotus-feet rested) the groups of princes bowed. V. 32. With the mind attracted by the manifold excellences of Naland and through devotion to the son of Suddhodana (the Buddha) and having realised that riches was fickle like the waves of a mountain stream, he whose fame was like that of Sangharthamitral, built there (at Nalanda) & monastery which was the abode of the assembly of monks of various good qualities, and was white with the series of stuccoed and lofty dwellings. V. 33. Having requested, King Devapaladeva, who was the preceptor for initiating into widowhood the wives of all the enemies, through envoys, very respectfully and out of devotion and issuing a charter, (he) granted these five villages, whose purpose has been noticed above for the welfare of himself, his parents and the world. V. 34. As long as there is the continuance of the ocean, or the Ganges has her limbs (the currents of water) agitated by the extensive plaited hair of Hara (Siva), as long as the immovable king of snakes (Sesha) lightly bears the heavy and extensive earth every day and as long as the (Udaya) Eastern and (Asta) Western mountains have their crest jewels scratched by the hoofs of the horses of the Sun so long may this meritorious act, setting up virtues over the world, endure. No. 18.-MATTEPAD PLATES OF DAMODARAVARMAN. BY PROFESSOR E. HULTZSCE, PA.D.; HALLE (SAALE). This inscription is engraved on flve very thin copper-plates, which were found in the village of Mattepad in the Ongole Taluk of the Guntor District and forwarded to Rao Bahadar H. Krishna Sastri by the Tahsildar of Nellore. The plates measure 6 inches in breadth and 13 inches in height. There are eight inscribed faces, the outer faces of the first and last plates having been left blank. Each inscribed face bears only two lines of writing. The margins of the plates are not raised into rims, but the writing is in fair preservation. The five copperplates are strung on a ring of the same metal, passing through a hole of about 1' in diameter on the left side of the writing. The two ends of the ring, which is about 21" in diameter, are fixed in the base of an oval seal, which is much worn; it seems to bear, in relief, the figure of a Beated ball, facing the proper right. The weight of the plates, with ring and seal, is 30 tolas. The alphabet is of an early Southern type. The Jihvamaliya ooours in line 7, and the Upadhinantya in line 16; 'final forms of t and m in lines 1, 7, and 15, 16 (twice), respectively. As in the case of the plates of Charudovi (above, Vol. VIII, No. 12) and of Vijaya-Devavarman (Vol. IX, No. 7), the eight inscribed faces are numbered consecutively, like the pages of a modern book, with the numerioal symbols 2, [3], 4, 5, 6, 7, 8 on the left margin; the first plate seems to bear, just as that of Dovavarman,' the sacred syllable or in the place of the figure 1. The symbol 2 occurs also in the date (I. 14), and the symbol 1 repeatedly in lipes 8-13 The language of the plates is Sanskrit mixed with Prikfit. Lines 1-14 are in prose, and the two last lines in verse. In the Sanskrit portion consonanta following are doubled, with the exception of t in kartum- and of h in arhanti (1.6). The Sandhi is neglected after purat (1.1), otasya and -sagotrasya (1.2), -gramayaka) (1.4), -gramab (1. 5), and bhumi (1. 15). 1 This might possibly mean that his wealth befriended the cause of the Sangha, Bee sb.vo, Vol. IX, p. 57.
Page #359
--------------------------------------------------------------------------
________________ 328 EPIGRAPHIA INDICA. [VOL. XVII. In lines 8-13 the proper names of the donees and most of the names of their gotras1 are given in Prakrit, and in line 14 the Prakrit form -samvachchharam occurs. The only other declensional forms are the nominative singular ameo (for which we would have expected ameo) and the genitive singular -ajjassa (-aryasya in Sanskrit) in lines 8-13. The vowel au has become o in Kondinna (= Kaundinya, 11. 8-11). Sanskrit p and b have been changed to v in Kassava (= Kasyapa, 1. 11 f.) and Savarajja (= Sabararya, 1. 10). Consonant groups are assimilated; but sri is represented by siri in Sirijja (1. 9). This name, as well as Nandijja (= Nandyarya, 11. 8, 13), Aggijja (= Agnyarya, 11. 9, 11), Agasti (= Agastya, 1. 13), and Venujja (for which we would have expected Venhujja3 Vishnvarya, 1. 12), are instances of Samprasarana (i = ya, and u = va). 4 The inscription records that, in the 2nd year of his reign (1. 14), the Maharaja Damodaravarman (1. 3) granted the village of Kangura to a number of Brahmanas. He was a worshipper of the truly and perfectly Enlightened one' (Samyak-sambuddha, 1. 1), i.e. of the Buddha. At the same time he boasts of having performed certain Brahmanical rites, viz. Gosahasra and Hiranyagarbha (1. 2 f.). These are the names of the second and fifth of the sixteen so-called great gifts (mahadana) of the Purapas. A similar feat is ascribed to king Attivarman in another copper-plate grant from the Guntar District, where I translate the epithet aprameya-Hiranyagarbha-prasa venas by who is a producer of (i.e. who has performed) innumerable Hiranyagarbhas.' That this Attivarman (whose name seems to be a Prakritic or Dravidian form of Hastivarman) belonged to the same dynasty as Damodaravarman, is evident from the fact that his family is stated to be 'descended from the lineage of the great sage Ananda' (ibid., text 1. 1). while Damodaravarman claims to have belonged to the gotra of Ananda (below, text 1. 2). Moreover, Damodaravarman resided at a city called Kandarapura (below, text 1, 1), which must have received its name from that prince Kandara who is mentioned as an ancestor of Attivarman. The characters of the copper plate grant of this king are decidedly more developed than those of the subjoined grant, which, besides, is partially in Prakrit, while the former is all in Sanskrit. Consequently, Damodaravarman must have been one gf the predecessors of Attivarman. When editing the Gorantla plates of Attivarman, my late lamented friend Fleet believed this king to have been a Pallava,7-chiefly because he interpreted the epithet aprameyaHiranyagarbha-prasavena by 'who is of the posterity of the inscrutable (god) Hiranyagarbha.' As I have shown above, this rendering is inadmissible in the light of the corresponding epithet used in the fresh plates, and Fleet himself had since withdrawn his original opinion in his Dynasties of the Kanarese Districts, second edition, p. 334. Henceforth Kandara, Damodaravarman, and Attivarman (Hastivarman) may be designated as 'kings of the family of Ananda.' The two localities mentioned in the subjoined inscription-Kandarapura (1.1) and Kangura (1. 4 f.)-I am unable to identify. But the first of the two villages referred to in the grant of Attivarman-Tanrikonra is probably identical with Tadikonda, 10 miles north of Guntar and south of the Krishna river, and the second village-Antukkural-with Gani-Atukuru, west P. 95. In line 18 the names of the gotras are in Sanskrit. Cf. Nandijs and Gonandija, above, Vol. I, p. 6, text 1. 21, and Vol. VI, p. 87, text 1.9. Cf. Rudavennhuja, above, Vol. VI, p. 317, text 1. 16. See Homadri's Danakhanda, chapter 5, and cf. also Ep. Ind., Vol. I, p. 368, verse 18 and note 58. Ind. Ant., Vol. IX, p. 102, text 1. 8. Loc. cit., text 1. 2. These coincidences were first pointed out in the Madras Epigraphical Report for 1920, Ind. Ant., Vol. IX, p. 108, text L. 7. Fleet read Tanthikontho 1 Bee Ind. A, Vol. IX, p. 102. See Mr. B. Sewell's Lists, Vol. I, p. 76. 10 Ind. Ant., Vol. IX, p. 108, text L. 8.
Page #360
--------------------------------------------------------------------------
________________ ii a. ii b. 111 a. 8 = J FIIIT's Mattepad Plates of Damodaravarman. 203 wly at t tn ttyaa I U J J L F H I J J J J Z W H H. KRISHNA SASTRI AULA RENT FEMIJ bhaagaarimaanugtshrngonaa renaainyts aghraane, nzaar A Yi S A Z R I A Z R S T O D T C I A V E UK y j s Z P D PAILLENTA lnytsnttnnddnaastthuttyM1b8dzdzmaamss SCALE FULL SIZE WHITTINGHAM GRIGGS, PHOTO-LITH.
Page #361
--------------------------------------------------------------------------
________________ it b, a#taarMraadzdzmaa / su kh69 naa / 842 7 zl / 4l-phyitaarM7/26'yin szh2 naam / / - 27/ 4. rgysmnnnu* J26numatttthmaa[(c) nu p gms- 77 . 2prfgwna (apg4@ti k fe Umtth |chzhu rn7;ynm?17tsitng- 26agy038 9%8g3zi@ged11: W5932) - 437 taa0 pz,305xpdeg60nmsunytsc@pQgp- 16 /
Page #362
--------------------------------------------------------------------------
________________ No. 18.] MATTEPAD PLATES OF DAMODARAVARMAN. -329 of Bezvada. Gorantla, where the plates of Attivarman were obtained, is 4 miles north of Guptar.s' Finally, Venkayya's Report for 1900, pp. 5, 35, notes a much defaced Sanskrit inscription mentioning the daughter of king Kandara of the Ananda gotra, at Chezatla, west of Guptir. TEXT. First Plate ; Second Side. 1 vijayakandarapurAt [bha]gavataH samyaksaMbuddhasya pAdAnudhyA2 tasya pA[na]ndasagotrasya pravandhya]gosaha[sAga]kahiraNya Second Plate; First Side. 3 garbhodbhavodbhavasya mahArAjazrIdAmodaravaNo vacanena 4 kaMgUraNAmayakA() vaktavyAH [*] ebhyo brAhmaNebhyo] nAnAgotracaraNa Second Plate: Second Side. 6 tapasvAdhyAyaniratebhyomadAsaptamakulanistAraNa[*]rtha kaMgUragrAma: 6 asmAbhismaparihAraiItta: [0] saMvidhAya' pre[]NaM kartumaInti ] Third Plate ; First Side. 7 eSAM brAhmaNAnAM gotranAmavibhAgAdaMzavibhAgaliyate [+] pUrvantAvat 8 koNDivAhajasma paMthI 1 koNDianandijasma paMtho 1 koNDivakhandabbasa paMzo Third Plats; Second Side. 9 kIvibhavajasma aMzI 1 koNDivaamminasa zo / kohipasiri jasma paMthI 10 punaH koNDicabhavajasma maMtho 1 'kolicalandannama yo 1 kozikA savaranasa zo] Fourth Plate ; First Side. 11 koDinapamijasma aMzo 1 korikhanavIralasa paMtho / kamavadAmanasa [payo] 12 kapakumArajasma maMtho 1 karamavaraNujjama paMtho 1 kamma[va]Sajasma paMcI Be above, VOL. VIII, p. 10. Ind.ant, Vol. Ix, p. 102. Mr. Sewell's Lists, Vol. I, - 74. * Prom Ink-improwions supplied by Rao Bahadur H. Krishna Sastri. Bad pitrAba.
Page #363
--------------------------------------------------------------------------
________________ 330 EPIGRAPHIA INDICA. Fourth Plate; Second Side. 13 kAzyapanandinnasta aMzo 1 vatsadoSajA paMzo bhAgastibhaddajA shit t' [1] 1 14 vijayasaMyacchara 2 kArttikapracasya cayodazyAM patrikA dattA [] [VOL. XVII Fifth Plate; First Side. 15 bahubhirvvasudhA dattA bahubhicAnupAlitA [1"] yasya yasya yadA bhUmi: ' tasya tasya tadA phalam // 16 vadatAM paradatta vA yo haraMtu vasundharAm [] gayAM gatasahasrasya E pivati duSkRtam / TRANSLATION. (Line 1.) From Kandarapura, (the city) of victory, the villagers of Kangura have to be addressed (as follows) by the word of the glorious Maharaja Damodaravarman, who meditates on the feet of the blessed Samyak-sambuddha; who belongs to the gotra of Ananda; (and) who is the origin of the production (i.e. who has caused the performance) of many Hiranyagarbhas and of (gifts of) thousands of pregnant cows. (L. 4.) For the saka of Our salvation as far as the seventh generation, the village of Kengura has been given by Us, with all exemptions, to the following Brahmapas of various gotras and charanas, and practising austerities and recital of their sacred texts. Knowing this (the villagers) should render service (to them).' (L. 7.) The allotment of shares is (now) made to these Brahmanas, with specification of (their) gotras and names. First then, to the Kondinna Ruddajja (Rudrarya) 1 share; to the Kondinna Nandijja (Nandyarya) 1 share; to the Kondinna Khandajja (Skandarya) (1) share; to the Kondinna Bhavajja (Bhavarya) 1 share; to the Kondinna Aggijja (Agnyarya) 1 share; to the Kondinna Sirijja (Sryarya) (1) share; again to the Kondinna Bhavajja 1 share; to the Kondinna Khandajja 1 share; to the Kondinna Savarajja (Sabararya) (1) share; to the Kondinna Aggijja 1 share; to the Kondinna Virajja (Virarya) 1 share; to the Kassava Damajja (Damarya) (1) share; to the Kassava Kumarajja (Kumararya) 1 share; to the Kassava Venujja (Vishnvarya) 1 share; to the Kassava Devajja (Dovarya) (1) share; to the Kayapa Nandijja 1 share; to the Vatsa Donajja (Dronarya) 1 share; to the Agasti Bhaddajja (Bhadrarya) I share. (L. 14.) (In) the year of victory 2, on the thirteenth (tithi) of the bright fortnight of Karttika, (this) set of plates has been given (to the donees). [Line 15 f. contain two of the customary slokas.] No. 19.-URLAM PLATES OF HASTIVARMAN; THE YEAR 80. BY PROFESSOR E. HULTZSCH, PH.D.; HALLE (SAALE). 1 is entered below the line. * Bend . This is a set of three copper-plates, measuring 7 inches in breadth and 2 inches in height. The outer face of the first plate has been left blank, while the second and third plates * Rend bhUmila?. See the introductory remarks. paffika is used in the same sense in other copper-plate grants. See above, Vol. I, p. 7, text 1, 61; Vol. VI, p. 14 text 1 18; p. 88, text 1. 28; p. 818, text 1. 40; Vol. VIII, p. 240, text 1. 40,
Page #364
--------------------------------------------------------------------------
________________ No. 19.] 331 URLAM PLATES OF HASTIVARMAN. bear writing on both sides. The margins of the plates are not raised into rims, but the writing is in good preservation. The plates are strung on a copper ring, which is passed through a hole about " in diameter near the left margin of the writing. The ring is about 3' in diameter and now carries no seal; but there are clear traces of a seal having once been soldered on it. The weight of the plates, with the ring, is 42 tolas. The plates were received by Rao Bahadur H. Krishna Sastri from Mr. K. Nagesvara Rao, Editor of the Andhra Patrika,' who stated that they are the private property of the Raja of Urlam, Chicacole taluk, Ganjam District. Mr. T. Rajagopala Rao has already published the text of the inscription on them in his journal. South Indian Research for July 1919. The alphabet is of an early Southern type and closely resembles that of the Achyutapuram plates of the Ganga Maharaja Indravarman I of Kalinga, which were drafted by the same officer as the Urlam plates. A final form of m occurs at the end of the inscription, while it is replaced by Anusvara in phalar (1. 20) and opalanam (1. 21). The two numerical symbols 8 and 80 are used in the date (1. 23), where 80 is expressed by the numerical symbol 80 and a superfluous cipher added to it. The language is Sanskrit, prose and five verses (11. 19-22, 23-26). As to orthography-v is used for b in "vidha (1. 14). The syllable ri is replaced by the vowel ri in the second syllable of kritpind (1.17). A nesvara is represented by gutturali in Rajasiri hasya (1. 24) anl -sanghateh (for-sarhatel, l. 25). Consonants are doubled after r, with the exception of sh (in varsha-, 1.2); and dh is doubled before y in -inuddhyatah (1. 7). The sandhi is neglected After -yasah (1.5), =smabhih (1. 9), Rosiddhaye (1.11), -simantiks and valmikah (1. 16), and rongly made in -rapya (1. 15) and tato (1. 18). The inscription records the grant of a piece of land at the village of Hondevaka in Grish uk -vartani (1.8) as an agrahara to Jayasarman, a resident of Uramalla (1. 12). This land had been purchased from the residents of the agrahara (of Hondevaka) by the grantor---the Maharaja Hastivarman (1. 8) of Kalinga (1.4), who belonged to the Ganga family (1. 5 f.) and resided at Kalinganagara (1.1). This king receives exactly the same panegyrical epithets us. are applied to Indravarman I at the beginning of his two published grants. The date of Hastivarman's grant was the year 80 (in words and figures) of the reign (1. 23), while IndiaVarman's grants are dated in the years 87 and 91 of the reign. For this reason, and because all the three grants were drafted by the same officer, Hastivarman must have been the predecessor of Indravarman I, and the years of the reign cannot possibly have been those of two individual reigns, but must be referred to the Ganga or Gangeya era, whose earliest known date is now that of Hastivarman's record. The day of the grant was the eighth (tithi) of the dark (fortnight) of Kurttika' (all in words, 1. 13) or the day 8 of Karttika' (1. 23). The officer who wrote the grant of Hastivarman and the two grants of Indravarman I, was Vinayachandra, son of Bhanuchandra. In the verse which contains his name, he cails his sovereign Rajasimha, which, accordingly, must have been a biruda both of Hastiverman and of his successor Indravarman I. According to verse 5, Hastivarman had the additional surname Ranabhita. The same curious expression, which at first sight does not look very complimentary, but may have to be understood in a moral sense, occurs in two copper-plate grants as the name of a member of the dynasty of Sailodbhava ; see verse 6 of the Buguda plates, above, Vol. III, p. 43, and of the Parikud plates, Vol. XI, p. 284. The subjoined grant does not mention the name of its engraver ; but I use this opportunity for again drawing attention to an error which dies hard, and crops up once more in the transla 1 Above, Vol. II, p. 127 ff. 1 See the preceding note, and the Parli-Kimedi plates, Ind. Ant., Vol. XVI, P 134. + Vorso 4 of the subjoined grant is identical with line 23 f. of the Achyutapuram plates, and with linu 19 f. of the Parla-Kimedi plates, of In:Iravarman I. 2 z
Page #365
--------------------------------------------------------------------------
________________ 382 EPIGRAPHIA INDICA. [VoL XVII. tion of a Ganga grant in Vol. XIII, p. 216. As I have shown in Vol. VII, p. 107, note 4, akhafali, the person to whom the engraving of copper-plate grants is entrusted, means goldsmith," and must not be confounded with akshapatalika, 'a keeper of records.' Of the localities mentioned in this inscription, Kalinganagara (1. 1) is the present Mukhalingam," and Uramalla, where the donee resided ( 1. 12), is Urlams where the copperplates were obtained. In the absence of local maps, I am unable to identify the village granted, Hopdevaka (1. 8 ), and another village, Eattaravanna, which seems to be referred to in the description of the boundaries of the former (116). The district of Krishtuka-vartani (l. 8) occurs also in the Chicacole plates of Devendravarman." TEXT." First Plate; Second Side. 1. svasti [it] sarvvarttumukharamaNIyAddijayakaliGganamarA sakalabhuvananirmANaka2 sUtradhArasya bhagavato 'gokarSukhAminacaraNakamalayugalamayAmAdapagata 3 kalikalako vinayanavasampadAmAdhAra khAsidhArAparispandAdhiga tasrakala kaliGgAdhirAjyacaturudadhitaraGgamekhalAvanitala pravi 4 5 tatAmalayazA (:) anekasamarasaMcobhaNanitajayazabdo' gAnA 6 malakulapratiSThaH pratApAtiyavAnAmita samasta sAmantacUDA Second Plate; First Side. 7 maNiprabhAmaSvasaipucaracitacaraNo mAtApitRpAdAnuyAtaH parama 8 mAhezvaraH zrImahArAja hastiva (1) kroSTukavarttayAM hoNDavakathAme sa 9 vyaMsamavetAnkuTumbinamA prApayati [1] viditamastu yo yathAsyAbhi[:]* 10 amingrAmaigrahAribasakAzAtkrItvA DAI ilasya bhUchedIjJatyAcandrArka 11 pratiSThamapracArayA sarvakAraH paritva mAtApitrorAmamaya pucAbhicayeM " 12 urAmajJanivAsine vaktasagotrAya vAjasaneyasabrahmacAriNe ja[ya] Second Plate; Second Side. 18 ye vAkayASTamyAsudakapUrva saMpratA [] tahiditvA sabhUmimanupAla zarmaNe 14 yatAM na kenacitparivAdhA" kAryeti / somAvikAni cAca [1] pUrveca pIkata > Cf. ' agasali, agasalavadu or agasalevadu, a goldsmith," in Brown's Telugu-English Dictionary. See share, Vol. IV, p. 187 ft. This identification was suggested in the Madras Epigraphical Report for 1920, p. 96, * Above, Vol. III, p. 181. * From.ink-impressions supplied by Bao Bahadur H. Krishna Spatri, Exprewood by a aymbol, Bond boka * Bond "saMghama', 10 Bond ka * Band yathAmAbhirami" 11 Rend bAdhA
Page #366
--------------------------------------------------------------------------
________________ Urlam Plates of Hastivarman : the year 80. (c)khnyuM Hua ajaj mh=l 7@ T1 7 ajaya* U 1 Jana1a9]12(2nirl@ada Ital na + B 2 ng+ diipmaathaa yaa 3D T+2 * a ] 8875= 10KRuamagyyea . t@uma ] m + sMkhaa= Eam * 2 (1 @ aooH taayaam : myaan m=92-Biginallaa++ diidup jng * // ngooHmenattthkh5 gyy+ii217 * #m. dii17 khaa= ausang 600 gnaa. 12. ma al n Eantaaaaa .ng+ >> Bat 5,7aa ]-maaraa26. " kssikssis trm hE pz i b, -naavaa naam mukh 135 9daag666 . yyaa ha Falam@ j aF60KRaaoo+ . paavidyaayaamkhaaraanyptimaaen gyy 62chnaaM.. * 166 66oo 13maa86 6666 666 hag . naga1maataajaataarooca 94 85 aagooH. khnyuMkhlaaMng w amadii6khlii + 2 ryy 16nttthaaygnaapnn.adu >> H. KRISHNA SASTRI, WHITTINGHAM & GRIGGS, PHOTO-LITH. SCALE THREE-FOURTHS
Page #367
--------------------------------------------------------------------------
________________ 20 24 iil a. lii - srd 22 26 gh gurbaaad caadraa sNvaastaa gur gurdiis v vaa vaa srkaar naam rsu prbbaav r mgjlhrgurmsaarn is vaar baag v gursr gddkr nuuN grg gulaa, aNbr 10 111 D. lhuur n vddmuHlaa sNgruur, jnNbr s 20 22 24 26
Page #368
--------------------------------------------------------------------------
________________ No. 19.] URLAM PLATES OF HASTIVARMAN. 15 kSetrapAlI tato ghoSaNavApyA [: *] pazcimapAlI tataH punarapi kSetra pAThI "] 16 daciyena ittaravabasImAntikA eva' [[*] pazcimena kSetrapAlI tato valmIka: ' 17 tataH zatRmA pASANapaGgiH [*] uttareNApi kSetrapAlI tato vIka: punarvvIka: 18 tato' pUrvvavalmIkamanuprApteti / bhaviSyadrAjabhicAyandAnadharmAnupAsanIya: [*] Third Plate; First Side.. ca vyAsagItA: [1"] bahubhirvvasudhA dattA bahubhiyAnupAlitA [1"] 19 tathA yasya yasya 20 yadA bhUmistasya tasya tadA pharNa [1] khadattAmbaradatta vA yajJAdraca yudhiSThira [1"] mahI 21 mahimatAM zreSTha dAnAyonupAvanaM [2] SaSTiM varSasahasrAci modate divi 22 bhUmidaH [*] cAcetA cAnumantA ca tAndheva narake vasediti / [1] pravardhamAnavijaya 23 rAjyasaMvArA bhamotiH 80 kArttikadina // idaM vinayacandreNa bhAtu24 candrasya sUtunA [*] zAsanaM rAjasihasva likhitaM svamukhAnmayA // [4*] Third Plate; Second Side. 25 maNDalAcApaniSpeSa nidhidvArA tisahate [1] 26 zrImatopraticAnnasya raNabhItasya zAsanam // TRANSLATION, (Line 1.) Ori Hail! From Kalinganagara, (the city) of victory. which is pleasant (on account of the simultaneous presence) of the comforts of all seasons, the glorious Mahara in Hastivarman, a fervent worshipper of Maheevara, who meditates on the feet of (his) mother and father, 8 commands (as follows) the ryots, accompanied by all (others), at the village of Hondevaka in (the district of) Kroshtuka-vartani. 1 Read saumAntikeva. * Read kRtimA. * Read maha 331 (L. 9.) Be it known to you that We have purchased two and a half ploughs (hala) of land in this village from the Agraharikas, have constituted (this land a separate) section. Bend vakhIkakhataH 4 Read bastataH. * Bend siMhastha. 1 Read : * The epitheta omitted here will be found translated above, Vol. III, p. 120. * ie, the residents of the agrahara. 252
Page #369
--------------------------------------------------------------------------
________________ 334 EPIGRAPHIA INDICA. [VOL. XVII. have made (it) an agrahara which is to last as long as the moon and the sun, have exempted (it) from all taxes, and that, for the sake of the increase of the religious merit of (Our) mother and father and of Ourself, on the eighth (tithi) of the dark (fortnight) of Karttika, with libations of water, We have given it to Jayasarman, who resides at Uramalle, belongs to the Vatsa gotra, (and) studies the Vajasaneya (sakha). Knowing this, nobody should cause obstruction to the new owners) while they are preserving their own land." (L. 14.) And the marks of the boundaries of this (land are): In the east, an anthill; then the bank (pali) of a field; then the western bank of the Ghoshana tank; and then again the bank of a field. In the south, only the boundary of Hattaravanna. In the west, the bank of a field; then an anthill; then an artificial row of stones. And in the north, the bank of a field; then an anthill; again an anthill; then the boundary) reaches the anthill in the east. (L. 18.) And future kings should preserve this meritorious gift. There are also the following (verses) sung by Vyasa. [Lines 19-22 contain three of the costomary Slokas.] (L. 22.) Eighty-in figures) 80--years of the reign of increasing victory, the day 8 of Karttika. (Verse 4.) At the command of his (the king's) own muth, this edict of Rajasimha has been written by Vinayachandra, son of Bhanuchandra (V.5.) (This is an edict of the glorious Ranabhitz, whore orders are irresistible, (and) who has crushed the Cullection of (bis) euenies by the strokes of the point of (his) scimitar. No. 20.-IPUR PLATES OF GOVINDAVARMAN'S SON MADHAVAVARMAN. BY PROFESSOR E. HULTZSCH, Ph.D., HALLE (SAALE). This is a set of three thin copper-plates in the possession of Brindavanam Gopalacharlzz at the village of Ipur in the Tenkli Taluk of the Gitar District, which was brought to the notice of Rao Bahadur H. Krishna Sastri by Mr. A. Rangasvami Sarasvati. The plates measure 64 inches in breadth and 14 inches in height. The outer faces of the first and last plates have been left blauk, while the middle one bears writing on both sides. The margins of the plates are not raised into rims, but the writing is in good preservation. The plates are strung on a copper ring, which is 3" in diameter and is passed through a hole on the left side of the writing. The two ends of the ring are secured in the base of a ciroular seal, which measures 13" in diameter and is somewhat worn. It is divided by a cross-line into two sections. The lower section bears, in relief, the legend and in two lines. Above the line seems to be a figure of Lakshmi or a Svastika on a pedestal, flanked by two lamp-stands and surmounted by the sun (P) and the crescent of the moon. The weight of the plates, with ring and seal, is 30 tolas. Tho alphabet is of an earlier southern type than that of the two other published grants of the Vishnukundin family The secondary forms of i and i are not always clearly distin Cf the corresponding portion of the Achyutapuram plates, above, Vol. III, p. 129. * These are the Ramatirtham plates of Indravarman, above, Yol. XII, p. 133, and the Chikkulla plate Vikraidendreyarpan Il, Vol. IV, p. 138.
Page #370
--------------------------------------------------------------------------
________________ Ipur Plates of Govindavarman's Son Madhavavarman. bsil)stsn-pq= m: r rgysyz/1. mi'l,ch-m-rnymkr)28g, 730)la' + [[lm-107]]je tshe ni mi 171 #*je8s inyi=2422828g3:55T nyink5*0 7 tu ]]acu'dulc**n / m ng ng : 9 02knyj annM-7yon8) braanu(c)nnni-b83nsachy7 l d mk@mgtn paa, hutgi05>>gnywkkaa-kiyaan-dzhraaky" F3 " ucnusaacmssmthrnm-mkh81124 / / H. KRISHNA BASTRI. SCALE THREE-FOURTHS WHITTINGHAM A GRIGGS, PHOTO-LITH
Page #371
--------------------------------------------------------------------------
________________ Seal FULL SIZE
Page #372
--------------------------------------------------------------------------
________________ No. 20.) IPUR PLATES OF GOVINDAVARMAN'S SON MADHAVAVARMAN. 335 guished ; in okundinam= (1.1) i looks like 1, and in bhagarach-Chhriparvvata - (1.1), sri. Govinda' (1. 3), and mahi- (1.4), i loks like i ; t is distinguished from by a loop on the left: but in janins (.9) the second has a loop, aud in jagat-kalmashah (1. 7) and -samvatsare (1. 14) the t has no loop. Final forms of m and t occur in -arttham (1. 10), r'a sundharam and vrajet (1. 13). The numerical symbols 5, 7, and 10 are used in the duto (1. 14). The language is Sanskrit prose (with two verses quoted in l. 12 f.), but the abbreviation gi (1. 14) presupposes the Praklit word gimha (= grishma in Sansk, 't) The incorrect form saptatrise, (for saptatriinse, l. 14) seems also to be due to Prakrit inceuce. Palatal is es. pressed by lingual in Manchyanna. (1. 11). Consonants are doubled aftur r throughout, and dh before y in -anuddhyatasya (1.1), while tva represents ttva in -satvu- (11. 3, 6). As the notes on the text will show, the rules of sandhi are frequently disregarded. The inscription records the grant of the village of Vilembali in the Guddadi-vishaya (1.8 f.) to the Brahmana Agnisarman. The graptor was the Mabaraja Madhavavarman (1.8), son of the Maharaja Govindavarman (1.3), who was a worshipper of the temple at Sriparvati and belonged to the family of the Vishnukundins (1.1). Madhavavarman issued his order to the villagers from his camp at Kudavade (1.8) and seems to bave resided at Trivaranagara (1. 4). The executor (ajna) of the grant was (the king's) 'dear son,' Manchyanna-bhattaraka (1. 11). Its date was the 15th day of the 7th fortnight of the hot season in the thirty-seventh year of the reign (1. 14). In consideration of the comparatively early type of the alphabet of this inscription, I feel. tempted to identify Madhavavarman with a king of the same name, who is known to have been the grandfather of the grantor of the Ramatirtham plates, and the great-grandfather of the grantor of the Chikkulla plates. For easy reference, I subjoin a tabular statement. Ipur plates. Ramatirtham plates, Chikkulla plates. Govindavarman. Madhavavarman (year 37). Madhavavarman. Madhavavarman. Vikramendra. Vikramendravarman I. Indravarman (year 27). Indrabhattarakavarman, Vikramondravarman II (year 10). Of the localities mentioned in this inscription, Sriparvata (1.1) is perhaps identical with Srisailam in the Karnal District. Whether the Guddadi-vishaya (1. 8 f.) has anything to do with the Guddava di-vishaya to which Draksharama and Challar in the Godavari District belonged, I am unable to say, nor can I identify Vilembali (1.9), Kudavada (1.8), and Trivarunagara (1.4), which can hardly be identical with the distant Tripuri (Tewar). 1 See my remarks above, Vol. XII, p. 133, and cf. the Madras Epigraphical Report for 1920, p. 99, * Bee above, Vol. IV, p. 195. See abovo, Vol. IV, p. 83; Ind. Ant., Vol. XIV, p. 53, text 1.77; Vol. XIX, p. 424.
Page #373
--------------------------------------------------------------------------
________________ 336 EPIGRAPHIA INDICA. [VOL.XVII. TEXT.I First Plate ; Second Side.. 1 svasti [*] bhagavacchopaLatakhAmipAdAnuddhyAtasya viSNukuNDinAmaparimitabala. parAkramasya 2 paramadhArmikasya praNatasakalasAmantasyAnakagopiraNyabhUmipradAnasya mahArAjasya 3 zrIgovindavarmANaH putraH timatibalasatvadheyyavoryavinayasaMpana: 4 sakalamahImaNDala]ma[nu]japati[pratipUjitazAsanaH vivaranagarabhavanagatayuva Second Plate; First Side. 6 tihadayanandanaH 'khAnayavalaMvijitasakalasAmantAtulabalavinayanayaniya6 masatvasapanaH sakalajagadavanipatipratipUjitamAsana: pagniSTomasahasrayA7 jo hi[ra*] sthagarbhaprasUta: ekAdazAzvamedhAvamathavidhUtajagatkASaH sustira8 karma [1] mahArAjazrImAdhavavarmA vijayaskandhAvArA[*] kuDAvADavAsaka guddAdiviSa. Second Plate ; Second Side. 9 ye vilambaligrAmajanAmAnevama[*]JApayati yathA aso vatsagocAya - brAhmaNA10 ya" agnimarmaNe pramazavibhUtyaya'm" sarvaparihAraNa dattavAnami [1] tadavagamya sarva11 rAjapuruSaiH parihattavyaH pAlayitavyaca [1] asyAtrA priyapuSa: maNacakha bhahArakaH [1] Third Plate ; Firat side. 12 bahubhivvaMsudhA dattA bahubhicAnupAlitA [*] yasya yasya badA bhUmistasya tasya tadA pa * Rand 'zAsanarivabara. ! From ink-Impressions supplied by Rao Bahadar H. Krishna Sastri. + Rend makha. * Perhaps svabhujavala is intended. Read sAmantI ituka. * Read satvasaMpanna:- Read 'prasUtirabAdazA * Rnd degvAsakAidAri " Beed brAmavAyAprioma " Read puSI mAraka * Rand zAsanIgni * Read susthira " Rond baghA. " Read "vA.
Page #374
--------------------------------------------------------------------------
________________ No. 21.] IPUR PLATES OF MADHAVAVARMAN IL 18 [m // *] svadattAM paradattAM vA yo harata vasundharAm yo ta padharAm [1] cAcetA cAnumantA ca sayA naraka prajet [1] 1 337 14 pravardhamAnavijayarAjyasaMvatsare saptAtrime ' gi pa 7 di * ft to ? * # TRANSLATION. (Line 1.) Hail! The son of the glorious Maharaja Govindavarman, who meditated on the feet of the holy lord of Sriparvata; (who belonged to the family) of the Vishnukundins; whose power and valour were immeasurable; who was most religious; to whom all vassals were bowing; (and) who (performed) many gifts of cows, gold, and land; (L. 3.) the glorious Maharaja Madhavavarman, who is endowed with (knowledge of) the law, intelligence, power, honesty, firmness, valour, and modesty; whose edicts are worshipped by all rulers of men on the circle of the earth; who delights the hearts of the young women standing on (the top of) the palaces of Trivaranagara; who has subdued all vassals by the power of his own arm; who is endowed with unequalled power, modesty, policy, self-restraint, and honesty; whose edicts are worshipped by the rulers of the earth in the whole worlds; who has performed thousands of Agnishtoma sacrifices; who is a producer of (ie. who has performed Hiranyagarbhas; who has removed the stains of the world by bathing at the end of eleven Aivamedhas; (and) whose religious rites are everlasting; (L. 8.) from (his) camp of victory, pitched at Kudavada, commands as follows all men at the village of Vilembali in the district (vishaya) of Guddadi. (L. 9.) For the sake of the prosperity of Our family, I have given (this village), with all exemptions, to this Brahmana Agnisarman of the Vatsa gotra. Knowing this, all royal officers should exempt and preserve it.' (L. 11.) The executor (ajna) of this (grant was the king's) dear son, Manchyannabhattaraka. [Line 12 f. contain two of the customary Slokas.] (L. 14.) In the thirty-seventh year of the reign of increasing victory, the 15th day of the 7th fortnight of the hot season.7 No. 21.-IPUR PLATES OF MADHAVAVARMAN II. BY PROFESSOR E. HULTZSCH, PH.D.; HALLE (SAALE). This is another set of three thin copper-plates without rims, which belongs to the same owner as the preceding one (above, No. 20). The plates measure 7 inches in breadth and 14 inch in height and have four inscribed faces, the outer sides of the first and last plates having been left blank. The writing is much injured, especially on the two last faces. The plates are strung on a ring, which is about 3" in diameter, and the ends of which are secured in the base of Road saptaciMze Read narakaM. The two last epithets are nearly identical with two others applied to the king before in line 3 f. Hiranyagarbha is the name of the fifth of the sixteen Mahadanas. Cf. aneka-Hiranyagarbbh-odbhasodbhavasya in the Mattepad plates of Damodaravarman (above, No. 18), text 1. 2 f., and aprameya-Hiranyagarbha prasavena in the Gorantla plates of Attivarman Ind. Ant., Vol. IX, p. 102, text 1. 3. The same epithet occurs (with the various reading avadhauta for vidhita) in the Ramatirtham plates, 1. 3 f., and in the Chikkalla plates, 1. 2 f. Cf. above, Vol. IX, p. 59, note 6. With gi pa 7 cf. gimha pakho chhathe 6 in the Mayidavolu plates (above, Vol. VI, p. 88); [g]imha-pakke pachame 5 at Karle (Vol. VII, p. 61); the following dates of four Nasik inscriptions (above, Vol. VIII): gimba pakhe pachame 5 (p. 59); gimhana pakke bitiye 2 (p. 60); gi pa 2 (p. 65); mha-pakhe ohothe:4 (p. 88) and gihma-pakkam padamam in a Malavalli inscription (Vol. X, Appendix, p. 188, No. 1195).
Page #375
--------------------------------------------------------------------------
________________ 338 EPIGRAPHIA INDICA. [VOL. XVII. a circular, much worn seal, which is turned towards one side. The seal is divided by a cross-line into two sections. In the lower section the legend TATU*[ ], in two lines, is very faintly visible, while the symbols in the upper section cannot be made out. The weight of the plates, with ring and seal, is 30 tolas. The alphabet reminds us of that of the British Museum plates of Charudevi (above, Vol. VIII, p. 143). The Upadhmaniya, occurs in lines 12 and 16. The numerical symbols 7 (thrice) and [40] are used in the date (1. 13). The language is Sanskrit prose (with two verses quoted in II. 14-16); but the abbreviation ta (1. 13) presupposes the Pra's fit form rasa (= varsha in Sanskrit). Consonants ara doubled after throughout, t before r in kshattriya (1. 3 f.) and -puttras= (1.5), and all before y in oddhyato (1. 7), while tva is employed for itra in-satra- (1.6). The inscription records the grant of a village, the name of which is doubtful, by Madhavavarman (II) (1.7), who resided at [Amarapura (1. 1), ruled over the Trikuta and Malaya mountains (1. 5), was a worshipper of the temple at Sriparvata (1. 6 f.), and belonged to the family of the Vishnuzundins (11. 7, 13). His father was Devavarmin (1. 5), and his grandfather the Maharaja Madhavavarman (I) (1. 3 f.). As the alphabet of this inscription seems to he of an earlier type than that of the preceding one, and as grandsons are frequently named after their grandfather, I consider it not impossible that Madhavavarman II was the grandfather of Govindavarman's son Madharavarman, who would then have to be designated Madhavavarman III. The first tigure of the year in the date portion of the subjoined inscription (1. 13) is injured end uncertuin. The localities mentioned in this inscription I am unable to identify, with the exception of Trikata, mountain on the Boinbay side, and Malaya, i.e. the Western Ghats, both of which were at a safe distance from the dominions of Midhavavarman II, although he professes to have ruled over them. For Sriparvata=Srisailam see above, Vol. IV, p. 195. TEXT. First Plate ; Second Side. i afar [] (]greiZITANICHTuna w] 2 Pirmagtatraufsata PIARAZA3 NikhacitacaraNayugalakamalasya mahArAjasya zromA4 4 : fogat 1991962[af]augfqafa Seconl Plate; First Side. fuafa 6 (1 auta 1947*. fragata 6 ayavinayasatvasaMpanI' bhagavacchIparvatasvAmipAdAnu But not in -svadhyaya- (1. 8) and -dayano (1.12). See shove, lio. 20. Deo above, Vol. XI, pzzo, ant et. Vol. IX, p. 209. From luk inpresions en plied by Ruo Bahadur H. Krishna Sastri. Tloud Wegne. * leader
Page #376
--------------------------------------------------------------------------
________________ Ipur Plates of Madhavavarman II. 04A-8255 A XX DJUK COLX H. KRISHNA SASTRI. SCALE THREE-FOURTHS WHITTINGHAM & GRIGAS, PHOTO-LITH.
Page #377
--------------------------------------------------------------------------
________________ Seal
Page #378
--------------------------------------------------------------------------
________________ No. 21.] IPUR PLATES OF MADHAVAVARMAN II. 339 7 at fag - - [A]T9[]af 0-2-FORUA gara [a]HT 8 vafa JUTHATHEFTER ATT 9 . . 10 HT. 11 A . - - Second Plate ; Second Side. . . . . . . . . afa [*]-[T]. . . . . . . . . [#f]*. . . . . . . . . tage xurretia[:*] [g]fi [funa) [*] e [Fe] Third Plate ; First Side. 13 [a]es faux[rufe]+[1]HT[MUUTETET] , [80] o s a o 14 bahubhirvasudhA dattA bahubhivAnupAlitA [1] yasya yasya yadA bhUmi15 [Fe] ng ati C IETENI Trenia o in agai4 ] 16 [sai] taure (]Xfuafa fafcufafan] TRANSLATION (Line 1.) Hail! From [Ama]rapura, the dear grandson of the glorious Maharaja Madhavavarman, who had removed the stains of the world by bathing at the end of eleven Advamedhas ; who had performed thousands of Agnishtoma sacrifices ; (and) whose pair of lotus-feet was studded with the jewels on the top of the diadems of many bowing) vassals ; (L. 4.) the dear son of glorious Devavarman, who displayed matchless, well-known valoar in sttacking warriors ; (L. 5.) the glorious Madhavavarman, the lord of the Trikuta and Malaya (mountains), who is endowed with policy, modesty, and honesty; who meditates on the feet of the holy lord of Sriparvata ; (and who belongs to the family) of the Vishnu[kundins], commands as follows the men at the village of . . . . . [Line 8 f. seems to refer to two donees, Agnisarman and Indragarman.] (L. 12.) The command (ajna) of this edict' was ennobled by the meditation (P) of the overlord of the Vishoukunding. (L. 13.) The year [4] 7, the 7th day of the 7th fortnight of the rainy season. Oni. [Lipes 14-16 contain two of the customary Slokas.] E 1 Restore perhaps fawgfeat. * Expressed by a symbol. . These two epithets occur also in line 6 f. of the other Ipur plates (above, No. 20). * Cf. asya foranas-disaptih: South-Ind. Inscr., Vol. I, p. 57, text 1 118 1. . With vi pa 7 cf. asa 6 in the Firabadagalli plates (above, Vol. I, p. 7); varska-pakshi chaturttha (Vol. III, p. 262); naraha-pakshah aahtamah (Ind. Ant., Vol. VII, p. 37); ridad pakha 8 in two inscriptions at Jaggayyapats (ASSI, Vol. I, p. 110); va Pa 4 at Karlo (above, Vol. VII, p. 64)vana padhe 2 Mod pa sina pakho 4 at Nisik (Vol. VIII, pp. 71, 736) 3
Page #379
--------------------------------------------------------------------------
________________ 340 EPIGRAPHIA INDICA. [VoL. XVII. No. 22.-REVISED TEXT AND TRANSLATION OF TWO OF THE KURAM PLATES. BY PROFESSOR E. HULTZSCH, PH.D., HALLE. Some time after I had published the Kuram copper-plates of the Pallava king Paramesvaravarman 1,1 the late Professor Kielborn recognised that plates III and IV of that inscription in wbich I had noticed only two verses, are all in poetry. I now reprint the very corrupt text of this portion of the inscription (11. 19-49), arranging it in verse lines, correcting the writer's mistakes, as far as I am able to do this, in notes, and adding a fresh translation. Rao Bahadur Krishna Sastri was good enough to contribute to this article a few additional conjectures, viz. dhanuSi, verse 123; yuktabhaTe or uttabhaTe, v. 14 : mRgamadadeg , v. 15; kRtavAn, v.21; spaSTa , v. 23. The subjoined passage consists of 22 verses (5-26). The relative pronouns in verses 5, 6, 21, avd 26 refer to the name of the donor Paramesvaravarmma, l. 19) at the end of the preceding probe passage. Verses 8-21 form one long relative sentence, describing the king's victory over the Chalukya king Vikramaditya I. Verses 22-26 praise Parames varavarman's state-elephant Arivarana, his charger Atisaya, his dagger, and his girdle. TEXT. mahendravammaMgaH . . . . . putra[:]. . . . . paramezvaravarmA bharata iva sarvadamana[:*] sagara iva kRtAsamaJjasatyAgaH [*] . karaNaM va puSkalAMgo yaH priyaka[*]vyo yayAtiriva [ // 5 // *] . (a) Metre of verses 5-9 : Arya (30+27 matras). anupanatA rAnA (a) yasthAtrA mapati sarvadApIkA (6) [1] saiva muhadAmprayacchati sukhazobhA (e) karNapUratayA [ // 6 // *] (a) Read rAjA. (B) Read degpauDa:. (c) Read degzomA. catura kalAvilAsa niyatam yAMdo (a) bhavatyanaMgasya [*] mulAguNasta daye muktAguNa eva vanitAnAm [ // 7 // *] (a) Read niyataM caMDI agaNitanarahayakarikukhavimai janitena reNatahinena [*] pAropitamimaNDalasAdRzyasahasrakarabimbe [ // 8 // *] pagAravagalitoye vikozanistriMzatviAdAbhoge (a) [*] pracaritakucarajalade vikAlavarSAvatAra iva [ .. *] (a) Rond degnisviMzavidyu (dyu)deg 1 South Indian Insoriptions, Vol. I, pp. 144 f. As the notes on the text are numerous and contain long Nagari passages, I am using for them ordinary type Instead of the small and indistinct note-type, which, w I know from experience, is liable to breaking and dropping.
Page #380
--------------------------------------------------------------------------
________________ TWO OF THE KURAM PLATES. tuMgaturaMgataraMge pracaratkarimakarajanitaviSamAvatto (a ) [ 1* ] aviraLamudokhe vijRmbhamANe samudra iva [ // 10 // *] (b) (a) Read baseM. (b) Metre : Sugiti ( 32+ 27 ). khaGgalatAvaraNayute sazarAsananAgatilakapunAgaghane [*] utakalakalazabde kAnana va caNDavegapavanAkulite [ // 11 // * ] (a) (a) Metre: Aryagiti (32+32). yodhApurotadhanuSu (a) vyatipatitapatavirudda pavanaphathe ( 6 ) [ 1*] pracaritatomarazaktiprAsagadA kaNaya kappaNacakre (c) [ // 12 // *] (d) (c) Read t (a) Read yodhApuritadhanuSi (b) Read pavanapathe. (30+29). anyonyalIzaradana kulIzasthira kilitavadanamattagajabRnde (9) [ 1*] anyonyamUIpAtitakhaGgavyatiSaktaturagasAdigaNe [ // 13 // *] (8) (a) Read anyonyaradanakulizasthirakaulita', (b) Metre : Giti (30 + 30 ) . zastrAzastrakacAkacidaNDokiyApravyaktabhaTajane (a) [*] anyonyasadRzagaNanaparibhavanoryyAtanA ( 6 ) [ // 14 // *] (a) Read zastrAstri kacAkacidaNDAdaDikriyA prayuktamaTe or pravRttamaTe. The remainder of this verse is left out by the writer. (d) Metre: Pragiti 341 (b) Read deg gaNanAparibhavaniyatanA mRzamadamizrItazoNita kuMkuma ghanalipya [mA* ] nabhUmitale (a) [1*] virahitanipatitabAhugrIvAjaM [ gho] rukANDa dantabalauye ( 6 ) [ // 15 // * ] (c) (a) Read sRgamadamizrita (b) Read 'laughe. (c) Metre : Lalita (30+32). myUhasa[mpA] tavidorNaprajavitavidruta[bhUmita] tobhayapace (a) anyonyajayaparAjayasandeha meM khalagna lakSmIvihite ( 6 ) [ // [1*] 16 // *] (c) (a) From [mpA]a to the end, this line is engraved on an erasure. To satisfy the metre abhisampAta might be read. (b) Read perhaps fvadite. (c) Metre of verses 16-19: aryagiti. rudhiroghapAlikA yItapatitagajazreNipRSTavicaratsubhaTe (a) [1*] anyonyaghAtarandhrAnadhi [ga] malapta kkiyAyatasthitayodheM ( 6 ) [ // 17 // * ] (a) Read rudhiraughapAlikAyita' and 'pRSTha (b) Read 'lupta kriyAyita. strodyatabhujadaNDe : (a) sArambhavilohitAca daSToSThapuTai [:*] (6) [1*] rAjanyai[:*] kRtakRtyaiH nohatitA [I] itairitasthitaH (c) saMkIrNe ca (d) [ // 18 // * ] (a) Read zastrI. (b) Read saMrambha.. (c) Read kRtyairnihatArddha hatairitastata:. (d) The metre requirer ca to be cancelled. zodhvajAtapatre[: *] patitagajazca (a) sitacalitacAmaranikare [*] tividitacUrNitamakuTaM gadahArakaTakakarNAbharaNe (6) [ // 18 // *] (c) Read gajAzva (6) Read makuTAMmada. 842
Page #381
--------------------------------------------------------------------------
________________ 342 EPIGRAPHIA INDICA. [ VoL. XVII. rudhiramadhupAnamattAgotakUmANDa[rAkSa]sapizAce [*] dattalayatalyakAlapratibhayanInaya'mkavandhazavayonI (a) [ // 20 // 1 (8) (a) Read bhayanatyatkavandhazatayonI. (b) Metre : Giti. [yone]kalAkSasAdhanamA[yodha]nazirasi (a) vikramAditya[m / *] kappaTamAtraparicchadam(b) ekAkipalAyitam [kata](c) [1] [21 // *] (a) (a) Read lakSa. (b) Read kappaTa'. (c) Read degcchadamekAkipalAyitaM kRtavAna. (a) Metre : Arya. rakhaprabhAkhacitakAJcanazAribandha (a) sAbAba() nAgamakivAraNanAmadheya[ma*](c) [*] nityAnubandhamadanijaramaTrinAtha (d) sAkSAdiva hipasahasrakatAniyAtram (e) [ // 22 // *(f) (a) Rend tao and Pami. (6) Read #918. () Read Pafcant. (d) Read "faitafeare'. (6) Read Ouargarga. (f) Metre : Vasantatilaka. tridazapatitaraMgasyevamaSTamaMgalayaH (a) parasaJcalasam pravyaktakalyANajAti (5) [*] . saragamatizayAkhyAM(6) ratnapalyANavantama satamapi (d) iyalacAmaracchanakaraNa : // 23 // *] (e) (a) Rend perhaps turaMgaspaSTamAMgalyayAtaM. (b) Read perhaps varamanalasakampavyaka. (0) Read yA (bapalyANa mantaM. (1) Read yutamapi. (e) Metre : Malini. samaraparizramasya sadRtvazamahapalamalayujavokam (a) [*] rattanakharamanupama (8) mANikyamarakatanivezamaNDanam [ // 24 // ] (c) (a) Read pramasadRzaM tvasamamahIpalamAlAyujamekam . () Read rabadeg and degmanupamaM ca. (c) Metre : Grti. zakSaNaguNaM guNantakaTisUtram udIrNaMm maNiprabham (a) [*] bhAsurakiraNamAlikoTamANikkamanadhamavizRtam (3) [ // 25 // *] (c) (a) Read guNavaskaTisUtramudaurNamaNiprabham . (6) Read degkoTimANikyamanamabhizrutam . (c) Metre : ? manasi bhayavi[---*]payanyArthivAnA- (a) dizi dizi caTitani| yazam puSpamAlA[ma*] (1) [*] idam maharadazeSa (c) satayA matAlacamyA saha vapuSI (d) vizeSAlaMkate vorakatyA [ // 26 // *] (e) (a) Read perhaps bhayAveSAdAvarSa. (6) Read palitArihoM yazApu. (c) Rand gyamAradazeSa, (d) Rend agiu. (e) Metre: Malins.
Page #382
--------------------------------------------------------------------------
________________ No. 22.] TWO OF THE KURAM PLATES. 348 TRANSLATION. . Mabendravarman's.....son (was)..... Paramesvaravarman, (Verse 5.) who was & subduer of all enemies), just as Bharata (bore the surname) Sarvadamana'; who avoided improper conduct (asamanjasa), just as Sagara banished (his son) Asamanjasa; who possessed a strong body (ariga), just as Karpa (was the king) of the rich Angas; who was fond of poems (karya), just as Yayati was fond of (his father-in-law) Kavya (Uganas); (Verse 6.) whose command always becomes a chaplet on the heads of (i.e. is received with respect by) independent kings, (bat) also confers splendour on the faces of i.e. fills with joy) (his) friends by reaching (their) ears, (just as an ear-ring (karnapura) becomes an ornament to the face]; (Verse 7.) (who) is clever in the sport of fine arts (kula) (and) constantly passionate in ove, and who avoids vice (mukt-aguna) in (his) heart, (but) also becomes) a pearl-necklace (mukta-guna) on the breast of (his) wives; (Verse 21.) who put to flight Vikramaditya, --Whose army (had consisted) of several lakhs, (but who was left) quite alone (and) covered only by a rag, at the head of a battle, (Verse 8.) in which the disk of the sun was made to assume the likeness of the circle of the moon through the mist of dust produced by the stamping of countless troops of men, horses, and elephants; (Verse 9.) which inspired terror through the thunderlike sound of kettle-drums; in which unsheathed swords (reminded of) the curves of flashes of lightning; in which elephants were advancing like clouds; (and which therefore) resembled an unseasonable breaking of the monsoon; (Verse 10.) in which tall steeds (looked like) high waves; in which elephants tore up the ground on their path, just as sea monsters produce whirlpools in diving up; in which conches were incessantly blown (or: cast up); (and which therefore) resembled the gaping ocean; (Verse 11.) which contained curved swords and shields (drarara), (resembling) rhinoceroses, creepers, and varana (trees); which teemed with heroes holding bows and (riding) mighty elephants, as if it were) covered with Sara (grass) and with asana, naga, tilaka, and punnaga (trees); in which confused noises were raised; (and which therefore) resembled a forest agitated by a violent wind; (Verse 12.) in which bows were bent by Warriors; in which the air was obstructed by arrows flying past each other; in which javelins, pikes, darts, clabs, lances, spears, and discuses were flying about; (Verse 13.) in which troops of mast elephants firmly impaled each other's faces with the thunderbolta of their tusks; in which squadrons of horsemen were connected by their swords that had struck each other's heads; To make the construction clear, I had to place verse 21 before verso 8. ? Cf. Mahabharata, 1, 74, 8; VII, 68, 7, and Sakuntala, ed. by Cappeller, p. 93, 1. 2; p. 95. 1. 84; P. 97, 1.8, p. 102, 1. 21. In the epic poems be is called Asamajs or Asamaisa. * The poet neeias to hint a comparison of the king to the moon, who is charming is the splendoar of his digita (kala),' and to Sive, who was angry with the god of love."
Page #383
--------------------------------------------------------------------------
________________ 344 EPIGRAPHIA INDICA. [VOL. XVII (Verse 14.) in which soldiers were engaged in fighting with sword against sword, pulling of hair against pulling of hair, and club against club; .......... considering * each other as equal (or) despising each other); (Verse 15.) in which the ground (seemed to be) thickly smeared with saffron, as the blood (of the wounded) was mixed with the musk anointing their bodies); in which (both) large armies had lost and dropped arms, necks, shanks, thigh-bones, and teeth; (Verse 16.) in which, during the encounter, both parties were broken, urged on, put to Hight, and stretched on the ground; which was witnessed by the goddess of fortune sitting on the swing of doubt about mutual victory and defeat; (Verse 17.) in which brave Warriors were marching on the back of lines of fallen elephants forming a bridge over the flood of blood; in which soldiers stood rendered motionless, as their blows did not hit each other's weak parts; (Verse 18 f.) which was covered here and there with elephants which had fallen (simultaneously with shattered banners and parasols), and whose respirations waved the mass of chowries and with dead (or) half-dead warriors who had done their duty, whose strong arms (still) raised the weapon, whose lips were bitten, and whose eyes were deep-red with fury; in which tiaras, armlets, necklaces, bracelets, and ear-rings were broken, crushed, and pulverized; (Verse 20.) in which Kashmandas, Rakshasas, and Pisachas were singing aloud, as they were intoxicated by drinking the liquor of blood; (and) which contained hundreds of headless trunks dancing together in a fearful manner and beating the time (with their hands). (Verse 22.) Having caused to be accontred the elephant named Arivarana,-whose golden howdah was studded with the splendour of jewels, the flow of whose rut was incessant, (and who therefore) resembled the king of mountains (Himalaya) himself, whose torrents never cease to flow,- followed by thousands of (other) elephants ; (Verse 23.) also the excellent horse named Atisaya; -who displayed the majestic stepping of the horse of the lord of gods (Indra); who manifested his noble breed by his active jumping; (and) who bore a saddle (set with) jewels, ---accompanied by lakhs of (other) horses whose ears were surmounted by chowries; (Verse 24.) (and having put on) an unique and unequalled curved dagger (set with) jewels, which was fit for the fatigue of battle, attached to a string of matchless big stones, (and) ornamented by being inlaid with rubies and emeralds; (Verse 25.) (and) a valuable, priceless, famous girdle (which was strung) on a soft string, which emitted the splendour of gems, and the ruby at the end of which resembled) the bright san; (Verse 26 ) he (viz. Paramesvaravarman) who had destroyed his enemies, inspiring with fear (and despair] the minds of princes, and spreading) the flower-garland of (his) fame in all regions, carried all these (ornaments) on his body that was highly adorned with heroic deeds, -along with the powerful goddess of fortune clinging (to him). This seeing to refer to verse 24t.
Page #384
--------------------------------------------------------------------------
________________ No. 23.] DHANAIDAHA INSCRIPTION OF KUMARAGUPTA I: THE YEAR 113. 345 No. 23.-DHANAIDAHA COPPER-PLATE INSCRIPTION OF THE TIME OF KUMARAGUPTA I: THE YEAR 113. BY RADHAGOVINDA BASAK, M.A., CALCUTTA. This inscription, engraved on a thin copper-plate which now looks very much worn out and fragile, was discovered about a decade and a half ago in a village called Dhanaidaha in the Natore Sub-division of the Rajshahi District in the Rajshahi Division of the Bengal Presidency. Babu Akshaya Kumara Maitreya, B.L., Director of the Varendra Research Society of Rajshahi, obtained it from Maulvi Muhammad Ershed Ali Khan Choudhuri (now Khan Bahadur), and it is now deposited in the Museum of the Society along with the five copper-plate inscriptions of the Gupta period recently discovered at Damodarpur in the District of Dinajpur. It was edited in 1909 by Mr. R. D. Banerji, then of the Calcutta Museum, in the Journal of the Asiatic Society of Bengal (Vol. V, No. 11, pp. 459-61). Mr. Banerji's decipherment of the inscription was not correct, and the text as prepared by him contained some mistakes. Mr. Vincent Smith in his Early History of India (3rd Edition) has referred to this epigraph by the name of the Natore inscription in a foot-note at page 327; but he could not make out any material for the history of the period, probably because Mr. Banerji's reading was unsatisfactory and because of his remarks that "the wording of the record is rather difficult to interpret," and that "no continued translation is possible of the text." While editing two of the Damodarpur inscriptions belonging to the same monarch's reign, I had to revise the reading of * this inscription, and I re-edited it in the Bengali monthly, the Sahitya of Calcutta, in the Pausha issue, 1323 B.S. I now record the results of my decipherment in this Journal for the scrutiny of scholars. Some of the chief mistakes in Mr. Banerji's reading will be pointed out below in the foot-notes. Other differences in our readings may be left to be found out by those of our readers who may care to do so. The inscription is a fragmentary one, consisting of 17 lines of writing incised in the early Gupta characters of the 5th century A.D. It is written on one side only of the plate, which is now very much corroded. In length the full plate seems to have been almost twice the fragment now preserved, which measures 5%" x 51". Almost the whole of the proper right half of the plate is broken and lost together with the upper right and lower left corners. From an examination of the portions of the writing preserved in lines 14-16, which form parts of the wellknown imprecatory verses, it can be ascertained that about a dozen and a half letters are cut off from the proper right side of each of the lines. This loss of almost half of the inscribed portion and the extremely blurred state of the letters preserved are the greatest obstacles in explaining the document. But the five newly discovered Damodarpur copper-plates and the four Faridpur grants' have helped us much in deciding that the present plate also, like them, is not an ordinary royal land-grant, but is a sale-deed embodying the record of a purchase of land for the purpose of donation. Mr. Banerji states that the fragments of the proper upper right corner, which was broken in the exhibition grounds of the Calcutta Industrial Exhibition of 1906-7, contained the two letters ma and ra, which, he thinks, were evidently the second and third syllables of the name of the emperor Kumara-gupta. The inscription is dated in 113, which must be referred to the Gupta era, and this evidently proves that it belonged to the time of the Gupta Above, Vol. XV, No. 7. I take this opportunity to acknowledge most thankfully the suggestion of Mr. K. N. Dikslit, M.A., Superintendent of Archaeology, Eastern Circle, that I should bave read 128 in place of 129 and 224 in place of 214 as the dates in Plats Nos. 2 and 5 respectively of the Damodarpur inariptions These corrections in the dates do not quite materially affect the historical deductions I made in my paper on them published in this Journal. Indian Antiquary, 1910 and J. A. S. B., 1911, No. 8.
Page #385
--------------------------------------------------------------------------
________________ EPIGRAPHIA INDICA. [VOL. XVII, monarch Kumara-gupta I. The language of the inscription is Sanskrit, and it is in prose throughout excepting in lines 14-16, which contain the three imprecatory verses. Mr. Banerji's statement that "the bad state of preservation makes it very difficult to make any remarks on the orthography" cannot be upheld; for, the following points in respect of orthography may easily be observed: (1) as in the Damodarpur copper-plates, the sign of the medial a is attached by a hooksign towards the bottom of the lower right of some of the letters, especially of kha, ga and na, e.g. khasaka l. 5, Khada (ta ?)para- 1. 7; gram-ashta- 1. 6; and gun-aguna- 1. 13; (2) the sign of dvagraha is not used, as in -vishaye-nuvritta- 1. 7; (3) the letters ga, na, ta, ma, ya and va (and not sha, e.g. varsha- 1. 15) are doubled with a preceding r, e.g. vargga- 1. 4, svargge 1. 15; utkirnnam 1. 17; kirtti 1. 4; -sarmma 11. 3 and 5, dharmma 1. 8; -maryyada- 1. 7; and -pureva ll. 2 and 16, sarvva l. 9; 846 (4) m has sometimes been joined with following pa and va, e.g. in evadattam-paradattam-va 1. 14; and (5) ka has been doubled with a following r, e.g. in kkramena (na) 1. 8. The form of the initial vowels a, i and u are seen in the following words respectively, Byuktaka 1. 11, iha 1. 7, and utkirrnam 1. 17. The form of the letter me in kkramena(na) 1. 8, sarvvam-eva 1. 9, Stha (Sta)mbhetvara 1. 17, and -kulyavapam-ekam 1. 11, is to be noticed. For a similar incision of me, especially the mark in it, we may compare the words kavyam-esham 1. 31 in Fleet's, C. I. I. Vol. III, No. 1 and guham-etam 1. 5 (ibid, No. 6), and the word doshagramo 1. 1 (wrongly read as das-agrena by Mm. H. P. Sastri and Mr. R. D. Banerji) of the Susunia Rock Inscription (above, Vol. XIII, p. 133). In my paper on "The Five Damodarpur copper-plate inscriptions of the Gupta period," published in this Journal (vide Vol. XV, Part III), I made a remark at the outset that those sale-deeds, which our present inscription resembles, "may be regarded as having roughly six different parts in the form in which they are drawn up." The same remark holds good with regard to this inscription also. the first part ends with the word vijnapita 1. 7, the second with da[tum] 1. 8, the third with tad-avadhritam-iti yatas 1. 10, the fourth with ekam dattam 1. 11, the fifth with -Varaha-svamino dattam 1. 12, and the sixth with the rest of the grant. The contents of the inscription may be stated as follows:-In the year 113 G.E. (=432-33 A.D.), belonging evidently to the reign of Kumara-gupta I, some one (very likely a royal officer, an ayuktaka) whose name seems to have ended in -vishnu (1. 7) approached the village householders, the mahattaras and the ashta-kul-adhikaranas and perhaps also the local government of the district and expressed to them his desire to purchase one kulyavapa of cultivated land by paying the price at the usual rate prevalent in the vishaya of Khada (ta ?)para. It seems that the applicant wanted to buy the land by destroying the nivi-dharma (the non-transferability of it), i.e. with the right of alienation. His prayer was granted and the purchased land was severed for him by proper measurement. He in turn seems to have made a donation of the same to a Samavedin Brahmana (chhandoga 1. 12) of the name of Varaha-svamin. It seems very probable, though the mutilated condition of the plate does not permit us to be very confident on the point, that the Dhanaidaha plate contained a reference to the Pundravardhana bhukti being under a governor appointed by the Gupta ruler (compare the Damodarpur plates of the years 124 and 128 G.E., belonging to the same monarch's reign) and that the vishaya of Khada(ta?)para was, like Kotivarsha, one of the many districts of the same bhakti. In the Khalimpur copper-plate1 of Dharmapala, King of Gauda, though of the 9th century A.D., we have the names of two other vishayas, viz. Mahantaprakasa (1. 31) and Sthalikkata (1. 41), as being situated in the bhukti of Pandravardhana. Above, Vol. IV, p. 249.
Page #386
--------------------------------------------------------------------------
Page #387
--------------------------------------------------------------------------
________________ Dhanaidaha Copper-plate of the time of Kumaragupta I: the year 113 3.IN F. W. THOMAS WHITTINGHAM & GRIAGS, COLL. SCALE SIX-FIFTHS (ENLARGED)
Page #388
--------------------------------------------------------------------------
________________ No. 23.] DHANAIDAHA INSCRIPTION OF KUMARAGUPTA I: THE YEAR 113. 347 I edit the inscription from the original plate : TEXT. ....... mvatsaral-sat[@] trayodas-otta. 2... ... n-d[i]Vasa-parvvayam parama-daivata-para........ (?) katu[mbi]..... brahmana-Sivasarmma-Nagasarm ma-maha-5 4.::.va-kirtti-Kshornadatta - Goshthaka * Varggapala - Pingala - Suvkuka Kala.......pa (P)-vishnu - [Deva]earmma - Vishnubhadra7 - Khasaka - Ramaka Gopala6 ....... sa (?) su (?) Sribhadra-Somapala-Ram-idyah (?) gram-ashta-kul adhikarapan-cha 7....... vishnuna (?) vijnapita iha8 Khada(ta P)para-vishaye=nuvpittal maryyada-sthisti]8 ......nlvi-dharmma-kshayena labhya[te] [ta]d-arhatha mam10-ady inenaiva kkramena(pa) dastum] 9....... samatya=a(?; bhi hitai(th ?) sarvvam=eva * joa(?)kara-prativesi(?). kutumbibhir-avasthapya ka10........ ri * kana * yad-ito *' * [ta]d-avadhritamil-iti yatas tath=eti pratipadya 11 ....... vakala-nala[bhya]m-apavinchhya kshetra-kulyavapam=ekam dattam tatah syuktaka12 ....... * bhra(?)tri - kataka - vastavya18 . chhandoga - brahmana - Varaha svamino dattam tad-dha-[va ?] 13. ...... bhumya da[n-aksho]po cha gun-agunam-anuchintya sarira ka(ka)nchanakasya chi14 ....... * [u]ktan=cha bhagavata Dvaipayanena Svadattam=para-dattam [ll] Shashtim varsha-sahasrani(pi) 15. ...... [bhib] saha pachyate svargge modati [bha]mida) [18] 1 Read sanratsara.. * Read -ottare. Read asyon=dirasa.. * Rond -paramabhaffaraka. In the Damodarpar plates also Kamara-gapta I is styled parama-daivata. * Road, perhaps, mahattara.. *& Mr. Banerji ronds Kshamavanta and Vishyabhadra. * Mr. Banerji reads Maha-khushapara. * Mr. Banerji reads nivatta instead of amritta. 10 Mr. Banerji's reading "maiadya nanu oakkra lena () " instead of our reading "mam-adya=anen aiva Eleromona(na)" and his remark on the palaeography of his supposed la in his own reading lena () is Quwarranted. 11 Instead of avadhritan iti yatas-tatheti Mr. Banerji read dahyakam=iti yatast(y)ajati. 11 Read alfaka-navaka-nalabhyars. The sense of the whole docament depends on the correct reading of this line of the inscription, and Mr. Banerji's reading gives no help. His reading of the whole line is as follows:" .. ... vara nalaka sada (?) .chya ....... kritya vasa-lak. (?) datta tata suyuktaka ......." Mr. Banerji rends vantabhya (?) for vastavya and chandala () for ohlandiga. 14 Mr. Bauerji reads furu () gunan, 1 Mr. Banerji roads fasi ). SB
Page #389
--------------------------------------------------------------------------
________________ 348 16 17 [VOL. XVIL [Pu]rrva-dattam dvijatibhyo yatnad raksha Yudhishthira [*] mahim [mahi][matan-chhreshtha*] ya[m] su (?) Sribhadrena (pa) utkirnnam Stha(Sta)mbhe svara1dase[na] EPIGRAPHIA INDICA. TRANSLATION. In the year one hundred exceeded by thirteen on this day (as above specified), [during the reign of] parama-daivata parama-bhattaraka, etc. Kumara-gupta the ryots (of the village). the Brahmapas Sivafarman, Nagasarman and the Mahattaras [Do?]vakirtti, Kahemadatta, Goshthaka, Varggapala, Pingala, Sunkuka, Kala.. ., -vishpu, Devasarman, Vishnubhadra, Khasaka, Ramaka Gopala,. su (?) Sribhadra, Somapala, Rama and others, and the officers in charge of eight kulas in the village were informed by (some officer whose name appears to have the ending Vishnu 1. 7) as follows: "In this vishaya of Khadata ?)para the established custom (regarding the sale of culti vated land) prevalent ... to be had (at .. .. such rate) by the nullification of the custom of permanent endowments (nivi-dharma). So deign to make a gift (of land), this day according to this method.... by the neighbouring house-holders who are obedient and who are (thus) addressed establishing ... Whereas it was so determined, and whereas this determination was accepted by the statement "be it so "-one kulyavapas of cultivated land was given to him, with its area severed by the measurement of 8 x 9 reeds. Then the same land was given to the Chhandoga" (Samavedin) Brahmana Varaha-svamin, an inhabitant of the kataka of...., by this official (ayuktaka). So, considering the merit and demerit respectively of making a gift and confiscating (it), and (the unstability) of body and gold, (this gift is to be preserved). To the same effect has been stated thus by Bhagavan Dvaipayana (Vyasa): (1) Whoever confiscates land given by himself or by another becomes a worm in ordure and rots with his forefathers. (2) Land has been given by many kings, such as Sagara and others: the reward (of these grants) belongs to whosoever at any time possesses the earth. (3) 0 Yudhishthira, best of land-lords, preserve with care land already given to the twiceborn (Brahmanas); for, the preservation of land-grants is more meritorious than the making of a grant. Engraved by su (P) Sribhadra and (written) by Stambheevaradass. 1 Mr. Banerji reads the name as Sthahnesvara. 3 Vide my note on this word in Plate No. 4 of the Damodarpur collection, above, Vol. XV, p. 187. Fide my note on this word, ibid, p. 137. Mr. Banerji's explanation of this term as "a local officer (kuladhikarana) who exercised authority over eight villages" does not seem to be correct. He was rather an officer in the village having supervising authority over eight bulas (for the technical meaning of which see Kalluks commentary on Manu, VII, 119). Vide my note on the term nici in Plate No. 1 of the Damodarpar collection, above, Vol. XV, p. 131, n. 8, and Indian Antiquary, 1919, p. 14. Vide my note on this word on p. 182, above, Vol. XV. The word apavinchya occurs in the Faridpur grants (Indian Antiquary, 1910) and in Damodarpur plate No. 8, 1, 10, p. 136, above, Vol. XV. Chhandoga means one studying the Simsveda. For the use of this term vide Manu, III, 145, and the Banskhera Plate of Harsha, above, Vol. IV, p. 211. Kafaka may either mean a camp or the capital. Vide my note on the same in Plate No. 4 of the Damodarpur collection, p. 140, store, Vol. XV.
Page #390
--------------------------------------------------------------------------
________________ No. 24.) SOME IMAGE INSCRIPTIONS PROM EAST BENGAL. 3D No. 24.-SOME IMAGE INSCRIPTIONS FROM EAST BENGAL. BY NALINIKANTA BHATTABALI, M.A., CURATOR, DACCA MUSEUM. The short votive inscriptions recorded on the pedestals of images are often very usefal to the antiquarian in more ways than one. They not only illumine the darkness of the past like flash-lights by furnishing pointed and concise historical information, but the help that they give in determining the periods of sculptural history is by no means inconsiderable. Students of iconography too have reason to welcome them, since many votive inscriptions contain the names of the images on whose pedestals they are inscribed, helping thus to identify them easily. Below I edit six such votive inscriptions from East Bengal, in some of which all the three characteristics noted above will be found to exist to the fullest degree. 1. THE BHARELLA NARTTESVARA IMAGE INSCRIPTION. The worship of images of Natesa-siva (the dancing Siva) seems to have been a peculiarity of Southern India. Such images in metal abound in Southern India and Ceylon; but they are very rarely met with in the North-Indian Provinces. How Bengal came to share this pecuharity with the Deccan is one of the unsolved problems of history. We must, however, note here that north and west Bengal do not show this peculiarity, and it is only in the south-eastern districts, roughly comprising the ancient divisions of Vanga and Samatata, that images of the dancing Siva were discovered. The Dacca Mugenm has three excellent specimens, while a rather ill-preserved one is to be found in the Rajshahi Museum. I know of two other very well preserved Natosa images, which are being worshipped in two village in the Dacos and Tippera districts of East Bengal. The discovery of so many images of the same claas in & rather limited area cannot be accidental, and it is quite possible that their worship was introduced by some Saiva ruling family. The Sena kings, whose origin some trace to the Deecan, had their metropolis in Vikramapark in the Dacca district, in the heart of the ancient Vanga, as is at tested by the majority of their copper-plates, and they were renowned Saivas. It is very probable that the worship of Natoka. Siva came from Southern India with the Senas. It is worth noting that out of the seven images far discovered and known to me, five came from Vikramapura; and a village situated in the suburbs of the capital of the Senas in Vikramapura (a pargana in the Daoca district) contains the ruins of a big temple and is still called Natesvara. The present image, however appears to be earlier than the Senas. The inscription here edited was found on the pedestal of a huge image of Natoka-siva dur out of a tank in a village called Bharella, Police Station Badkimta, in the district of Tippers It was brought to my notice in 1911; and in 1912 I went to Bharella too late to save the image, which was broken to pieces by a fanatic Fakir; but I procured the inscribed pedestal for the Dacca Sahitya Parishat, where it is at present preserved. A large fragment of the figure of the god is now in the Dacca Museum. I edit the inscription from the original. The inscription is in two lines in four sections on foar planed faces of the pedestal, below the lotus-seat of the god. The whole inscribed sarface measures in length about 14", and that letters are approximately 1 long. The first section has suffered a little by the peeling of the stone, while the beginning of the third and the longest section has been altogether chopped off, damaging altogether 12 or 13 letters of each line. The first line runs connectedly to the end of 1 The image was found in the village of Kalikil ander Police Station Leahajang in the Vacon district. Svi thast not be taken as an instance of a find in north Bengal
Page #391
--------------------------------------------------------------------------
________________ 850 EPIGRAPHIA INDICA [VOL. XVII. the third section and then returns to the first section to begin the second line. The name of the sculptor is given in the fourth section in two lines The characters used are the ordinary north-eastern characters which gave birth to the modern Bengali script, and which even at this stage show distinct resemblance to the modern script of Bengal. Paleographical considerations would lead us to assign the latter half of the 10th century as the time when this inscription was incised. The date is missing; but it may be that the lost portion of the second line in the beginning of the third section contained a date. There are some data from which a date perhaps is obtainable by mathematical calculation. The image was consecrated on a Thursday, under the star Pushya, on the fourteenth day of the dark half of the month, the day being the 14th of Ashadha counted by the movement of the moon. It would be a very interesting calculation to lovers of astronomical problems to find out in which year or years between 900-1100 A.D. all these data met. I myself do not possess the necessary equipment for the calculation. Dewan Bahadur L. D. Swamikannu Pillai who was consulted by Mr. Krishna Sastri on my behalf kindly writes : "Between 900 A.D. and 1000 A.D. there are three dates which agree perfectly, viz. A.D. 912, 939 and 983. I have marked these with an asterisk in the accompanying list which shows also dates of less perfect agreement. There must be an equal number between A.D. 1000 and A.D. 1100. We cannot tell which of these dates is meant. Thursday Ashadha, ba. 14. Pushya. A.D. 905. Th. 4 July; .32; n. f. d. .75. A.D. 912. Th. 16 July; .09; .63. A.D. 925. Th. 21 July; f. d. t. .52; f. d. n. .68. A.D. 932. Th. 5 July; .52; f. d. n. .90, A.D. 939. Th. 18 July; .41; .86.* A.D. 942. Th. 14 July; f. d. t. .12; f. d. n. .89. A.D. 966. Th. 19 July; .71; f. d. n. .09. A.D. 969. Th. 15 July; f. d. t. .21; f. d. n. .90. A.D. 983. Th. 12 July; .03; .94. A.D. 993. Th. 20 July; f. d. t. .01; f. d. n. .30." He adds: "14th tithi means nothing more or less than 14th day by the movement of the moon. A solar month date would be different, but in a lunar month the days and tithis are the same in the Indian Calendar. In the Muhammadan, Jewish and Greek Calendars there may be a slight difference." The inscription refers itself to the 18th year of the reign of a king Layaha-Chandra by name. Kings with the surname Chandra are found on the thrones of two adjacent countries, viz. Vanga and Arakan. The Chandra kings of Vanga, who, like the Sena and the Varman kings, had their capital in Vikramapura, are known from two copper-plates. But no name in their geneology resembles Layaha-Chandra, which sounds indeed rather outlandish. We find an account of the Chandra kings of Arakan in Phayre's History of Burma, p. 45, and Numismata Orientalia, Vol. II, Pt. I, p. 42, by the same author, where we learn that the dynasty came to an end in 957 A.D. We know of another isolated Chandra king of Vanga, Govinda-Chandra by name, from Rajendra-Chola's inscription. Layaha-Chandra-deva must have belonged to one of these three lines. If Layaha-Chandra was of the Arakan line, 939 A. D may be taken as the date of this inseription. 1 Ep. Ind., Vol. XII, p. 188. and Dacca Review, Vol. II, p. 250. Recently a third plate of Sri-Chandra, dova was found and edited by me in the Darca Review for May and June 1919, 17. XII. 1919, Bp. Ind., Vol. IX, pp. 232,483,
Page #392
--------------------------------------------------------------------------
________________ No. 24.) SOME IMAGE INSCRIPTIONS FROM EAST BENGAL. 351 Ballade, at one time very widely popular are current about a king called Govinda-Chandra throughout Bengal. One was published by Grierson'in J. A. S. B., 1873. Another was published by Babu Sib Chandra Sil from Chinsura near Calcutta. I published a version by a poet called Bbabanidas, edited from two manuscripts of the song procured from the Tippera district. All these versions say that Govinda Chandra was the daughter's son of Tilak Chandra king of Meharkul which is still a pargana of the Tippera district. Govinda Chandra of RajendraChola's inscription and the Govinda-Chandra of the ballads appear to have been the same person, and Layaha may have been the name of the father of Tilak Chandra. Kusuma deva, whose son Bhavu-deva consecrated the image of Narttesvar, seems to have heen a vassal prince under the suzerainty of Layaha-Chandra, ruling over Karmmanta, which I am inclined to identify with modern Badkamta (the senior Kamta), some three miles southwest of the find-place of the image. Badkainta is still a place of considerable importance, being A police station with a big Zemindary kachery, situated within a spacious area surrounded by an ancient moat and containing two big tanks, in the smaller of which many ancient stone images of Brahmanical deities were found. Stone images, both Buddhist and Brahmanical, abound in the villages surrounding Badkamta, and testify to the former prosperity of the tract. The area surrounded by the moat probably indicates the site of the palace. The appellation Deva at the end of the names of Kusuma-deva and Bhavu-deva is also in favour of supporting their claims to royal dignity. My friend Prof. Radhag vinda Basak, M.A., however, is in favour of taking the word Karmminta to mean'a store of grain,' and degrading Kusuma-deva to the rank of an officer in charge of the royal granary. We know that the two plates of Deva Khadga published by the late Gangamohan Laskar in the Memoirs, A. S. B., Vol. I, were issued from Jaya-Karmmanta. I have elsewhere tried to show that Karmmanta the capital of the Khadgas and the Karmmanta of the present inscription are identical, and is the present Badkimta (J. A. S. B., July 1914). The language of the inscription is Sanskrit prose throughout. As to orthography, we may note the doubling of consonants after as in karmmanta (1.1), saruvakshara (1. 2), etc., but chaturdafyan (1.1) is spelt with one d. Numeral figures for 1 and 4 are used in designating the 14th day of Ashadha. The letters of the inscription are mentioned to have been engraved by one Rataxa; but Madhusudans seems to have been the sculptor who made the image. TEXT. Part I. i [fafura'] Amugureauretaforation ver[ey* ****o]wgert tithau dRSyati vAre puSyanakSave kamAntapAlo. 2 munaythigeantfoto BaHET[**....] poat wargfa 28 #gfany Tatata wafat: Part IT. i afany Way 2 aafa # 1 Expressed by a symbol ; see below, p. 852, Road yrafa
Page #393
--------------------------------------------------------------------------
________________ 352 EPIGRAPHIA INDICA. (VOL. XVII. N. B.-It is customary to read the auspicious symbol or in the beginning of an inscription as it and this interpretation has been adopted by eminent epigraphists like Hoernle and Fleet. Hoernle writes thus (Intro. Bower Manuscripts, Indian Antiquary reprint, p. 22) - "Indian manuscripts or records as a rule commence with some benedictory word, such as siddham success or swasti "hail' or with the sacred particle on. The last mentioned is almost universally used at the present day. It may be either written in full or indicated by a symbol. The latter takes the form of a spiral, which may turn either to the right or to the left, and which is probably a conventional representation of the sacred sarikha, or conch-shell." In editing the Mankuwar Stone Image Inscription of Kumara-gupta, where this symbol is met with for the first time, Dr. Fleet remarks (Corpus. Ins. Ind., p. 46, n. 3):-"As was usual throughout the whole of the period covered by this volume, this word is represented by a symbol, not by letters. Om is not of very frequent occurrence at the commencement of Buddhist inscriptions." Thas both the scholars read the symbol as on, but none has advanced any reason for their reading it so. Writing about eight centuries and a half earlier, Al Beruni also says the same thing (Vol. I, p. 173) "The Hindus begin their books with Orhthe word of creation, as we begin them with 'In the name of God.' The figure of the word om is a This figure does not consist of letters; it is simply an image invented to represent this word, which people use, believing that it will bring them a blessing and meaning thereby & confession of the unity of God." This passage of Al Beruni is perhaps responsible for the confident reading of Hoernle and Fleet. But the reading should be reconsidered in the light of the following points: (a) In Bengal, this symbol was largely used in all ancient documents and manuscripts and in teaching alphabets to beginners they were taught to draw this symbol to start with. This custom was prevalent as late as twenty-five years ago, but has disappeared by this time. This symbol was called athji and was supposed to signify the god Ganeka, the giver of success, being drawn to represent his elephant's trunk. In reading, it was read Siddhir-astu. (6) In the Gupta inscriptions this symbol only appears in those in which the customary benediction Siddharh is left out, and nowhere does it appear with it. Consequently it must have stood for Siddhath, and as time went on it must have become more and more customary to represent the word by this symbol. c) In some inscriptions the symbol is found to precede Or, which would never have been the case if the two were identical. In such cases the reading given is Or, Or, which is certainly not reasonable. Reference may be made to Epigraphia Indica, Vol. XII, p. 8, Ibid, Vol. XIV, p. 159, for examples of the joint use of Orin and this symbol. In view of these facts, the symbol, I think, should be read Siddhan or Siddhir=astw1 TRANSLATION. Part I. May success attend ! In the eighteenth year of the victorious reign of His glorious Lajesty Layshachandra-deva, on Thursday in the dark Fourteenth Tithi, and under the star Pushya, Bhivu-dava, son of Kusuma-dove, Lord of Karmanta, caused to be made the Lord Narttesvars .... on the 14th day of Ashadha (calculated) by the movement of the moon. And all the letters engraved by Ratoke. Part II. Also engraved by the illustrious Madhusudans. [This weths to be the proper interpretation of the symbol, in spite of Al Beruni's statement to the contrary. In the Tamil country the same symbol slightly modified 2 is even today called the Pillaiyar-fadi. Gapaia's usland in Ant taught to be dnwa by children before they begin to learn their alphabet.-Ed.)
Page #394
--------------------------------------------------------------------------
________________ No. 24.] SOME IMAGE INSCRIPTIONS FROM EAST BENGAL. 353 2. THE BAGHAURA NARAYANA IMAGE INSCRIPTION This inscription was brought to my notice in 1912, when I went to Tippera to secure the inscription described in the foregoing pages. Ramanath Chakravarty, a former pupil of mine, whom I met in Comilla, gave me to understand that an inscribed image of Vishnu had been discovered in a village near the Sub-divisional town of Brahmanbaria in the Tippera district and that the local people had been able to read the word Mahipala on the inscription. My curiosity was considerably roused to come across an inscription of the Pala kings so far east from their native home in north Bengal. Pressure of business, however, did not allow me to go after the insoription at that time, and for the next two years I was too busy elsewhere to think of getting at it. Towards the beginning of the year 1914 a friend of mine, Babu Upendrachandra Guha, B.A., B.T., who is an enthusiast in matters archaeological, secured chalked photographs of the inscription and published an article with a reading of it in the local monthly, the Dacca Review. The reading, however, was rather defective, and I gave a more correct reading in the next number of the journal. I also published a correet reading of the inscription in the January number of the J. 4. 8. B., 1915 and pointed out its importance. The image containing the inscription was dug out of a pond some ten or twelve years ago in the village of Baghaura near the Sub-divisional town of Brahmanbaria in the district of Tippera. It is now worshipped by a half-crazy woman in the neighbouring village of Vidyakata. In January 1915 I visited the spot and obtained some excellent photographs of the image ; but no amount of persuasion could prevail upon the woman to part with the image. The inscription purports to be of the third year of king Mahipala, presumably Mahipala I of the Pala dynasty of Bengal. It records the installation of the god Narayang in Samatata, included in the kingdom of Mahipala, by a merchant, Lokadatta, son of Vasudatta and hailing from the village of Bilakindaka, in furtherance of the religious merit of himself and parents. Bilakindaka is in all probability the village Bilakenduai, situated close to Baghaura. The importance of the inscription is twofold. First, it definitely settles the position of the kingdom of Samatata. There is no room for doubt now that the village of Bilakenduar must have been inside the kingdom of Samatata. Now let us recall what Yuan-Chwang sava about Samatata. The pilgrim came to the country of Samatata going 1,200 or 1,300 li south of Kamarupa. Taking 5 li to 1 mile, 1,200-1,300 li represent about 250 miles. The country of Samatata was about 3,000 li (i.e. 600 miles) in circuit and bordered on the great sea. The land lay low and was regularly cultivated. Now, if we look round for the country which must satisfy all these conditions and at the same time must include the Brahmanbaria Sub. division of the Tippera district, in which the village of Bilakenduki is situated, and if we remember that natural barriers such as mountains and rivers marked off one kingdom from another in those days, we cannot but accept the plain tract of land bounded by the Garo and the Khasi Hills and the hills of Tippera on the north and east, by the Lauhitya, or the old Brahmaputra river, on the west, and by the Bay of Bengal on the south as the ancient kingdoni of Samatata. It is a perfectly natural geographical unit with neatly marked boundaries. comprising the eastern half of the present Mymensingh and Dacca districts lying east of the Brahmaputra, the greater part of Sylhet, and the whole of the Tippera and Noakhali districts. The distances between countries recorded by Yuan-Chwang are, in all reasonable probability, distances between the capital towns; and the distance of 250 miles recorded by Yuan-Chwang between Kamarupa and Samatata is pretty accurately the distance between Gauhati and Comillal by any modern route. The circuit of 600 miles is also right and the tract, which is a vast plain, borders on the great sea. II am of opinion that Badkamta, 19 miles west of modern Comilla, was the ancient capital of Samntata. Vide my paper "A forgotten kingdom of East Bengal," J. 4, S. B., March 1914.
Page #395
--------------------------------------------------------------------------
________________ 354 EPIGRAPHIA INDICA. [VOL. XVII. There has been much discussion about the situation of the countries of Shi-li-ch'a-ta-lo Kia-mo-lang-kia, etc., mentioned by Yuan-Chwang in his account of the kingdom of Samatata; but no satisfactory solution seems to have been arrived at. With our present identification of Samatata we may proceed to consider their cases also. This is what we find in Beal's edition about them: "Going north-east from this to the borders of the ocean, we come to the kingdom of Srikshetra (Shi-li-ch'a-ta-lo). Farther on to the south-east on the borders of the ocean, we come to the country of Kamalanka (Kia-mo-lang-kia). Still to the east is the kingdom of Dvarapati (To-lo-po-ti). Still to the east is the country of Ishanapura (I-shang-na-pu-lo). These six countries are so hemmed in by mountains and rivers that they are inaccessible." 6 Now, the pilgrim says that the country of Shi-li-ch'a-ta-lo might be reached by proceeding north-east to the borders of the ocean. This anomalous statement seems to have puzzled every. body, including Beal and Watters, as the borders of the ocean are never reached by going north-east from Samatata, wherever its position might have been in eastern India, and the fact that all the original copies of the Travels available, as well as, the biography of the pilgrim, give north-east as the direction, has stood in the way of emending the text to south-east. My studied opinion is that in spite of the unanimity of all the versions, north-east is a manifest mistake for south-east and the apparent unanimity arises from the mistake having originated in a very early copy of the Records.' The very qualifying phrase that the direction would lead to the borders of the ocean is sufficient for the emendation. But the emendation is confirmed by the manner in which the succeeding sentences begin. The next sentence begins thus,-"Farther on to the south-east, etc." and this would lose all force if "south-east" had not been the direction spoken of in the previous sentence. If we accept south-east and move from Comilla in that direction to the borders of the ocean, we arrive at a place called at present Chattagram (Eng. Chittagong), which was anciently called Sri-Chattala, a name still frequently used. Is there any reasonable objection to identifying Yuan-Chwang's Shi-li-ch'ata-lo with Sri-Chattala of the present times ? It is evident that it satisfies all conditions. The second importance of the inscription lies in the fact that it throws some light on an obscure part of the history of the Pala kings of Bengal. The Bangarh plate of Mahipala I1 and the Dinajpur pillar inscription inform us that some usurpers drove Vigrahapala from the throne and that he, after losing his kingdom, took shelter in the eastern country where water abounds (dese prachi prachurapayasi). His heroic son Mahipala recovered the lost kingdom of his father. The two characteristics, water-abounding and eastern, agree, well with the present districts which composed the ancient kingdom of Samatata,-so well that it is impossible to suggest any other country which answers equally to the description; and little room is left for doubt that the eastern country alluded to was the kingdom of Samatata. The new Baghaura image inscription, which is the earliest of the reign of Mahipala, finally settles all doubts on the point. When we find that Samatata was under Mahipala so early as in the third year of his reign, we cannot but conclude that it was Samatata where Vigrahapala took shelter, suffering reverses in war with the usurper, and leaving north Bengal in the hands of the victor. The fact of the earliest inscription of Mahipala turning up in Samataia points to his having probably been crowned there and this was perhaps the loyal country used by him as the base of operations in his fight with the usurper for the recovery of his father's kingdom. The flaka in the Bangarh plate which describes Vigrahapala's sojourn in the eastern country has been copied also in the Amgachhi plates of his great-grandson Vigrahapala III, where, 1 J. 4. 8. B., Vol. LXI, pp. 77-87 and Gaudalekhamala, p. 91. Also Fp. Ind., Vol. XIV, page 224. 1 J. A. 8. B., 1011, p. 615. Ind an Antiquary, Vol. XXI, pp. 97-101.
Page #396
--------------------------------------------------------------------------
________________ No. 24.7 SOME IMAGE INSCRIPTIONS FROM EAST BENGAL. 355 curiously, it is applied to him. Mr. R. D. Banerji, M.A., in his Monograph on the Palas of Bengal, is inclined to discredit the statements of the floka on this ground. When & floka describing some events in the history of a monarch, occurring in a copper-plate of his son, is reproduced in a copper-plate of the great-grandson of that monarch and is applied to that great-grandson, it is presumable that the former application is correct, and the latter plate is (i) either a forgery or (u) the composition of a very silly panegyrist, who was unaware of the historical significance of the sloka and took it only as an attempt at conventional panegyrics, or (ii) the repetition denotes some similar event in the life of the latter monarch. The inscription is incised under the lotus-seat of a standing image of Narayana (Vishna) about 3' high, between two kneeling figures. It is in a perfect state of preservation and is legible throughout without any difficulty. The lines measure each 6" in length and the characters are " long. The characters belong to the North-Eastern variety, specifically called the Kutila character, which gave birth to the Bengali characters of the modern days. The inscription is dated; but the date is given in regnal years. It refers itself to the reign of a king called Mahipala, presumably Mahipala I of the Pala dynasty of Bengal; Mahipala II had a very short and troubled reign, terminating in the successful Kaivarta revolt. As the chronology of the Pala kings of Bengal is still uncertain, it is difficult to give the exact year of the inscription; but it cannot be far removed from 978 A.D. The language is Sanskrit. In orthography, the only point to note is the absence of the avagraha sign in punyayaso abh: (1.4). No distinctive mark of virdma is added to final consonants. There are numerical figures for 3, 2 and 7. TEXT. 1 [sithirastu]' sambat 3 mAghadine 27 zrImahIpAladevarAjcha 2 fifru TTR THE[I]Tae ATT fa(fa)wate3 koyaparamavaiSNavasya vaNikalokadattasya vasudattamuta4 sya mAtApitrorAtmanaca puNyayazopabhihaye TRANSLATION. May success attend. The year three, the 27th day of Magha. In Samatata, in the kingdom of Sri Mahipala-deva, this meritorious work, namely (the image of) the lord Narayana, is of the merchant Lokadatta, belonging to the village of) Bilakindaka- great devotee of Vishnu--son of Vasudatta, for the furtherance of the spiritual merit and fame of himself and parents. 3. THE KEOAR VISHNU IMAGE INSCRIPTION The inscription was discovered by myself in 1909. That year, in the month of June, I happened to be on a visit to the little village of Keoar, some three miles to the south-east of Rampal, the famous site of the ancient capital of the Sena kings of Bengal, in the Munshiganj Sub-division of the Dacca district. I found the image lying on its face, half buried in earth, and on turning it for inspection, I noticed the inscription. The image has now been fixed against the outside wall of the math in the same village. The inscription is incised on the pedestal of an image of Vishnu, about 3' in height. It is in four lines, each line measuring 7"; but the last line is an inch shorter, for want of plane space to write upon. The letters are about ' in height and are everywhere boldly incised. Memoirs, 4. 8. B., Vol. V, No. 3. Expressed by a symbol. Read tusfoort 30
Page #397
--------------------------------------------------------------------------
________________ 358 EPIGRAPHIA INDICA. [VOL. XVII. The second couplet has been much injured towards the end by the erosion of the stone, and the several letters could with difficulty be recognized. The inscription is in verse throughout, and consists of two couplets. The language is correct Sanskrit, with only a single exception, which is perhaps an engraver's mistake. The Wetters belong to the Kutila variety, current in Bengal in the 10th, 11th, and 12th centuries The inscription is not dated; but paleographical considerations would not possibly allow of an earlier date than the early part of the 13th century A.D. It records the installation of an image of the lord Vishnu by one Vangoka, great-grandson of Saurisarman, grandson of Pitamaha and the offspring of the couple Sayoga and Anuyami. The absence of a royal name in a pretty long inscription is rather remarkable, though by no means uncommc It may suggest that the inscription belongs to a period when there was no king worth the name to refer to at the time of the installation of the image. There is anothet fact which confirms this supposition. The Brahmana family to which Vangoka belonged is spoken of as hailing from some place in Varendri, i.e. north Bengal. They must have migrated to Vanga, which included the pargana of Vikramapura, the region where the image was found, not long before the installation of the statue, as the fact of their descent from a stock of Varondri was, in Vangoka's estimation, still of sufficient distinction to merit a special mention. The name Vangoka is also significant. In a family where the first three of the line are named in pure Sanskrit after the sacred names of gods, the naming of the fourth member after the name of a country signifies that he was born just after the family had migrated into that country, and the migration was an important event in the family history. The period at the end of the 12th century A.D. which necessitated the migration of Varondri Bruhmapas from north to east Bengal must have been the time when Lakshmanasena was worsted by Muhammad-bin-Bakhtyar, about 1200 A.D., and the old king and his court fled to Vikramapura. Muhammad established his court at Deb-kot, 14 miles south of Dinajpur, in the heart of Varendri, and orthodox Brahmanas must have had a rather hot time of it, necessitating flight to the Vanga country, where the Senas still had sway. The history of the reign of the sons of Lakshmanasena is very imperfectly known; but erasures of royal names on their copper-plates suggest fratricidal war and consequent anarchy, and the present inscription may well belong to this troublous period. TEXT. 1 [fafcend WHITUAIA PEITEHT fay: [] 2 artan i fagfa **** [w] 3 atacatoa ufow40 [] fuata. 4 au luat fra . TRANSLATION ay success attend ! Longing for residence in the heaven of Vishnu, this image of) the Lord Vishna was consecrated by Vangoka, hailing from [the village of] Tataka in Varindri, offayring of the body of Bayogs and (hegotten on) Anuyami, in the race of the Saint) Sandilya. grandson of Pitamaba and great-grandson of Surigarman. I should put it on record here that the mistance of my friend Prof Radhagorinda Bisak, X.A, of very great we to wo in obtaining correct decipherment and interpretation of the inscription. * Exiprested by a symbol
Page #398
--------------------------------------------------------------------------
________________ Some Image Inscriptions from East Bengal. I The Bharella Nartesvara Image Inscription of the reign of Layahachandra: the 18th year. CON SET LUKEA HAKUT, SCELTAL SCALE ONE-HALF ) II. The Baghaura Narayana Image Inscription of the reign of Mahi-Pala I: the 3rd year. can yadeva. paka dAdarAgAmadhyaha REIKI SCALE TWO-THIRDS III. The Kewar Vishnu Image Inscription. NEJPRD ken bulb mukhaalbe SCALE ONE-HALF IV. The Deulbadi Sarvani Image Inscription of Mahadevi Prabhavati, Queen of Deva-Khadga. NET SCALE FOUR-FIFTHS V. The Dacca Chandi Image Inscription of Lakshmana-Sena: the 3rd year. md yp m m diye naastphaal 2 WI LAI $17 abre con su SCALE TWO-THIRDS F. W. THOMAS WHITTINGHAM & GRIGGS, COLL.
Page #399
--------------------------------------------------------------------------
Page #400
--------------------------------------------------------------------------
________________ No. 24.] SOME IMAGE INSCRIPTIONS FROM EAST BENGAL. 4. THE DEULBADI SARVVANI IMAGE INSCRIPTION OF MAHADEVI PRABHAVATI, QUEEN OF DEVA-KHADGA. 357 Deulbadi is a village situated about 14 miles south of Comilla, on the trunk road running from Comilla to Chittagong. The image with which we are dealing was found about two decades ago by one Muhammad Faqir Choudhury, when demolishing the ruins of an ancien structure standing on plot No. 447 of the Settlement Map of Jammura, a mauza in which the small village of Dealbadi is included, under Police Station Chauddagrama, in the Tippera district. A fine brass statuette of the sun-god, in which the god is represented sitting inside his one-wheeled car, drawn by seven spirited horses, as well as some brass lingas, of which one was inscribed with a short votive inscription, were discovered along with the image of Sarvvani. Babu Taranath Chakrabartit, the then Sub-Inspector of Police in charge of the Chauddagrama Police Station, secured the images and placed them with one Kailas Chandra Chakrabartti of Deulbadi. There the images remained for about sixteen years, until they were bought by Babn Saratchandra Chakrabartti and Babu Nibaran Chandra Chakrabartti of the village Dajdi, Police Station Chandpur, District Tippera. These two brothers are the priests of a temple on the Chandimura peak of the Lalmai Hills in the district of Tippera, near the Lalmai Station on the Assam Bengal Railway. As the ungo installed in the temple of Chandi had long disappeared, these two brothers were anxious to get an image of Chandi for their temple, and they obtained the present image from a cousin of Kailas, who in the meantime had died. The image was brought to Comilla along with the other images discovered, and for cleaning they were placed in the care of Babu Mahesa Chandra Bhattacharyya, a well-known Homoeopathic druggist. When the images were with Mahesa Babu, the inscriptions on the Sarvvant image and on one of the lingas began to attract attention. Babu Anukulchandra Roy, Manager, Wards' Estates, Comilla, sent me an imperfect rubbing of the inscription on the image, I at once recognized that this was a new inscription of the Khadgas and wrote to Anukal Babu to that effect. With the help of Mr. F. C. French, C.S.I., I.C.S., late Commissioner of the Dacca Division and President of the Dacca Museum Committee, I opened negotiations for the acquisition of the image for the Dacca Museum and went over to Comilla and obtained rubbings of the inscription and photographs of the image. The owners of the image, after much persuasion by Rai Annadaprasad Sen Bahadur, the Additional District Magistrate, and Mr. T. Emerson, C.I.E., I.C.S., the then Magistrate of Tippera, consented to part with the image on condition that a duplicate should be made for them and a sum of money given. At this juncture the annual grant received by the Dacca Museum from the Bengal Government was reduced from Rs. 6,000 to Rs. 3,000 and all ideas of acquiring the image had to be abandoned. The image was taken to the temple at Chandimura and set up for worship. I am informed that it has since been stolen from the temple and lust sight of. The image is of the goddess Sarvvani, one of the forms of Durga. It is about 20" in height and rather heavy. A portion of the rim of the top towards the proper left is broken away and lost. The image is cast in low relief. The technique is rather crude, and the pose rigid. The goddess has eight arms, holding on the proper left, from the bottom upwards, the thunderbolt, the bell, the bow and the shield; and on the proper right, from the bottom upwards, the conchshell, the goad, the sword and the wheel. Two maids are on her two sides, holding fly-whisks. She stands on a lotus-seat on the back of a couchant lion, with a rather well-executed head. The image was gilt all over with thin sheets of gold, the pious work of queen Prabhavati, and the original gilding is still intact in places. The white patches in the photograph show where it still clings fast. **RG[<<*]NEW. 8c2
Page #401
--------------------------------------------------------------------------
________________ 858 EPIGRAPHIA INDICA. [VOL. XVII. The inscription refers itself to the reign of a king called Deve-Khadga of the Khadga line of kings, who ruled over Samatatal towards the end of the 7th century A.D. The existence of the Khadga line of kings in east Bengal became known from the discovery in 1884 of two grants of Deva-Khadga, evidently the most powerful monarch of the line. These two plates were finally edited by the late Babu Gangamohan Laskar, M.A., in the Memoirs of the Asiatic Society of Bengal, Vol. I, No. 6. The inscription records the names of three generations of the Khadgas ;-Khadgodyama, the founder of the line, his son Jata-Khadga and his son Deva-Khadga. All these names were known from the copper-plate grants of Deva-Khadga referred to above, and it has nothing new to tell as in this respect. It informs us that Prabhavati, queen of Deva-Khadga, caused the image of Sarvvani to be covered with gold leaves out of reverence for the goddess. The name of Prabhavati also was known previously, as she figures in one of the plates of Deva-Khadga As a donor of land to a Buddhist monastery. The royal family of Samatata seems to have been of a particularly religious turn of mind. Yuan-Chwang states that Silabhadra, the head of the University of Nalanda, came of the royal stock of Samatata. We can hardly conceive at this distance of time what an exalted position it must have been. As the head of the greatest centre of Buddhist culture of the time, he must have occupied the position of the dictator of the then Buddhist world. It is probable that he was a Khadga, and those who kept alive the name of Khadgas in later times tried in their way to emulate their illustrious predecessor by noble deeds of piety and benevolence. Deva-Khadga was a donor of land to Buddhist monasteries, and his wife and sion also followed in his footateps, as appears from his grants. Yuan-Chwang calls the king of Samatata & devout Buddhist and Deva-Khadga seems very well to merit this appellation The pious soul of queen Prabhavati has once again spoken to posterity through the present discovery. The image reveals a curious state of religions belief prevalent in those days. Queen Prabhavati and the members of her husband's family were all devont Buddhists; but all the same she did not feel it irreligious in any way to pay reverence to a goddess who must have belonged to the Brahmanical pantheon. Harshavardhana, to whose court Yuan-Chwang came, in a simi. lar manner divided his veneration among the Buddha, the Sun-god and Siva. All these clearly show that we must revise our idea of the Buddhists and Hindus of ancient days as two com munities shut up in watertight compartments. They were more like the present-day Saktas and Vaishnavas than otherwise. Asrafpur, near the bank of the old and the real Brahmaputra, the find-place of the two plates of Deva-Khadga, and Deulbadi, sixty miles south-east, almost at the foot of the hills of Tippera, the find-place of the present image, mark respectively the western and eastern limits of Samatata, the kingdom of the Khadgas. The inscribed surface at the base of the image is about 8" in length, and the characters are approximately 1' long. They are bigger in the two extreme sections than in the middle one. They are incised pretty deeply and are in an almost perfect state of preservation. The characters belong to the Eastern variety of the Gupta script current in Bengal towards the end of the 7th and the beginning of the 8th century A.D. Mr. Laskar, at the time of editing the plates of Deva-Khadga, assigned them to "the 8th or 9th century A.D.", while Mr. R. D. Banerji in his Bengali History of Bengal is, on paleographical grounds inclined to push the date still further forward. I believe, however, that these Khadga inscriptions cannot be taken farther than the beginning of the 8th century A.D. No one, I believe, can Pide my paper" A forgotten kingdom of East Bengal," I. 4. 8. B. March 1914. * Vide leo Mr. Bagerji's Monograph on "The Palms of Bengal." Memoiro, 4. . B, Vol. V, No. 8. P 67.
Page #402
--------------------------------------------------------------------------
________________ No. 24.] SOME IMAGE INSCRIPTIONS FROM EAST BENGAL 359 compare the letters of the present inscription, as well as those of the two plates of Deva-Khadga, with the letters of the Nidhanpur plates of Bhaskaravarman, the Aphsad and the Shahpur inscriptions of Aditya-sena-deva, the Deobarnark inscription of Jivita-gupta, the Banskhera and Madhuban plates of Harsha, without coming to the conclusion that a span of about a hundred years covers them all. A comparison of the characters of the Khadga inscriptions with those of the earliest known inscriptions of the Pala kings leaves no doubt that the former must be considerably prior to the latter, possibly by about a century. There is nothing special to note in the orthography, except the doubling of after in Sarvvapi. The use of only one symbol for b and v is almost the rule in Eastern Indian inscriptions, as in the modern Bengali language. The language is correct Sanskrit verse. The inscription is in three lines on three sections ; the first two lines run over all the three sections, while the third line is incised only on the middle one. I edit the inscription from rubbings and photographs in my possession. TEXT. 1 [fefre] afet unght A zufacturer f STEW: [1] ___ tadAtmajo dAnapa2 fa: gaiuttgaut fafaatfiek: [*] Tree Etat mahiSI zrIprabhAvatI [*] sa(za)oNIpratimA Haar SAETATUT I ** TRANSLATION May success attend ! May welfare accrue! There was an overlord of kings, Khadgodyama by name. His son (became known) on earth (as) Jata-Khadga. His powerful and benevolent son Deva-Khadga was (like) a sword, a conqueror of all foes. Prabhavati, the queen-consort of this king, out of reverence for Sarvvapi, covered her image with gold. 5. THE DACCA CHANDI IMAGE INSCRIPTION OF THE 3RD YEAR OF LAKSHMANA-SENA-DEVA. The inscription is on the pedestal of an image of Chandi, discovered about four decades ago in the ruins of Rampal, the site of Sri Vikramapura, the capital of the Senas referred to in their land grants, in the pargana that still goes by the same name, included at present in the Dacca and Faridpur districts. It is at present worshipped in a small temple situated in the Dalbazar quarter of Dacca on the Farashganj Road, a little to the east of the Northbrook Hall. The late Babu Baikunthanath Sen, Deputy-Inspector of Schools, of Sonarang, District Dacca, was an enthusiastic collector of images, quite a crop of which used to turn up every year in the course of casual excavations in and around Rampal. These, on discovery, were usually put under a tree by & roadside to receive the chance worship of the passers-by. Sometimes they were put to altogether unholy uses and sometimes consigned again to neglect and oblivion. It does great credit to Baikuntha Babu that he alone, amidst the general callousness of his countrymen, was alive to the artistic and archeological merit of these relics of the past, and not a few of them owe their safe preservation to his labour. Many pieces of his collection are, it is gratifying to note, now in the Dacca Museum. This inscribed image of Chandi was one of Baikuntha Babu's finds, and he must have presented it to the founder of the temple in which it at present lies. 1 Ep. Ind., Vol. XII, p. 65. * Expressed by a symbol.
Page #403
--------------------------------------------------------------------------
________________ 860 EPIGRAPHIA INDICA. [VOL. XVII. The inscription, however, seems to have aroused little interest at the time of the discovery, and its existence was unknown to the gentry of Dacca. In April 1911 Mr. R. D. Banerji, M.A., of the Archeological Survey, and some friends discovered it, and from that time it has been known to the public. In August 1911 Mr. Banerji published a reading of this inscription in the Bhadra, 1318 (B.S.), number of the Pratibha, the journal of the Dacca Sahitya Parishat in an article on king Lakshmana-sona of Bengal. Four months later, in the Pausha number of the same journal, in & long article on the Sdna kings of Bengal, I gave my reading of the inscription. In June 1912 I published the inscription, with a half-tone reproduction of both the inscription and the image, in the Dacca Review, in an article on the era of king Lakshmapa-sena. In J. A. 8. B., July 1913 Mr. Banerji re-published it in his article on king Lakshmana-sona: The inscription has thug been published four times; yet it cannot be said that up to this time it has been properly edited Mr. Banerji's reading in the J. A. S. B., as well as his description of the image, is not free from mistakes. The image is about 30' high and is a rather fine example of Bengal sculpture of the time of the Senas. The goddess has four arms and she stands in a graceful tribhariga pose on a fullblown lotus over a couchant lion. Her apper left hand holds a bunch consisting of a half-blown lotus with some buds and leaves. The lower left hand holds an ornamental basket-like thing, either a flower basket or a waterpot. The upper right hand holds an elephant-goad and the lower one is in the Varada-Mudra. Two attendant female figures stand on the two sides of the goddess, and two elephants are pouring water over her from two pitchers. She seems to be a curious mixture of Gaja-Lakshmi and Chaudi and may represent the Sakti of the god Harihara. The inscription is in an excellent state of preservation. The inscribed surface is about 9?" in length, and the characters are approximately high. The characters may be called Bengali characters of the 12th century A.D. They are not very well executed and are far inferior in execution to those of the Deopara inscription of Vijaya-sena. They may be compared in style and coarse execution to the Buddha Gaya inscription of Asokachalla-deva execated in the 51st atita-rajya year of Lakshmana-8dna-deva (Epigraphia Indica, Vol. XII, p. 29). In this connection I may lay stress on a fact which is sometimes forgotten. Printed types have accustomed us to a standard; but in ancient times contemporary inscriptions varied as much in style as handwritings; because the inscriptions were always written with ink or lac on the surfaces to be inscribed and were then engraved by sculptors who were not always literate. The inscription refers itself to the third year of the era of king Lakshmana-Bena of the Sens dynasty of Bengal. As the era has been proved to have begun in 1119 A.D., the inscription must have been incised in the year 1121 A.D. It records that Adhikrita Damodara, son of Maladatta, began the image of Chandi in the third year of the era of Lakshmanasena and that his relative (younger brother?) Narayana installed the image in the fourth year. The inscription is in two lines on three sections. I edit it from the original stone. The language is incorrect &inskrit. Suta and adhikrita, which should have been in the 3rd case according to grammatical rules, are both used in the 1st case. TEXT. 1 zrImamANa- mAlade(da)ttasuta adhikSataH zrIdAmodare- zrInArAyaNana 2 sena devasva saM 1. zrIcaNIdevI samArahA tabAdakanA-pratiSThiteti // Indian Antiquary, Vol. XIX, p. 1.
Page #404
--------------------------------------------------------------------------
________________ No. 24 ] SOME IMAGE INSCRIPTIONS FROM EAST BENGAL. 361 Note on the reading. The decipherment of this short inscription presents some very serious difficulties. The fourth letter in what I have read as Maladetta is very curious. It bears little resemblance to any letter or compound used in the inscriptions of the time. Mr. Banerji has read it as Maladei; but certainly tta it is not like any i hitherto met with in the inscriptions of the period. It has moreover no perpendicular straight stroke to the proper left, distinctive of an i of the period. The following additional objections to the reading may be advanced : (i) Maladei must be a Praksit form of Mala-devi, and it is not easy to understand why a Prakrit word should be used in a Sanskrit inscription. (ii) The use of only the mother's name to denote parentage is unusual in a North Indian inscription. The letter that one would expect here is ta, reading the name as Maladeva; but the letter used does not bear the slightest resemblance to the va of the period or any of the va's used in this inscription. Then what is this letter? My reading of the letter as tta is only conjec. tural, based on the principle of greatest resemblance and possibility and on a surmise which I shall advance presently. [Perhaps we should read Mala-khadga.-Ed.] The second difficulty is about the reading of the name of the donor. Mr. Banerji has read it as Damodrona; but e is clearly absent from dra. We can read it at best Damodrana, which is inadmissible. I have read it Damodarena, which is admittedly the correct form of the word. It should be noted that the a mark of na, the letter below dra, is projected upwards to considerable distance. I believe the engraver wrote Damodana through mistake and attempted to put in re between da and nd. Want of space stood in his way, and he fared very ill. The projection of a of na should, in my opinion, be taken for the engraver's attempt to make a small ra, and the r mark of Damodra should be taken as the a he tried to make. I have this read Te betweel da and na. The next difficult word is what I have read as tad-bhradakand. Mr. Banerji read it as tabhradakana, which gives no meaning whatever, and which moreover is incorrect, as na has a clear a after it. The word must be a qualifying word of Narayanina, which follows it, and consequently must be in the 3rd case. It is also expected that the word should signify some sort of relationship between the donor and the founder, whose names prove them to have been close relatives. I have therefore read the word as tad-bhradakana, and would translate it as by his younger brother." The word bhradakana, again, is perplexing and new. I can suggest nothing better than that it was an irregular East-Indian compound of the two words bhrata and kantyan. Now, Damodara was evidently a high officer of the state, and we may expect to see his younger brother too in a similar position. We know from the Tarpandighi plate of Lakshmanasenal that one Narayana-datta was his minister of peace and war. Can this Narayana-datts be the Narayana of the present inscription ? Mala is an appellation of Vishnu, and the names Narayapa and Damodara are also names of Vishnu. It was evidently a Vaishnava family and the name of the father agrees well with the names of his sons. If our conclusions, which are based on a series of surmises, are right, and if Narayana of the present inscription can be identified with Narayana-datta, the minister of peace and war of Lakshmana-Bona, we may read the name of Damodara's father as Maladetta and emend it to Mala-datta by taking the of de as an engraver's mistake. Mr. Banerji read a visarga after iti, which is inadmissible; it should be read as 4, resembling the modern Bengali symbol for 4. It is not usual to put the two ciphers of a visarga in touch with one another as has been done in the present case. 1 Ep. Ind., Vol. XII, p. 6.
Page #405
--------------------------------------------------------------------------
________________ 362 EPIGRAPHIA INDICA. TRANSLATION. [VOL. XVII. The year 8 of the era of the illustrious Lakshmana-sena-deva. The (image of the) goddess Chandi was begun by the Superintendent (Adhikrita) Damodara, son of Maladatta and was installed by his younger brother Narayana (in the year) 4. No. 25.-A NOTE ON THE VAKATAKA INSCRIPTION FROM GANJ. (No. 4 of Vol. XVII of the Epigraphia Indica.) BY K. N. DIKSHIT, M.A., POONA. The last four paragraphs of the article on a Vakataka inscription from Ganj' illegible correction in the light of information available from the Poona plates of the thirteenth year of the Vakataka queen Prabhavatigupta (Ante. Vol. XV, p. 32 ff.) and another grant of the 19th year of Pravarasena (II) issued by the same queen Prabhavatigupta (Ind. Ant. Vol. LIII, page 48). The characters used in the Ganj and Nachna inscriptions are later in date than those of the Poona plates of Prabha vatigupta. The Prithvishena of these inscriptions is therefore more likely to be identified with Prithvishena II of the Balaghat plates, who was the greatgrandson of Prabhavatigupta and not with Prithvishena I her father-in-law. On paleographical grounds, Prof. Jouveau-Dubreuil attributes the Nachna inscriptions to the fifth century instead of the 4th and to Prithvishepa II, in preference to Prithvishena I (Ancient History of the Deccan, page 73). The present epigraph which is almost identical with the Nachna Inscriptions, can therefore also be assigned to Prithvishena II who must have lived in or about the last quarter of the 5th or the opening years of the sixth century A.D.
Page #406
--------------------------------------------------------------------------
________________ a, medial form of, abhaya, pose of hand, abbitvaramanaka, office, Achala-Laya, di., achari (acharya), an artisan, acharya (sthanacharya), acharya, title, Achyutapuram, vi, adhikarana adhikrita, office, adbiraja (adhiraja), Adigaiman or Adiyaman, a. a. Adiyan, Adi-Karttigai-pachchai, tas, Aditya-Sona-deva, Sena k., Adiyan, Kongu k., agamas,. Agapporal, s. a. Iraiyanar Agapporal, Agasti, s. a. Agastya, Agastya, sage, Agattiyam, Tamil grammar, agaval, metre (Tamil), Aggijja (Agnyarya), m., Agnikula kshatriyas, Agnisarman, m., Agnishtoma, sacrifice, agrahara, a Brahman village, agraharika, the resident of an agrahara, ahara, a territorial division, Ajaipur, vi, Ajanta, vi., Ajapura-naya, di., ajna, executor of a grant, ajnapti, do., INDEX.' 120 357 334 n. 1 . 347 360, 362 293, 297 n. 2, 305, 339 296 112, 117 359 296 PAGE 346 16 325 317, 318, 325 7. 292 . 830 192. 385, 337, 339 837, 339 204, 384 383 106, 107 317 13 317, 318, 324 335, 337, 339 294, 295, 296, 309, 339 n. 4 Akalankacharita, sur. of the W. Chalukya k. Satyasraya,. " . 16 294 m. 3, 297 328, 380 293, 304 298 n. 1 . * Akarika, office (?), 7,9 . 120 akhasali, a goldsmith, * 332 Akki-devi, sister of the W. Chalukya k. Jayasimha II, 121, 123 akshamala, symbol on the hand of the god Brahma-Sasta, 16 PAGE 332 akshapatalika, keeper of records, Akshasaraka, vi., 105, 106, 108 alabedai, symbol (Tamil), used in completing metrical quantity, Alberani, historian, Allahabad, vi., alphabets: Bengali, box-beaded, Deva-nagari, Grantha,. Gupta, Kanarese (Kannada),. Kutila, Nagari, Tamil, Telugu, Vattejuttu, Amarada-bobali, di.,. Amarapura, vi., Amavasya, the New Moon tithi, Ambasamudram, vi., 292 . 352 316 n. 2 Nandi-Nagari, Southern variety and its distinguishing features, Amgachhi, vi., amji, symbol for siddhirastu, Amma II, E. Chalukya k., Amoghavarsha I, Rashtrakuta k., Amritadeva, m., Anaimalai, hill, Anaimalai inscription, Ananda-gotra, family, Ananda, sage, anatti, s.a. ajnapti, Andhrakas, Anegondi, vi., anga-[bhoga],. Anga, co., angas, the six,. 189, 350, 355 12 310 1, 14, 291, 292, 293 345, 358, 860 7, 117, 121, 194, 202 355, 356 312 111, 194 12 .1,2 . 111 291 111, 117 338, 339 8 298 354 352 * 315 3 193 295, 296 292 328, 329, 330 328 294, 308 325 . 197 117 116, 343 204 . 1 The figures refer to pages: n. after a figure, to footnotes; and add. to the additions on pp. vii to xiii. The following other abbreviations are used:-ch.-chief; co.country; di.-district or division; do.ditto dy.-dynasty; E.- Eastern; f.-female; k.-king; m.male; mo.mountain; ri-river; s.d.-same ab sur, Jurname; te.-temple; vi.-village or town; W.-Western.
Page #407
--------------------------------------------------------------------------
________________ 364 EPIGRAPHIA INDICA. [Vol. XVII. PAGE Avapibhajana, sur. of the Pallava k. Mabendra verman I,. . . . . . . 15n. Avanichilamani Maravarman (1), Pandya k., 293 Avanichulamani, sur. of Maravarmap (1), 306 Avantivarman II, ch., . . . . 316 >> .4 avarana, a shield, , . . 343 Ayavel, k., . 294, 295, 296, 297, 307, 308 Aychakabbe, f., . . . . . 7, 10 aydam, symbol (Tami). . . . . . 292 Ayitajarys, m., . . . . . . 204 Ayodhya, s. a. Oudh Ayodhya, vi., . . . . . . . 193 ayuktaka, oficial, . . . 109, 346, 847, 348 * 350 124 . v PAGE Antukkura, . a. Gani-Atukuru . . . 328 Anushtubh, metre, . . . 197, 292, 318 anusvara, . . . . 291, 292 anusvara, unnecessary insertion of, . . . 194 Apuyami, f. . . . 356 apavinchhya,. . 348 . 6 ape banner, . . 120 Aphsad, vi... . 359 Arakan, di.,. . Arasibidi, vi., . . * 121 Arcbimides, astronomer, Arikesari Asamasaman Maravarmap (II) Pandya k., . . . . . . . 293 Arikosari Maravarman, .. a. Arikesari Asamass man Maravarman (II), . . . . . 297 Arikesari, skr. of the Pandya k. Maravarman II, 296, 297, 306 Ariketari, sur. of Pandi-pPerumbanaikkarap. .295 Arivarana, elephant, . . . .340 ., 344 ariya-puggalas, the eight, . . . , 325 Arjuna, epic hero,. . . . 305, 307, 326 Arsubidda, 4. a. Arasibidi, . . 121, 123 arthantaranyasa, figure of speech, . . 326 n. 2 Arya, metre, . . . . 292, 318, 340, 342 Arya, . . . . ; . . . 315n. Aryabhata, astronomer, . . . . 17, 24 Arya-siddhanta, astronomical work,. .8, 124, 125 Asamanja, Adamanjas, or Avatanjasa, myth. prince,.. . . . . . 843 & 1.3 Asamasaman, sur. of Maravarman (II), . 306 asana, tree, . . . . . . . 343 sshtabboga, the 8 kinds of enjoyment of land, . 204 ashtakula, . . . . . . . 348 sshtakul-adhikarans, office, . . . . 346 asbita-mahi-purusha-pudgala, 1. . ariya-paggalas, 322 Asokschalls-deva, Sapadalaksha k.,. 860 Asrafpur, ri... . . . . . 189, 358 Akvaghosha, author, ... . . 118 asvamedha, hors-sacrifice, . 118, 337, 389 Asvavannan, k., . . . . . .815 Atisaya, horse, . . . . . 340, 344 Attivarman, Ananda k., 837n. 4 Attivarman (Hastivarman), do. 328, 329 aw, expressed by 6, . . . . . : 1 Aupachchhandasika, metre, . . .818 avagratta, symbol, . . . . 189, 318, 824m. 3 * 1, 2, 3, 6 Badkamta, vi, . . . . . 351, 353n. Baghaura, vi.. . . . . . 353, 354 Balaghat, i., . . 18, 362 Balaputra or Balaputradeva, Sailendra k., . 311, 312, 313, 314, 315, 316, 325, 326 Balavarmman, ch,. . . . 311, 316, 326 Balavartman, Karusha k.. . 316 n. 4 Balavarmman, Pragjyotisha k., . . 316n. 4 Bali, demon k., . . . . . . 1,6 bali, royal revenue, . . . 110, 204 & Bana, demon, . . . 120 Bana, dy., . . Binadhirija, title of the Ganga . Prithvipati II, . . . . . . . . 3 Banavidyadbars, sur. of the Bana k. Vikram aditya (1), . . . . 2, 3 Bangarh, vin . . . . . . 369 Bauskhera, ci.. . . . .348n. 7, 359 Bappura, family, . . . . Barskuru, oi., . . . . . . 196 Bauddha Bhiksbu,. . . . . 15 Beuares, Di., . . Bengal, co., . . . . . . . 188, 189 Bezvade, oi., . Bhabanidas, poet,. . Bhadal, vi., . . Bhaddajja (Bhadrarya), m., . Bhadrenika, vi.. bhagabhogakars, . . . . . 826 The figures refer to pages: . after a figure, to footnotes; and add to the additions on Pp. vil to rii, The following other abbreviations are ad -ck. -chief: co.= country: di. -district or division; do.-ditto; dy, dynasty; E.-Eastern; J.-female; k.-king; m.-male; mo.wmountain; ri..river ; 1.d.-same ; w.ght name; 16.-temple; vi. village or town; W.-Western
Page #408
--------------------------------------------------------------------------
________________ Bharata, myth. k., Bhavajja (Bhavarya), m., Bhannchandra, m., Bhanugupta, Gupta k., bhata,. Bhattoji Dikshita, grammarian, Bhavanagar, plates from, . Bhavani, s. a. Parvati, Bharata, author, Bharella, vi.,. Bhashege-tappuva-rayara-ganda, title of Vijaya nagara kings, Bhashya-Bhasha, work, Bhaskaracharya, astronomer, Bhaskaravarman, Kamarupa k., Bhavu-deva, ch., Bhayanarya, m., Bhayi-Bhatta, m., bhikshu, Bhimasena, epic hero, Bhoja, k., Bhrigurace, bhu, numerical word for 'one', bhakti, territorial division, bhumichchhidra-nyaya, Bhuminaga, Naga, . bhuts, Bilakenduai, vi., Bilakindaka, s. a., Bilakenduai, boar, emblem on seal, boar, incarnation of Vishnu, bodhidruma, the Pipal-tree, Bodhisattva, Bodh Gaya, vi., Borneo,. . bow, (Chera) crest, Brahma, god., brahmadaya, brahmadeya, Brahma-Gupta, astronomer, Brahmana (Brahman), . PAGE 343 330 331, 334 193 317. 3 349 . . . 111 197, 201 125 359 825 291 . 109 203 351, 352 201 204 311, 325 326 116 315. 203 316. 317, 318, 346 325 11, 12 108 53 353, 355 * " * * INDEX. * 194 194, 202 313", 2 12, 325 113 314, 315 294, 307 6, 7, 14, 15, 16, 17, 309 110 .108, 294, 309 123, 124 . 2, 6, 7, 105, 108, 109, 110, 197, 203, 293, 314, 325, 328, 330, 335, 337, 346, 318 353 Brahmanottaras, Brahmaputra, ri., Brahma-Sasta, s. a. Subrahmanya, Brahma-Siddhanta, astronomical work, Brahmesvara, te., Brihach-charana, sect of Brahmanas, Brihadgriha, s. a. Karusha, British Museum, Buddha, Buddhacharita, quoted, Buddha-Gaya, s. a. Bodh-Gaya. Buddhist, Cambodia, Ceylon, chakra, the discus of Vishnu, chakravartin, . Chalukya, dy, Chalukya, Western, dy., Champa, Chandala, Chandalas, PAGE 325 353, 858 16, 17 123, 124, 125 10 112 . Chandi, image, Chandi Kalasan, te. (?), Chandra, dy., Chandra Gupta II, Gupta Emperor, charana, charu, . chata, Charadevi, Pallava queen, ChattagramChittagong,. Chaturbhani, title of a book, chanroddha ana, chanroddharanika, office, 188, 189, 190, 310, 311, 313, 314, 316, 317, 351, 352, 358 293, 294, 304 331 Badha, Jupiter, Bugnda, vi., Building materials, referred to in a Pallava inscription, 16, 17 111, 116, 194, 195, 207 1, 327 Bukka I, Vijayanagara k., bull, symbol on seal, 316 n. 4 7, 117, 121, 33 189, 311, 325, 326 327, 328, 358 118 360 " * * . 365 314 313 2 297 N. 120, 123 293 n. 4, 296 314 10 325 359, 360, 362 314 188, 189, 350 13 add. 330 110 325 327, 338 354 317 add. 325 325 " * * Brahmanbaria, vi.,. The figures refer to pages: n. after a figure, to footnotes; and add. to the additions on pp. i to xiii. The following other abbreviations are need-ca.chief; 'co.country; di.=district or division; do, ditto; dy. dynasty; E.Eastern; f-female; k.=king; m.male; mo.mountain; ri.river; s. a. same as; sur. surname ; te.=temple; vi,village or town; W. Westeru.
Page #409
--------------------------------------------------------------------------
________________ 38EUR EPIGRAPHIA INDICA. [ Vol. XVII PAGE chavadi, & a, rajya, . . . 111,117 Chedi, 00., . . . . . $15 the Chedi, famils, . . . . . .815 Chidiyariya (Chodiraja), title of Miladu chiefs, 315 n. 1 Chellur, vi.. . . . . . . 335 Chera, co., . . . . . . . . . 294, 298 Chera, dy. . . . . 307 . 1, 308, 315 *. Chezarla, oi., . . . 329 Chhandoga, deg. Samavedin . . . 346, 348 Chhaudomanjari, quoted, . . . . 292 n. Cthurika-bhalanetra, title of the Vijayanagara k. Virupaksha II, . . . 194, 203 Chicacole, vi, . . . . . 332 Cbikkulla, vi.. . . . 384,386, 337 n. 4 Chitukanabalu, oi., . . . . . 197, 204 Chola, co. . . . . 294 Cbola, dy., . . 8, 296, 807 & n. 1, 312, 313, 315 Chudamanivarmman, Sailendra k., . : Coimbatore, vi.. . . . . . Coliya, tribe, . . . . . . . $14 Comills, vi. . . . Copjeeveram, ci., . Consonant groups, assimilation of, in Prakrit, crescent, symbol on seal, . . . . . 334 Capid,. . . . 326 5th, PAGE date of the fifth Damodarpar Gupta plate, correc ted, . . . . . . . 193; date of the second Damodarpar Gupta plate, cor. rected, . . . . . . . . 193. dates expressed by a chronogram, . . . 11 dates expressed by namerical symbols, 331, 332 dates expressed by numerical words, . . 196, 203 dates expressed in words, . . . . . 331 Dettatroja, god, . . 16 days, lunar: bright fortnight 1st, . . . . . . 111, 117 2nd, . . . . . 120 . . . . . . . . 110. . .. 118, 120 12th, . . . . . 111. 117, 196, 204 13th, . . . . . . 330 dark fortnight . . . . . 106, 108 8th, . . . . . . 331, 334 14th, . . 120 . 350, 352 15th or New Moon, . . 121, 123 days, of the week :Monday . . . 196 Sunday: .111, 118 add., 118 121, 123 Thursday, . . . . . 8, 350, 352 Wednesday, . . . . . ,!18 days, solar : 21st,. . . . : 311, 326 Deb-kot, w., . . . . . . 356 deer, emblem on seal, . . . 188 Deer Park, .. a. Sarnath, . . 188 Demambika, queen of the Vijayangara k. Devaraya I, . . 111, 116, 194, Deobarnark, oi., . . Deopara, ti.. . . . . . 960 desa, .. , mandala, . . . . 318 desabhasha, the vernacular of a province, , . Deulbadi, m., . . . . . 957, Davajja (Devarya), 4). Dovakbadga, Khadga k., 189, 851, 357, 358, 359 Tovakirtti, m., . . * 348 Devapaladova, Pala k., 310, 311, 313, 316 316 . 4, 325 & n. 4, 326, 927 Dacca, vi.. . . . . . .359 Dacca Museum, . . . 188, 190, 849, 359 Dacea Sahitya Parishat, . . . 349 Dadigaraan, Bappura ch., . . . 121, 128 Dadhikarna, Naga, . . . . Dalavanur, the Pallava cave at, . Damajja (Damarya) m., . . . . . 3,3 Damodara, m., . . 360, 882 Damodara, . a. Vishnu,. . . . 361 Damodaraverman, Ananda k, 328, 330, 337 1.4 Damodarpar, vi... 193, 345, 346, 347 * 4, 348 Danekhanda, work, . . . 328 n. 4 Dandapasika, office, Dandika, do... . . . . . . 825 aparadha tas. . . . . . . .925 Dasaparadhika, office, . . 325 The figures refer to pages : after a figure, to footrotes; and add to the additions on pp. viito xiit. The following other abbreviations are used :ch.chief ; 00, countrydi. -district or division; do. -ditto dy.-dynasty; E. Eastern ; f. female; k=king;m. pale; mo- tuountain; ri.river ; .a.-same 48 pur.= sarusne ; tomtom ple; vi,= village ci town; W.Westora,
Page #410
--------------------------------------------------------------------------
________________ INDEX 367 PAGE drona, land medsure, . . 189 Durga, godiless, . 357 Darga-Bbatta, son of Madhavaradhya, m., 197 and add., 204 Darga-Bhatta, son of Vallam-Bhatta, m., 204 dutake office . 105, 108, 109 and add., 110, 318, 316 dutapraishanika, do., , . 325 Dvaipayana, 8. a. Vyasa, . . . . 348 dvarapalaka, image, . . . . . 14 191 PAGE Devaraya-mabara ya 8. a. Devaraya II, 117 Devaraya I, Vijayanagara k., . 203 Devaraya II, do.. . 110, 111, 116, 196, 196 Devaraya (-Pratapa-Do), Vijayanagara prince,. 195 Devasarman, ... . . . . . . 348 Devavarman, . a. Vijaya-Devavarman, . 327 Devavarman, Vishnulundin k., . . 888, 339 Devendravarman, E. Ganga k., . . dh, doubled before y . . . . . dh, replaced by th, . . . . Dhanaidaha, vi., . . . 345, 346 Dharapuram, vi... . . 298 n. 1 Dharani (Earth), . . . . 118, 120 Dharanindra, Earthly Indra,. . . 312 dharma (law), one of the three jewels of Buddhist faith, . . . . . . 190, dharmachakra, emblem on seal . . . dharmanetri. . . . . 825 .. 3 Dharmapala, Gauda k., . Dharmapala or Dharmapiladeva, Pala k., 311, 316, 317 Dharmapuri, vi, . . . . . 296 Dharmaraja Ratha, . . . . . 16 Dharma-ratna, . . . . 311, 325 Dharmaseta, k., . . . , 311, 316, 316 Dharma (Varma) setu, k. . . . 326 .5 Dharwar, vi.. . . . . . . 117 Dbatri, s. a. Brahman,, . . . . 309 Dhirataran, title of Murti Eyipan, . . 296 dhivaloka, chronogram, . . . 111, 116 Dhruvasens (I), Valabki k., 105, 106, 107n., 108, 109 and add., 110 dhravasthanadhikaraniks (dhruvadhikaranika), office, . . . . . . 107, 109 Dhurtavitasamnyada, work, . . . 317 add. Digbanikaya, Pali work, . . . . . 317 Dinajpur, ei. . . 354, 356 Dindika, 8. a. (?) Prithvipati II, . . 3. Dipavali or Diwali, festival, . . . 120 . divalichara-dhavalam, dm replaced by tm, dma for lma,. . . . . . 291 Donajja (Dronarya), m., . . . , 330 Draksharams, e., . . . . drangika, Dravidian, . . . 328 polipse, solar, . . . . 8, 10, 12, 128 elephant, associated with the temple of sasta, . 16 n. Elliot Collection, . . . . . . 7 Enadi, m., . . . . . . .294 Enadi, sur. of sattan sattap. . . . . Eranigereyaha!li, os., . . . Eras: Chalukya-Vikrama, . . . 118, 120 Ganga or Gangeya, . . . 831 Gupta, . . . . . 193, 845, 846 Kushana, . . 10, 11, 12 Lakshmana-sena, . 360, 362 saka, 25., 3, 7, 8, 10, 110, 111, 116, 117, 121, 123, 195, 196, 197, 203, 311, 312 Salivahana (8. a. saka), . . . . 203 Valabhi or Gupta-Valabhi, 105, 106, 107., 110 [Vikrama], Samvat, . . . 11, 326 Eyinan, title, . . . . . 296 Fa-Hian, . . . Faridpur, ti., . . fish, pair of, Pandya Crest, . . . .. . .314 346, 348 n. 6 293, 294, 804 . 1 Gaja-Lakshmi, goddess, . . . . 360 gajavettai-kandaruliye, epithet of PratapaDevaraya, . . . . . 195, 196 gaja-vettai, shortened form of gajavettaikandaruliya. . . . . . . 196 Gamagamika, office,. . . . . .325 Ganada Hafur, vi. . . . . 121, 123 Ganadhipati (Ganapati), god, . . . 202 Ganapati, god, . . . 194 Ganesa, 8. a. Ganapati, . . . . 3 1 The figures refer to pages: n. after a figure, to footuotes and add to the additions on Pp. vii to zili. The following other abbreviations are used :--ch.-chief; co.-country; di. -district or division; do. - ditto; dy. -dynasty E.-Eastern; f. -female; k.- king: m.-male; mo. mountain; ri.-river; $. 3.-ame M; Nr.-surname; te.-tomple; vi. - village or town; W. Western.
Page #411
--------------------------------------------------------------------------
________________ 368 EPIGRAPHIA INDICA. (Vol. XVII. .. . 330, 33, 327 PAGE Gotras :-contd. Kasyapa, . . . . . . 330 Kaundinya, . . . . 330 Srivats,. . . . . . . 204 sanaka, . . 105, 108 * Vasishtha, . . . . 201 Vatsa. . . . . . 330, 334, 337 Vrajagana, . . . . . 110 Govinda-Chandra, Chandra k., . . . 350, 351 Govindavarman, Vishnukundin k... 335, 337, 338 Greeks, . . . . . . . . 124 Guddadi-vishaya, di, . . 335 & add., 337 Gaddavadi-vishaya, di., 335 Gudimallam, vi. . . . . . 1, 2, 3 guna, numerical word for three' . . 203 Gunabliers, sur. of the Pallava k. Mabendra varman 1, . . . . 10 . Guntur, vi. . . . . . 328, 329 Gupta, dy., . . 13 and add., 193, 313, 317, 352 * 325 * 310 PAGK Aaneigad, oi.,. ... . . . 106 Ganga, co., . . . . . . . . 296 Ganga dy... . . . 295, 297, 332 Ganga (Ganges), r., 119, 122, 123 Gangaraja, k. of the Gangas 294, 297, 307, 309 Gangavi di 96,000, di., . . . . . 296 Atanga, W. dy. .. . . . . 3,286 Gani-Atokura, din . . 328 Ganges, ri.,. .. Gaj, vi., . . * 12, 13 add., 862 Ganadubal, 8. a. Ganada Halur, . . . 121 Garo, hill,. . . . 353 Ganda, co., . . . . . . Gaudelek hamili, quoted, . . 351 n. 1 Gaulmika, office Gaarimbika, queen of the Vijayanagara k. Bukka I, . . . 111, 116 Gautama Buddha, s. a. Buddha, Gaya, di.. . . . . 317 Gaya-vishaya, di.,. 811, 818, 325 Gennayya, 7. . . .. . . . 10 Ghanadri-rajya, di., . . . . 208 Ghanidri, . a. Pedugonda, . 194, 195 gazelle, emblem on seal, 310 Ghosbana, tank, . . . . . 384 Ghugrahiti, si, . . . . . 318 n. 2 gi, abbreviation of gimha (grishma), . . 325 gimba or gluha (grishma), season, . 937.7 Giritrs, 8. a. Sivs, .. Giti, metre, .. .... .. .. 14, 341, 342 Gogha, vi., . . . 106 Gokage, s. a. Gokak, . . . . 121, 128 Gokak, vi.... .. .. . Gonada-bedangi (gunada-bedangiyar), title Akkadevi, . . . . . 121, 122, 128 Gonandije, m., . . . . . 328 n. 2 Gopala, ., . . . . 348 Gorantla, oi. . . . . 328, 329, 337 . 4 Gosa barn, one of the 16 makadanas, 111, 117, 307, 328 Goshthaka, ., . . . . . 348 gitra, family, . . .. . 830 Gotras : Agasty, . . . . . 880 Atreya,. . . . . . 109, 203, 204 Rbaradvaja, , . .. 204 Harita, . . . . 204 * 333 * 6 . 121 Hagaraitege, Hagaritage, Hagaritige, Hagaratta gi, Hagarittage, Hagarittige, Hagarittigi or Hagalittage, vi.. . . . . . . 8 Hagari, ri., ." . . .. . 197, 204 hala, land measure, Hampanarya, m., . .. * 204 Hampe or Hampi, vi, . . . . 112, 197 Hunt, s. a. Siva, . . . 120, 305, 327 Haraba, vi.. . .... . . 193 Harihars, god, . . . . . . 360 Hari-Hara-Pitamaha, 8. a. Dattatreya . . 16 Harihara (I), Vijayanagara k. . . 111, 116 Haribara (II), do. . . . . 194, 203 Harini, metre, . .. . . . . . 318 harivana of food, od, . . . . . 111 add., 117 Harsha, Kanauj k. . . . . 348 *. 7 Harsba, s.a. Harshavardhana, . . . 359 Harshavardhana, Kanauj k.,. . . . . 358 Hastavapra-harani, di.,.. 105, 106, 108 Hastavapra, *, a. Hathab, . . 106 Pasti or Hastigrama, vi.. . 311, 317, 324, Hastimalla, sur. of Prithvipati II, . 3 Hastinavati, s. a. A negondi, ... , 197 Hastinavati-valits, di., . .. i97, 204 Hastivarman, E. Ganga k., . . .333 417 324, 325 1 The figures refer to pages: n. after figure, to footnotes, and add to the additions on pp. vii to xiii, The following other abbreviations are used :-o.-chief; 60.country; di district or division; do.-(litto wy.=dynasty; 2. Eastern ; f. femalo; k.=king: #.*male; 10. - mountain; ri. -river; 8. a. - same es ; tur, surnamesto.temple: n=villape or town N. Western.
Page #412
--------------------------------------------------------------------------
________________ Hathab, vi., Hathigumpha inscription of Kharavela, Hathi Tola, vi., Hattaravanna, vi., Hemadri, author, Hemanarya, m., kings, . Hethoa Bigha, vi., Himalaya, mo., Himavat, s. a. Himalaya, Hindaraya-suratrana, title of Vijayanagara Hindus, Hinen Tsang, Chinese pilgrim, Hogari(Pogari)-gachchha, Hondevaka, vi., Hirahadagalli, vi., biranyadeya,. biranyagarbha, one of the 16 mahadanas, 306, 307, Hoysala, dy.,. Hoysala, s. a. Karnata, Huna, tribe, Huvishka, Kushana k., not distinguished from i, i used for yi,. Idilpur, vi., ihdu, Indo-China, co., Indra, god. * Hastyaevoshtranan balavyapritaks, office, I Indra, see Dharanindra. Indrasarman, m., Indravajra, metre, 111, 116, 194, 208 352 339 n. 5 108 328, 337 316, 317 121 & n. 3, 123 . 333 195 195 193, 325 11 825 190, 208, 293, 204, 805, Indrabattarakavarman, Vishnukundin k.,. Indravarman, s. a. Indrabhattarakavarman, Ipur, vi., Iraiyanar Agapporul, Tamil work, Irivabedanga, aur. of the W. Satya raya, Ianavarman, Maukhari k., I-shang-na-pu-lo (Ishanapura), co., Isvara, s. a. Siva, Isvaradatta, author,. * 295 317 332, 334 828 n. 4 204 317 294, 344 120 . 339 318 335 324 #. 2 334, 335, 337, 339 n. 3 . INDEX. 4 PAGE 106 1 292 188, 189 29% 312, 314 326, 344 * . 298 n. 1, 296 Chalukya k. * 7,9 193 354 14, 15, 17 317 add. Isvaravarman, Maukhari k., Iyaveja, vi,, iydu for ide, Jaggayyapeta, vi., Jain, Jains, Jata-Khadga, Khadga k., Jatila, Pandya k., Jatila, a.a. Parantaka Nedunjadaiyan, Jatilavarman, do, Jaunpur, vi., Java, * Jaya-Nandivarman, s. a. Nandivarman, Jayasarman, m., Jesuit fathers, jhampalacharya, title, jihvamuliya, Jina, god, Jivita-gupta, Gupta k., Jyeshthanaka, vi., Kadamba, dy., Kadamba, family, Kadaram, s. a. Kataha, Kadara, s. a. Pallava, kadi, grain measure, Kadungon, Pandya k., Kaivarta, dy., Jayakesi or Jayakesideva (II), feudatory 118, 120 Jayamangala, commentary on Vatsyayana's Kamasutra, 317.4 Jayameru, sur. of the Bana k. Vikramaditya (I) 2, 3, 6 3 834 313 118, 120 291, 292, 327 121, 191 350 106, 106, 108 Kalandai pond, Kalasan, vi., PAGE 193 108 add, 292 311, 312 &. 1, 313, 314, Kalabhra, race, Kalabhra, s. a. Karpata (?) Kalakkad, vi., Kalamesvara, teis SC9 839 #. 5 121, 123 317 358, 359 293 305 292 193 . 315, 316, 326 Kadamba 13, 118 add. 118, 120 313 294, 295, 308 2,7 293, 225, 297, 308 kala, fine arts, 355 343 343 #. 4 kala, a digit af the moon, Kalabhran (Kalabhra), k. of the Kajabkra race, 298, 294, 806 295, 297, 808 293.4, 306 s. 2 298 117 . 208 . 311 1The figures refer to pages: n. after a figure, to foutno tes; and add. to the additions on pp. vi to xiii. The following other abbreviations are used:-ch.ehief; co-country; di.-district or division; do.=ditto; dy. dynasty; E.-Eastern; f.-female; k.king; male; mo.mountain; 7. river; s. a. same as i sur surname ; ie. temple ; vi. village or town; W. Western.
Page #413
--------------------------------------------------------------------------
________________ 870 EPIGRAPHIA INDICA. (VOL. XVII PAGE taliyam, tas, . . . . . 112, 117 Kali age, . . . . . 6, 203, 307, 308 Kalidasa, poet, . . . . 293 #.1 Kalidevasvamin, te. . . . . . . 120 Kalikal, ti.. * . 349.1 Kalinga, co., . 116, 314 Kalippagai, sur. of Nedaojadaiyan,. . . 307 * Face . . . . . 293, 306 Kalkere, vi.. . . .8, 10 Kalps, . . . . .298, 294, 304 Kamadeva, god, . . . . 321 n. 1, 326 Kamakkani-Narchitga , ., . . . . 308 Kamakkani Surarap-Siogan, . a. Kamakkani . Narchingad . . . 294, 309 komandala, symbol of the image Brahma-slists, 16 Kamarupa (Assam), Co., . . . 363 Kamasutra, work, . . . 317 n. 4 Kamikagama, sork,.. . . 297 6. 3 kamma, land measure, . . . . . Kanaaj, di. . 316 - 4 Kandara, Ananda k., . 328, 329 Kandarapurs, oi.,.. . 328, 330 Kandarpa (Capid), . . Kangura, vi.. . . . . . 328, 330 kapikksi, a nasar, . . . . . 112 Kapikkha, s. 4. Kani. bka, . . . 11 Kanishka, Kushana k. . s, 8.0. Pudra, . . . 316 . 2 Kapalika, . . . . . . . 15 tappadi tank, . 121, 123 karinmai, . . 308 Karavandapuram, . a. Kalakkad, 294, 295, 297, 298, 309 Kariyakero, tank,. . . . 197, 204 Karlo, pi., . . . 337, n. 7, 389 , 5 Karma-Brahms-patha . . . . Kamminta, ol., . . . . 351, 353 Karpa, epic hero, . . . . 326, 343 karnapura, as ear-ornament, . . . 343 Kernata, 00. . . . . . 194, 195, 203 Katita, race, . . . . . 295, 325 Karnataka, *. a. Chalukya W., . . 293. + Karanatakan, . a. Madaraka runatakap, 307 Karur,ci. . . 298, 307 Karusha, o., . . . . . . 916 . 4 Kassava, . a. Kasyapa . . . . 338, 380 * 30$ PAGE Katabs, co.. . . . . . . . 313 kataka, a oamp or capital, . . . .348 KathAgaritsigara, work, . . . . .312 Kathiawad (Kathiawar), co. , 109, 110, 316 , 4 kattige-avatars, tax, . . 112 and add., 117 kaustubha jewel, . . . . . . 116 Kaveri, ri., . 111, 112, 117 and add., 291, 295, 308 Kavi, title of Mangalarijs, . . . 309 Kavi, title of Marangiri, . . . . 295 Kaviri, .. a. Kaveri, . . 291, 296, 307 Kavya (Venas), planet, . . . . . 343 Kedarpur, vi., . . 188, 189 Kodar Ray, ch., . 188 kelvi, office, . . . : 293 . 2 kelvi-audanalar (ke]vi-Brihmanas), 293 & n. 2, 305, 308. Kepar, vi.. . . 356 Korala, co. . . . 293, 296, 297, 308 Keto js, m., . . . . . . 123 k, form of, . . . . . . 12 Khada (ta?) pars-vishaye, di., . 348, 348 Khadga, family, . . , 351, 357, 358, 859 Kbadgodyama, Khadga k., . 358, 859 Kbalimpar, ti. . . . . 316, 317, 318 Khandajja (Skandarya), 1., . . 830 khandaraksha, ofice, . . . . .325 Khiravele, Kalinga k., . . Kharlar, vi.. . . . . * . 206 and add. khari, land measure, . . . . 197, Khaeska, .,. . Khasas, people, . . . . .825 Klasi, hill, . . . 353 Kia-mo-lang-kia (Kamalanka), co., . 354 Kikkaka, ., . . 106, 108, 109 and add., 110 kinnara, . . . . . . . 307 Kirtivarman II, Western Chalukya k. . . 996 kiforn-vadava-go-ina bisbyadhikrits, office, , 325 Kisukada Seventy, di. . . . . 121, 123 Kling or Keling, s. a, Kalinga, . .314 Klurak, . . . . . . . 312 Kodambalur, vi. . . . 294, 297, 298, 307 Kodunati or Pindik kodumudi, vi... 296, 248 Koetei, co., . . . 314 Koli, &. a. Uraiyur, . . 294, 297, 298, 307 Kondinna, (Kaundinya) . . . 328, 330 1 The figures refer to pages: . After figure, to footnotes ; and add to the addition on pp. vii to zit, T'he following other abbreviations are dised :-ch. = chief; co. = country; di, district or division; do.= ditto; y dynasty; E. Eastern; f. female; . king im. male ; mo. mountala; ri, rivers . a. same as; ewr. surname; to. = temple; ci. - village or towa; W. - Western.
Page #414
--------------------------------------------------------------------------
________________ INDEX. 371 PAGE Kumbakonam, vs., . . 315 n. 1 Kumadasutra (sant) or Kumuda-sutra-vithi, . . 317, 318, 325 Kundapi, oi, . . . . 196 Kundav vai, queen of Baqavidyadhara, . : 3 Kundings, k., . . . . . . . . . 315 Kundur, 8. a. Narendra,. . . . Kuntala, co., . . . . 13 Kuram, vis . . 340 Kuruba, caste, . . . . . . 138 Kurukshetrs, . . . . . . . . 119 Kurumadai, vi., . . 294, 297, 307 Karamba, tribe,.. . . 294, 295, 296, 308 Kara-nadu, co., . 293, 297, 306 Kopumbu.nada (*) .. a. Naffukkurumbu, 308 Kushinandas, demons, . . . . 344 Kusumadeva, ch. . . . . . 351, 352 Kusumapurs, 8. 4. Pacaliputra, . . 317 add. Kathari, vi.. . . . . . . 12 kutombi, a cultivator, . . 325, 332, 347 ...:: 112 112 PAGE Kong or Konga-bhumi, 8.a. Kongu, 293, 296, 297, 307, 309 n. 1. Kongarkoman, title of the Pandya k. Sadaiyan, 293, 295 Kongar-kop, title of the Pandya k. Parantaka Nequnjadiyap,. . * * 294, 295, 309 Kongu or Kongu-mandalam, co.,. . 296, 309 1 Kongu-Vaoji, vi, , . . . . 298 Konnaangere, vi.. . . . . . 118, 120 Kopparam, vin, . . 306 n. 2 Korkai, vi., . . . 293, 294, 297, 305, 308, 309 Korranputtur, ti, . . . . . 357, 308 Kosals, co. . . . . . . 13, 193 kotapals, ofice, . . . . . 326 Kotivarsha, di. . . . . . . 346 Koy:lolagu, Tamil work, . . . . 196 koyinmai,:. a. koyma. . koyma, . . . . . . Krishna, god, . . . * 326 Krishna-Rajs, &. a. the Rashtrakufa k. Krishna . 3 Krishna III, Rashtrakuta k. . . 3 Krishna, ri., . . . Krishna, . a. Vielna, . . . Krishna-tataka, tank, 197, 204 Kpita age, . . . Kroshtuks- vartani, di.,. kah, replaced by tah, . Kshemadata, .,. . Kshetrapila, office, . Kshitimand-abara, di, Kubera, god, . . . . 116 Kudel, 8. a. Madara, . 294, 297, 298, 307, 308 Kodavada, vi., . . . . 335, 387 kola-gadya da, coin, . . . 111, 117 Kulandaivan, 1.. . . . 308 and add kulavadai, tat, . . . . 112, 117 Kulikas, people, . . * . 325 Kalluks, commentator, . 348 n. 3 Kulambur, oi., . . 294, 297, 307 Ku]vandai-bey, field, . . . . 308 kulyavape, land measure, . . . 346, 348 Kumars, s. a. Skanda, . . . . . 6 Kumara-Gupta I, Gupta k., 345, 346, 317. n. 4, 318, 352 Kamarajja (Kumararya), ., . . . . 330 Kumarata laka-mandala, di.. . . . 189, 190 . . . 106 I ased for . . . . . . 1 I used for . . . . 118 ! changed to ! . . . . 118, 121 ! changed to r, . . . . . 118 Laghu-Arya, 8. a. Arya-Siddhanta, i 124 Lakshmana sens or Lakslimanasenadeva, Sena k., 356, 359, 360, 362 Lakshmi, goddess, 202, 203, 306, 308, 326, 334 Lalla, astronomer, . . . . . . 17 lampstand, symbol on seal, . . . 33 Languages :Bengali, . . 189 Kannada, . . . . . 111 Old Kanarese, . . . 7, 117, 212 Prakrit, . 327, 328, 335, 338, 361 Sanskrit, . 1, 7, 12, 14, 111, 118, 120, 121, 123, 189, 194, 291, 292, 293, 297, 310, 327, 328, 329, 335, 338, 346, 351, 355, 356, 359, 360, 361 Tamil. . . 1, 7 ., 291, 292, 298. 297, 314 Lata, co., . . . . . . . 311 Lauhitya, ri, . . . . . 353 Layaha, Layaha-Chandra or Laysha-Chandradeva, Chandra k. . . . . 351, 352 Leliya, vi., . . . . . . 189. 190 1 The figures refer to pages : #. after a figure, to footnotes; and add to the additions on pp. vi to xiii. The following other abbreviations are used :--ch.chief; co. - Country: di, - district or division; do. ditto; dy. -dynasty; E. - Eastern ; f.-female; k-king: m.-male; mo. - mountain; ri, river; 8. d. same as; mur.- surname; te.temple; vi. village or town; W. Western.
Page #415
--------------------------------------------------------------------------
________________ 872 EPIGRAPHIA INDICA. (VOL. XVII. PAGE letters (Grantha), ud a symbols for numbers, . 292 Leyden Museum, . . . . $12, 313 linga, . . . . . 7, 367 lion, crest, . . . . . . . 120 Lokadatte, fl. . . . . 363, 356 lotus bad, symbol, . . . . . . 10 M *, final form of, . . . . 1,335 Medabakti, wife of Kamadeva,. . . 824 .. 1 Madavikalap, title of Marangiri, . . 294, 808 Madavikalap Marangiri, .. a. Mangalaraja Ma dhuratara, . . . . . . 284 add. Yadhava, ... . . . . . 106, 108 Midhavaradby, ., . . . . 197,204 Madhavayapman (I), Vishubundin k. 388 Madhavavarman (II), do. 888, 889 Madbavavarman (III), do. 386, 387, 888 Madhuban, ul. . . . . . 359 madhuka, tres, . . . . . . 326 Madhuratars, title of Mangalaraja 294, 309 Madhuratara, title of Marangari, . . 296 Madhusudana, .. . . . . 351, 352 Madru Muum, . . 1, 196, 292, 293, 295, 298 Madur country, . . . . . 296 Madar, vi,, . . 294 n. 3, 297, 298, 307, 3G8 Madara-Karanatakat, title of the Pandya k. sadaiya. . . . . . 298 Magadha, co., . . $21, 319, 816 Mababalipuram, oi. . . 16 Mahabharata, quoted, . . * 848 .. 2 mahidanas, the sixteen, Mahidandanayaks, . . 325 mabadaubsidbasidhadiks, office, 825 Mahadevi, title, . . . . . .357 Mahakantin, 4. a. Pandns, . mahakarttakritika, office, mahakamaramatga, do., . . mahamai, taz, . . . . . Mahamandalesvart, mahanagara,. . Mahantaprakasa-visbaya, di., 346 Maha (or, the second) Arya-Siddhanta, astronomi cal work, . . . . . 124 mahapratihara, office, . . . . 325 PAGE maharaja, .11, 12, 13, 14, 105, 108, 109, 110, 811, 826, 328, 830, 883, 836, 387, 338, 89 maharajadhiraja, ... 8, 118, 122, 189, 190, 192, 811 Maharathas, race(f), . . 294, 297, 298, 307 mahasamanta, . . . . 109, 246, 825 Mahasudeva, Sarabhapura ch. . 106 and add. mahsttama, office, . . . . . 325 mahattara, do. . . . . 109, 346, 348 Mabayans, school of Buddhists, . . 312 Mahendrapals, Kanaaj k., . . . 816.. 4 Mabendravarman I, Pallava k., 14, 16, 16 Mahendravarman (II), do. . . . . 843 Mahendravikramavarman, . a. Mahondravarman , . . . . . . 16 .. Mahevara, 1. a. Siva, . . 338 Mahipala or Mahipaladeva I, Pala k., 368, 354, 366 Mahipals II, do., . . . . .866 Mailala-dovi or Mailala-mahadevi, queen of the Kadamba ch. Jayakori IT,. . . 118, 120 Maitrska, dy.. . . . . 106, 108, 109 Mals, . a. Vishna, . . . . . 861 Maladatta, m., . . 880, 381, 889 Maladar-Koman, rur. of Moypporul-Nayapar, 316 *. Maleiman or Malaiyaman, awr of the chief of Miladu, . . . . 314, 315 .. 1 Malaiya-nadu, hill country. . . . . 814 Mala-Kongam, co., . . . 294, 296, 297, 307 Mala-nada, di, 112, 114, add., 117, add., 297 Mala-nada, . a. Mala-nada, . . 111, 112, 117 Malats, co., . . MiJava (Malava), .. a. Mala-nada, 298, 297, 806 Ms!svalli, ting. . . . . 837 .. 7 Malavae, people, . . . . . . 325 Malaya. co., . . . . . . 818.. 2 Malays, mo. . . . . . . Malini, metre, . 197, 348 Malladeva, Bana k., . . . 2, 3, 6 Malla-Gavanda, . . . . . . . Malli-Bhatta, m., . . Mallikarjuna, Vijayanagara k., . . Mallana, m., . . . . . . . 197 Maluha-tongi, mill, . . . Mamandur, vi, . . . . . . 15 388, 339 The Agures refer to pages : #. after a figure, to footnotes; and add to the additions on Pp. vii to xili. The following other abbreviations are used :--ch.chief ; 00.=country; di district or division; dot-ditto ; dy.dynaty, E.Kastern 1.-female; k=king; *.=male; mo.=mountain; ri rivor; .. .--Amo m; w.surname; to. temple ; vi, villago or town; W.-Western.
Page #416
--------------------------------------------------------------------------
________________ Mammaka, m., mapaipperukadamai, tax, . Manchyanna-bhattaraka, Vishnukundin prince, Mandagappattu, vi., mandala, mandapa, Mandara, mo., Mandasor, vi., Mangalapuram, s. a. (P) Mangalore, Mangalore, vi., Mangalaraja, s. a. Marangari, Mangalaraja Madhuratara, s. a. Madavikalap Marangari, Manianwan, vi., Manivataka, vi., Manjasri, Buddhist goddess, Mankuwar, vi., Mannaikkudi, s. a. Mappikurichchi, Mannikarichchi, vi, matha, a monastery, Mathura Museum, Mathura, v., PAGE 105, 108, 109, 110 112, 117 Mattepad, vi., Maukhari, dy., Maurya, dy.,. . 4 Manu, myth. k., Manu, quoted, Maran Eyinan, m.,. Marangari, m., Maranjadaiyan, Pandya k., Maratakanagara (Virinchipuram), vi., maravadai, tax, Maravarman (I), Avanichulamani, Pandya k., Maravarman (II), Arikesari Asamasaman, do., Pandya k., Maravarman (I), Maravarman (11), do.. Maravarman Rajasimha, do, Maravarman Sundara-Pandya I, do.... Maravijayottungavarman, Sailendra k., Maradur s. a. Tiruppudaimarudur, Maradur, vi.,. 294 and add. 817 .311, 317, 818, 324, 325 312 352 mattar, land measure, Mattavilasa, surname of Mahendravarman I, Mattavilasa prahasana, book 835, 337 14 316,318 14 804 . 198 298 196, 298 309 297 n. 4 294, 297, 307 307 348.3 296 294, 295, 296, 308, 309 n. 1 * 295 195 112, 117 297 INDEX. . * 297 293, 304, 306 305, 806 293 295 312, 313 298 293, 297, 307 10, 120 10, 11 10, 11 10, 120, 123 15 15, 16 327, 337. 4 198 317 * * Maya, mother of Buddha, mavadai, tax, Mayidavolu, vi., Medas, class of people Meemeeguttoe, 8. a. Momigatti, Meghavarna, Ceylon k., Meharkul, di., Meladevi, queen of the Vijayanagara k. Harihara II.,. Melemuri, di. (?), Meliyala, tribe, Mera, mo., metres : Aryagiti, Drutavilambita, Lalita,. Malabbarini, Pragiti,. Sugiti, . Ashadha, Asvayuja, Asving, Chaitra, Karttika, Magha, Vaisakha, months, solar:Kartika, Moon, family of the, Mrida, s. a. Siva, Mrigadava, forest, Muda-nada, di, Upendravajra, Vasantatilaka Meypporul-Nayanar, Miladu ch., Mihirakula, Huna k., Miladu, contracted form of Malaiya-nadu,. Miladudaiyar-palli, te., Miladudaiyar, the chiefs of Miladu, Mimamsa, . miyatchi, tax, Momigatti, vi., Monghyr, vi., months, lunar: 203 111, 112, 117 and add 314 304, 307 PAGE 326 12, 117 337.7 325 117 . 313 &. 2 351 * * Madgagiri, s. a. Monghyr, Muddanarya or Muddanacharya, m., 873 . 341 . 292 . 841 292 . 841 341 292 292, 318, 342 .315. 193 . 314 315 . 1 314 197, 204 308 117 . 310 + . 111, 117, 118, 120, 850, 352 110 110 and add., 120. 121, 128 .111, 120., 196, 203, 380, 331, 334 355 . 106, 108 311, 326 116, 194, 293, 294, 304 . 120 810 197, 204 310 197 &., 204 The figures refer to pages: n. after a figure, to footnotes; and add. to the additions on pp. vii to xiii. The following other abbreviations are used-ch-chief; co. country; di.-district or division; do. ditto; ay.dynasty; E.- Eastern; f.-female; k.king; m. male; mo. mountain; ri. river; s. a. same as; sur. surname ; te. temple; vi.village or town; W. Western. 3
Page #417
--------------------------------------------------------------------------
________________ * 374 EPIGRAPHIA INDICA, [ VOL. XVII. 393 n. 3 PAGE Mndukodami, . a. Palyagamudakudumi Peruvaludi, . . Maghals, . . . . . . 188 Muhammadan, . 195 Muhammad-bin-Bakhtyar, Khilji k., 856 Makhalingam, w., . . . . . . 332 Mula-Sangba, . . . . . . . . . 121, 123 . Molavarmman, k., . . 314, 315 Multal, vi., . . . . . . 27. Mungir (Monghyr), vi., 310, 311, 316, 324, 326 n. 1 Mura, demon . . . . . . 32 Murti Eyinag, m., . . . . 295, 296, 309 Muro-riyara-ganda, title of Vijayana gara kings, . . . . 111, 116, 194, 203 Muruvada, land, . . . . . 121, 123 Museum, of the Varendra Research Society, 198 Musiri, vi.. . . . . . . . . 296 Mussalman, . . . . . . 189 Muveridsmangala-pP e raraiyan, sur, of Marangari, . . . , 294, 295, 208 PAGE Nalanda University, . . . . . 377 Nilanda, vi., . 810, 811, 812, 313, 314, 315, 316, 317, 318, 325, 327, 358 Namakkal, vi., . . 296 1., 297 Namuchi, demon, . . . . 205 Nandarija, mistake for Nannaraja. . .2 . Nanda, 8. a.) Nandivarman, . . . . 2,6 Nandija, m., . . . . . . 328 n. 8 Nandijja (Nandyarya), m., . . . 330 Nandivanika, vi., , . 311, 317, 318, 324, 325 Nandivarman, Bana k., . . . . 2.3, 6 Nandivarman (II), Pallapa k.,. 297 . 4 Nannarija, Rashfrakula k., . 2. Naranadevi-aava, s. a. Narayanambika, 111 ada., 117 and add. Nara, 8. a. Arjuns, : : 305 Narasinga (Narasinha)-Munaiyaraiyar, Milalu ch., . . . . . . . 318. Narayana-datta, eh.. . . . . . Narayana (Vishnu), god, . . . 6, 120, 203, 361 Narayana, nn.. . . . . 260, 362 Narayanambiki, queen of the Vijayanagara k. Vijayabbupati, . . . . 111, 116 Narayana (Vishnu), tmage, . . . 353, 355 Narayanidevi, s. a. Narayanambika,. 194, 208 Narendra, vi.. . . . . . . . 118 Narkorean, 7. . . . . 298, 305, 306 Narttesvara (Natoka), image, . . 349, 357, 252 Nasik, vi., . . . . 337 n. 7, 339 n. 5 Natese, form of siva, . . 349 Natesvara, vi.. . . . . . 849 Natore, vi, Natika, .. a. Nai Pokhar, 817, 318, 325 Natika, vi., . . . . 311, 324 Nittukkurumba, 8.4. Kurambu-nado . . 308 Nattakkorumba, vi, . . . 294, 295, 297 Naun van, . a. Nadiune, . . . . 317 Navendaka, oi. . . 108 and add. naya, . . . . . . . . 318 Nedomaran, Pandya k.,. . 296, 297 Nedunjadaiyap, do., . 292, 294, : 205, 296, 297, 307 Nedanjeliyan, s... Seliyan, . 297 Neduvayal, vi.. . . 294, 297, 807 Negapatam, vi.. . . 313 Nelvoli (Tiranelv@li), 8. G. Tinnevelly, 293, 297, 306 Neriyar, 8. a. Chola. . . . . . 807 . . 12 362 317 . . 7, form of, Nachane-ki-talai, inscription at, . Nachna, 4. a., Nachaud-ki-talai, . Nadiune, vi., . . . . . nada, a district assembly, . Nuga, . . . . Nagapattans, 6. a. Negapstam, Nagara, .. Cha Patalipatra, . . Nagara, 5. a. Srinagara, Nagara-bhakti, legend on seal, Nagara-bhukti... a. Srinagara-bhukti, Nagaraka, vi.. . . . . Nagar Brahman,. . . . . Nagarur, . . . . . Nagasarman, m. . Nagradna Pandita, Jain teacher, naga, tree, . . . . . Nigi . . . . . . Nai-Pokhar, ti. . . . . Neishadhakavys, quoted, . Nakkirar, Tamil commentator, nakshatra : Pashya . 10, 11 * 313 317 add 317 317 1.6 317 , 6 . 109 . 109 297, 308 . . . . 348 . . 121, 123 805 343 . 10 . 317 808 n. 3 350, 352 1 The gore refer to pages: . after flgare, to footnotes; and add to the additions on Pp. vi to xiii. The following other abbreviations are used ch.chief; co.= countrydi.diatrist or division , do.ditto dy, dynasty, E.Eastern; f.femalo; k.kingN.Emale; mo.mountain; 11.river 4.- same , w.roname: te-temple; vi.=village or towo: W.-Western
Page #418
--------------------------------------------------------------------------
________________ Nidhanpur, vi., Nilakandanar, m., . Nittura, vi., nivi or nivi-dharma, permanent endowment, Niya, m., nma for tma., nrita, contracted form of sunrita, Nowgong, vi., numerical figures, numerical symbols, . o for au (in Prakrit), Odras, co., Odras, people, Orissa, co., Oudh, co., p>h. pachchai, a nazar, padagara, land measure, padai-kanike, tax, padavartta, land measure, Padma, river, Padmasana, s. a. Lakshmi, Pagalatti, see Hagaratage. Pagalatti Three-hundred, di., Paganur-kurram, di., Pala, dy., Palamaks, vi., Palembang, kingdom of, pali, bank of a field, Pailtana, vi., Paji, vi., 328 311 325 Odumaiyiruppaisey, field, 308 olukku-nir-pattam, tax, 112 and add., 117 and add. dih, symbol,. 292 & n, 352 om, used in place of numeral 'one' 327 314 n. 4 193 . . PAGE 359 296 197, 203 346, 348 11 add. 291 118 * 105, 106, 108, 110, 327, 328, 335, 339 . 316 n. 4 351, 355 * INDEX. .118 112 309 112 and add., 117 108, 109 189 305 * * 7,8,9 293, 294, 297, 805, 308 188, 189, 310, 311, 315, 316, 353, 354, 355, 358%, 359 311, 317, 318, 325 313&., 3 834 105, 106, 107 m., 108, 109 n. 293, 297, 306 . PAGE Pallava, dy., . 14, 15, 294, 296, 307, 315 m., 328 340 293, 297, 306 16 Pallavamalla, sur. of Nandivarman II, Pallavaram, vi., Palyagamudukudumi Peruvajudi, Pandya k., 293, 294, 305, 308 312 n. 3 6 H. 310 Panahkarana, Sailendra k., panchanga-mantra, explained Panchavaggiyas, Pandamangalam, vi.. 111, 112, 116, 117 and add. Pandik-Kodumidi, s. a. Kodumudi, 294, 297, 298, 307 Pandi-pPerumbanaikkaran, ., 295 Panditavatsala, biruda of the Pandya k. Parantaka-Nedonjadaiyan Pandiya, tribe, Pandiya-pPerumbaaikkaran, ., Pandys, co., Pandya, dy, Pandya, myth. k., Pandyadhiraja, title, Panini, Panini, quoted, Parahitachari, m., paramabbattaraka, title, parama-daivata, do., parama-Saugata, do, Parameshthin, s. a. Brahma, parames vara, title, . Parla-Kimedi, vi., Partha, s. a. Arjuna, 295, 307 314 295 294, 315. 2, 291, 293, 294, 295, 28, 297, 304, 307, 308, 309 293, 304 297, 306 292 291 375 7 8, 118, 122, 189, 190, 192, 311, 348 348 189, 311 7 8, 118, 122, 189, 190, 192, 294, 311 340, 343, 344 3 Paramesvaravarman I, Pallava k., Parantaka I, Chola k., Parantaka Nedunjadaiyan, Pandya k., 291, 295 Parantaka, sur, of Jatila (i. e., Nedunjadaiyan), 29, 305 Parantaka, sur. of Maranjadaiyan, 295 .296, 307 Parantaka, sur. of Nedunjadaiyan, Pararaya-bhayankara, title of Vijayanagara kings,. Parasara, sage,. Parasurames vara, te., Parava, tribe, parihara, an exemption, Parikud, vi., . 194, 203 326 2, 7 293, 297, 306 7 331 331 n. 2 307 " 1 The figures refer to pages: s., after a figure, to footnotes; and add. to the additions on pp. vii to xiii. The following other abbreviations are used-ch. chief; co. country; di.-district er division; do.ditto; dy.-dynasty; E.-Eastern; f. female; k.-king; m. male; mo. mountain; ri. river; s. a. same as; sur.=surname ; te, temple ; vi. village or town ; W.-Western,
Page #419
--------------------------------------------------------------------------
________________ 376 EPIGRAPHIA INDICA. [Vol. XVII. PAGE Parvati, goddess, . * 202, 203, 326 Pubapati, .. a. Siva, . . . 291, 307 pataka, land measure, . . . . 189 Patalipatra (Patna), vi.. . . . . 317 pattika, a copper-plate . . . . .380 n. Pattuppattu, Tamil anthology. . . 315 . Paulin-Siddhanta, astronomical work, . 124 Paulomi, 8. a. Sachi . . . . . 326 Paandra or Paundravardhana, s, a. Pandra, 193, 816 Payal, vi.. . . . . . 297, 308 peacock, vechicle of Skanda, . . . . 16 . Pennagadam, oi., 294, 295, 297, 298, 308 Peranai, vi., . . . . . 14 Periyalur, vi, . . . . 291, 297, 307 Periyapuranam, Tamil work,. . . $15 *. per-kkadamai, tax,. . . . . 112 permatti, drum, . . : 120 Perambanaikkaran 3. a. Pandiya-pPerumbanaikka . . . 294 Pilipinka-naya, di, . . . $17, 318, 324 Pilipinka, 8. a. Pilkhi, . . . 317 Pilkhi (Pilke-mauza), ui. . . . . 317 Fyayar-fuli, symbol, . . . . 352 N. pillaiyar-fuli, aymbol ned as a mark of punetustion, . . . . . . 292 Pingala, m., . . . . . . . 348 Piragadattan (Bhrigu-Datta), Arya k. . 315 n. pisacha, a demon, . . . . . . 344 Pitamahn, m., . . . . . . . 356 pluta, . . . . . . . 292 Polayya's Math, Ponnaladevi, queen of the Vijayanagara prince Prataps, . . . . . . 196 ponnu=kalanja, . . . . 2, 6, 7 Poona plates, of the Vakataka queen Prabhavati. Gupta, from,. . . . . 13 add., 362 Prabhavati, queen of Devakhadga, 357, 358, 359 Prabhivati-Gapta, Vikataka queen, 13 add., 362 Prabhumeru, sur. of the Bana king Vijayaditya II, 2, 3, 6,7 Pragjyotisha (Gauhati or Assam), co., 316 n. 4 Praharshini, metre, . . . . . . 318 prajnaparamita, Buddhist-dharma, . 325 Pramatri, official, . . . 311, 325 Prambanan, temple at, . . . . . 312 PAGE prantapala, official, . . . . 871 prapa, a territorial division smaller than ahara. 106, 107 prapiye, 3. a. pravesya, . . . 105, 106, 107 prasasti, . . . 2, 7, 299, 305, 809 Pratapa, title of Vijayanagara kings, , 208 Pratapa-Devaraya, 1. a. Devaraya I, 111, 116 Pratapa, Prataparaya, Pratapa-Davaraya or Pratapa-Devaraya-Maharaya, Vijayanagara prince, 194, 195, 196, 203 Pratapa-Devaraya (1), s. a. Devaraya I, 19: Prathamabhadra, m., . . . . 857 #. pratihara, office, , , , , 108, 109, 110 Pratipati-Araiyar, 6. a. Prithvipati I, . . 3 pratyaya, . . . . . . 108 Pradba-Devaraya-Maharaya, 8. a. Pratape, 195 Prandbapratapa, . a. Pratapa, . . 195, 303 Praudhapratapa-Devaraya, 1. a. Devaraya I, 196 Pravarasona I, Vakataka k., . 13 and add. Pravarasena II, do. . . . 13 and add., 368 pravesa or pravesa, a territorial division smaller than ahara . . . . . . 107 pravesys, . . . 105, 106 and add., 107, 108 Pravpidjanapada, 1. a. Mala-nadu,. . 117 add. Prayaga, oi., . . . . . . . 119 Prithvipati I, W. Ganga k., . . Prithvipati II, do, Prithvisbena (I), Vakataka k., 12, 13, 14, 362 Prithvisbena II, do. . . . 13, 862 Prithu, myth. k., . . . . . .311 Priti, wife of Kamadova, . . .824 n. 1, 326 ... 4 Pudinkoda, vi.. . . . . 294, 297, 807 Pagalvippavarganda, sur. of Bara Vijayaditya (III), 3 Palakesin II, W. Chalukya k., . . 306. 2 Puliyur, vi.. . . . . . 293, 297, 806 pulli, . . . . . . . 891 Puna-pPaliyaq, biruda of Parantaka Nedonjadaiyan . . . . . . 294, 308 Pandra or Pundravardhana, co., . . 316 Pundravardhana-bhukti, di. . . . . 346 pannaga, tree, . . . . . . pap-payir, tax, . . . . . 112, 117 puram, revenue assessment, . . . . 2 Puranas, . . . . . . 329 Puranapuru, Tamil anthology, . 295, 297 Purandara, 5. a. Indra, . . . 305 The figures refer to pages: #. after a figure, to footnotes; and add to the additions on pr. vii to xiii. The following other abbreviations are nsed :--ch.chief; co. =countrydi. -district or division; do. - ditto; dy. -dynasty ; . - Eastern ; f. -female; k. - king; m. male; mo.-mountain; ri, river ; 1. 4. same ; our.surname, te-temple; divillage or town; W.-Western.
Page #420
--------------------------------------------------------------------------
________________ INDEX. 877 PAGE paravu, revenue assessment, Parnna-Chandra, Chandra k.,. . Parogs, official (?), . . Pururavas, myth. k., . . Parva-rajar, kings of the Eastern co., Pushpitagra, metre, . . . Pavalur, vl., . . . . . , 190, 192 * 825 . 298, 804 294, 296, 809 . 818 294, 297, 807 R +, consonants doubled after, . , 2, 189, 291, 325, 827, 338, 348, 881 , consonants doubled before, . . .2, 338, 346 , form of, . . . . . 12 ri, form of, . . . 121 ri for ri or ru . 291 ri, subscribed form of, not distinguished from , 1 race, lunar, 311, 314, 315, 316, 826 Raghavamas, poem, . . . . . 298 n. 1 rainy season (varsha), . . . . . 11 Rajadbiraja, title, . , . . . 194 Rajagambhira-valanadu, di., 111, 112, 114 add., 117 Bajagriha (Rajgir), oi, . . . . . 817 Rajagriha-visbaya, di.,. . 311, 317, 318, 324 Rajakesarivarman, Chola k., . . 315.1 Rajakesarivarman, sur. of Rajaraja I, . : 812 Rajamatys, official, . . . . .325 Rajamriganka, astronomical work, 124, 126 Rajaparamesvara, title,. . . . 194, 208 Bajeputraka, official (8) 825 Rajarajs (L.), Chola k . 312, 818, 815 n. 1 Rajaraja, s. 4. Kubers, . . . . 116 Rajaraja-valanada, di, . . 112, 114 add., 117 Rajaranaka, official, . . . , 326 Rajasimha, sur. of the Ganga k. Hastiverman, 381, 384 Rajasimha, biruda of Indravarman I, 381 Rajagirinha, hir. of the Pandya k. Maravarman II, . . . . . . . 298, 806 Rajasinha, do. Ter-Marap, . 297 Kajat raya-valanada, di, . . . . 296 Rajaaraya-valanadu, sur. of Mala-nada, 297 .. 8 Bajasthaniya, official, . . . . .925 rajatiraja (rajadhiraja), title,. . . 11, 308 Rajondro-Choln I, Chola k., . 818, 850, 361 Rajshahi, di., . . . . . .816 Rajshahi Museum . . . . . . 849 PAGE Rajshahi, pi., . , 193 rajya, a province. rakaba; confirmation of a former grant . . Rakshasa, a demon,. . . . . Bal, oi. . . . . . . . . 10 Rima, epic hero, . . . . Ramaks, m.,. . . . Bamanfindosa (Lower Burma), Co., 812 Ramatirtham, oi., . . 334 . 2, 385, 837 ... 4 Ramayana, Epio, . . . . .'. 812 Rampal, vi., . . . 188, 189,855, 859 Ranabbita, eur. of the Ganga k. Hastivarman, 891, 884 Ranadhira, Pandya k., . . . . 293, 306 Ranadbirs, sur. of sadaiyan, . . . 207 ranga-bhogs,. . . . 117 Ranganatha, te., . . . 110, 111, 116, 117 Rasebvara, m., . . . . . 197, 204 Rashtrakuta, dy. . . . . . 8 n. 8 Rathodd hata, metre, . . . . 918 Rati, wife of Kamadeva, . 924 n. 1, 848 Ratoka, ., . . . . . . 361, 852 Rayagatte, bund ((r)), . . . 121, 123 Tiyam, a secretary, . . . . . 204 Rotghamitrs, n., . . . . . 110 Radavennhoja, 7., . . . . . 828 .. 8 Ruddejja (Rudrarya), . . . . . 880 Rudradhart, ., . . . . . 109 add. Rudrados I, Vakafala . . . . . 13 Rodrosena II, do. . . . . 18 ads. sabdakalpadruma, logicon, Sachi, wife of Indra, . Sadalys, Pandya k. . Baddharmapandarike, quoted, Sagans, myth. k., . . Sahityadarpans, quoted, . Sahyadri, 10., . . Sabyskanya . a. Kaveri, Sailavarbia, dy, . . Sailendra, dy, . . . . . 817. 3 . . . . 808 298, 296, 298, 297, 307 . . . 926 m. 8 . , 811, 848, 848 . . . 1, 826. 3 . . . . 286 . . 117 add. . . 911, 819 & n. 4, 818, 314, 316, 380 . . . 814, 831 . . 118, 849, 46 Sailodbhava, dy.. Saira, . . . . . . 1 The figures refer to pages: #. After figure, to footnotes; and add to the additions on PP. vii to xiii. The following other abbreviations are und :- . oblet : 00.country, di distriot or dirigion, do.ditte dy.=dynasty, E.-Eastern; f. female; k.- king; .-melo mo, montain; ni-river 4 w 1 nut. sumame; to.=temple; w.village or town, W.-Wetern
Page #421
--------------------------------------------------------------------------
________________ 878 Sajjalur, vi., Sakhas and Vedas : Bahvricha, Chhandoga, Rik, Vajasaneya or Vajisaneya, Yajus, Sakra, s. a. Indra, Saktas, sect., Sakti, wife of Kamadeva, Sakuntala, quoted, Salini, metre, Saluva-Narasimha, ch., Samacharadeva, Gupta k., EPIGRAPHIA INDICA. Samatata, di, Sambhu, a. a. Siva,. Sambilaka, vi., Samgramavijayottungavarman, Sailendra k., Samkranti-dhavala, biruda of the Kadamba ch. 119 Jayakesi, . Samprasarana, 328 * Samudra-Gupta, Gupta k., 13 add., 313 n. 2, 316 n. 2 Samvat-Vikrama-Samvat, 326 Samyak-Sambhuddha, s. a. Buddha, sandhi, omission uf,. Sandilys, sage, San-fo-teal, s. a. Srivijaya, Sangam, Academy of Tamil poets, Sangama, Vijayanagara k., Sangha (congregation of Bhikshus), Buddhist faith, Sangharthamitra, m., Sankalpayoni-Kamadeva, Sankarabana, image, Sankha (conch-shell), Sankhya, Sankirpajati, sur. of the Pallava k. Mahen dra varman I, Santisarman, m., Sarabhanga, official, Sarabhapura, kings of, Bara, grass, Sarang arya, m., Sarasvati, goddess, Sardulavikridita, metre, Sarnath Museum, * PAGE 195 204 105, 108, 110 203, 204 109, 834 204 304, 305 358 324 #. 1, 326 n. 4 343. 2 197 196, 197 . 318 . 349, 353, 354, 355, 358 Sattan Sattan, sur. of Enadi, 116, 120, 202 106 add. 313 328, 330 292, 327, 335 356 313 295 . 1 111, 116, 194, 202 a jewel of 190, 191, 327". . * 327 824 n. 1 317 352 197, 204 * 16 109 311, 325 13 343 197, 203, 204 308 197, 292, 318 2 * * Sarnath, vi., Saragi,. . Sarvadamana, sur. of Bharata, Sarvakratuyajin, title, sarvamanya, tenure, sarvanamasya, tenure, Sarvvani, image, sa-saibaram, Sasimauli, s. a., Siva, Sasta, image, Sastras,. Satyamangalam, vi., Satyaarays, sur. of W. Chalukya kings, Satyasraya or deva, W. Chalukya k., Saulkika, official, Saurashtra, s. a. Kathiawad, Saurifarman, m., Savarajja (Sabararya), m., Sayoga, M., seal (Bana), seal, shaped like a signet-ring seasons: Satata-Padmavati-vishaya, di., Satrumalla, sur. of the Pallava k. Mahendravarman I, grishma, . rainy season, [VOL. XVII. Seliyan, the Pandya k., Seliyan, 8. a. Nedunjeliyan, Seliyan Vanavan Sendan, Pandya k., Sembiyan, the Chola k., Sembiyap, sur. of Sadaiyan, . * PAGE 188, 310 121, 123 343 293, 305 204 120, 123 357, 358, 359 106, 108 202 16 m. 294 189, 190 " .15. 294, 309 195 9, 120, 123 7,9 325 316. 4 356 330 356 1 194 . . . 335, 337 339 306 297 293 807.1 293, 307 189, 349, 350, 355, 356, 359, 360 294, 309 297, 306 294, 297, 307 293, 297, 306 Sena, dy., sena pati, title, Sendan, sur. of Seliyan, Sengodi, vi., Seppilam, vi., Beranaibandaperuma-nalar (Serenai-vepra-perumal 111, 112, 116, 117 and add. nallur), vi., serif,. Sesha, serpent, Setti Brahmayya, m 292 304, 327 7, 9, 10 312 11 359 Sewu. temple at, Shahi, title of Kushan kings, Shahpur, vi., . 1 The figures refer to pages: n. after a figure, to footnotes; and add. to the additions on pp. vii to xiii. The following other abbreviations are used:--ch.chief; co. country; di.-district or division; do.=ditto; dy. dynasty; E.-Eastern; f.-female; k.king; m.rale; mo. mountain; ri.-river; s. a. same as; sur. surname; te.-temple; vivillage or town; W. Western.
Page #422
--------------------------------------------------------------------------
________________ INDEX 879 PAGE Shi-li-cb'a-ta-lo (srikshetra), Co. . 354 354 Siddaladevi, queen of the Vijayanagara prince Pratape,. . . . . 194, 196, 203 siddham, . . . . . 352 Siddhanta-Siromani, astronomical work 124, 125 sign-manual, . . . . . 108, 111 Sihor, vi.. . . . . . . 110 silabhadra, m., . . . . 858 silabars, dy., . . . . 314 Simharishnuvarman, Pallara k., . . 15 . Sithapara, vi. . . . . . 110 Sins-chCholap, biruda of the Pandya k. Parintaks Nedun jadaiyan . . . . eine-values of the sun's centre, Singapps or singana-Dandanayaka, ch., sippamapur, ti., . . . . . Sirijja (sryarya), 7., . . 830 siva, god, . 1 and add., 2, 6, 16, 17, 116, 194, 202, 203, 293, 294, 304, 305, 307, 326, 327, 333, 343 . 4, 349, 358 Sivsbhattaraka, m., Sivamars I, Gangs k., . 296 Sivakarman, m. . . Sivatams, m., . . . . . . 7 Skanda, god,. . solan, the Chola k., solan, title of the Pandya k. Sadaiyan. 293, solavanda, vi.. . . . . . . 297 soliya-Enadi Tirukkanna, Malaiyaman ch., 315 Somalapuram, vi, . . . 193, 196, 197, 204 Somapala, m., . . . Somspitha, a drought of the Soma-juice,. . Somesvara I, W. Chalukya k., Sragdhari, metre, . . . . . . Sri, . a. Lakshmi, . . . . . 203, 308 Sribhadra, m., . . . . . Sri-Chandra or Sri-Chandra-Deva, Chandra k., 188, 189, 190, 192, 350 SH-Chattala, s. a. Chattagram, . . . 354 Sri-Devapaladovasya, legend on seal, . . .310 Srigiri, .. a. Pratapa or Praudhapratapa-Devaraya, 195, 196 srigirinatha-Udaiyar, . a. Srigiri, . 196 Srimadhavavarms, legend on seal, . . 334, 338 Srinagara-bhukti, di. . . . 311, 317, 324 Sri-Nagara, .. a. Patna, . . . 317 and add. Griparvata, .. a. Srigailam, . 385, 337, 388, 339 Paes Sripati, astronomer, . . . . . 17 Sri-prithvivellabha, . . . . . 188 Srirangam, island, . . 110, 111 Srisailam, Mill, 335, 838 Srisailam plates of Virupaksha II, 195, 196, 197 . sri-sri-Chandra-devab, legend on seal, 188 Sri-vachana-bhushanam, quoted, . . . 112 srivara or srivarap, biruda of the Pandya k. Parintake Nedunjadaiyap. 294, 295, 808 Srivarsmangale, s. 4. Velangudi, . . . 295 Sr.vijays, . , Palembang, 312, 313 & . 3, 316 Sri-Virupakaba, sign-manual of Vijayanagara kingi,,. . 194, 202, 204 Sri-vishaya (siri-Visaiya), co.,. . $12 n. 5 Sthalikkata-vishays, di, . . . 848 Stambbesvaradasa, m., . . . 348 Subrahmanya, god,. . . . 18, 17 Suddhodana, k.. . . . . 326, 327 Sudi, vi.. . . . . . 121 Sugata, 5. a. Buddha, . . 189, 190, 192, 311 Suleguli temple . . . . . 121 Sumatra, . . . 312, 313, 314, 315, 316 summer season (grishma), . . . . 11 Sundaramurti-Nayapar, Sait saint,. . 315 . San, god, . . . . . 169., 368 San-god, image of, . . . . 357 sun, symbol on seal, * 334 Sunsipuha-nalur, vi, 111, 112, 116, 117 and add. Surishtra, di. . . . . 109 Suroja, m., . . . . . . . 123 Surywiddbanta, astronomical work, 8, 124 n., 135 Susunia, hill, . . . . . . 346 Suttakobari-pPerumbanaikkarap, ... 294 add., 309 Savarnabhumi (Indo-China), . . . . 312 Suvarppa-Chandra, Chandra k., 189, 190, 192 Savarnadvips, s.a. Sumatra, 311, 312, 316, 325 Svaminaga (possible emendation of Bhuminaga), Naga, . . . . . . . 11 svasti, . . . . . . . . 353 Svastika, symbol, . . . . . . 334 t, fival form of, . t, form of, . . tadayaktaka, official, . . . . . . . . . . . . . 335 . 12 . 325 1 The figures refer to pages: .. after a figure, to footnotes ; and add.' to the additions on pp. vii to xiii. The following other abbreviations are bred :ch. chief; co.-country; di district or division; do.- ditto dy.-dynasty; E. - Eastern fifemale; k.-kis; *.-male; momountain; ri-river; * , - same was cur. - surname; te=temple; vi village or town; W.-Westorn.
Page #423
--------------------------------------------------------------------------
________________ 380 EPIGRAPHIA INDICA. [VOL. XVII. 325 PAGE PAGE Talikonda, di, . 328 Tiwarkhod, plates from,. . . . . 2*. Tagadur, 14. Dharmapuri, To-lo-po-ti (Dvara pati), co., . . . . 354 Talakad, os., . . . . Toombgee or Tumbgi, s.a. Tambegi, . . . 7 talas in musie, . . Toramana, Hina k., . . . . 193 Tamil numerals, . . Trailokya-Chandra, Chandra k., 189, 190, 192 Tamrelipti (Tomluk), oi, Trailokyamalla, mur. of the w. Chalukya k. Tanjore, ning . . . . 313, 315 . Emesvara 1, . . . . . 121, 123 Tinrikonra, 1.a. Talikonda, . . . . 928 Traiparashadeva, temples of, . . . . 16 . tintruka (tantrika), . . 925 n. 9 tribhanga, pore in standing images, . . . 360 tantras, . . . . . . 325 Tribhuvanamalla, Jr. of Vikramaditya VI, 118, 120 Tara, Buddhist goddess, 812, 314, 316, 326 Trikuta, mo., . . . . 389, 339 Tati, image,. . . * 317 Trichinopoly, rock-cut cave at, . . . . 14 Tira, Sailandra queen, . . 311, 315, 318, 326 Trichinopoly, vi.. . . . . 112, 196, 298 daripatika, official, Trilochana-Kadamba, -Kadamba, 120 tariks, do., . . . 826 Trimurti cave, . . . . . . 16 tarikkadamai, taa,. . . . . . 112 trina-yuti-gochara, . . 325 & *. 4 Tarpandighi, vi... . . . Tripuri (Tewar), oi., . . 861 . . 335 Tataks, oing . . . Trisirupalli (Tiruchchirapall), ..a. Trichinopoly,. 117 Tattan (Datta), f., . . .816. Trivaranagara, vi, . . . . . 335,337 Telaga country, . to for ksh, . . . . 291 Tannap (Pandya), Epithet of Pandya linge, 307, 308 tulabhara, one of the 16 mahadanas,. , 306, 307 Teppe-Vapavan, biruda of the Pandya k. Tumbagi, vi.. . . . . . . 7 Badaiyap. . . . . . . . 298 Tombige or Tambige Agrahara, s.a. Tumbagi, 7, 8, 9 Teppavar, the Pandya kings,. . . 807 Tungabhadra, ri., . 111, 112, 116, 117, 'For-Mapp, Pandya k.. . 294, 295, 296, 297, 807 203, 204 4, doubled after , . . . . . 12 Turushkas (Turku), the Mahomedans, 194, 203 Thanesvar, di., . . tiger, Chofa crest,. . . . . 294, 307 Tiloke, commentary on Ramayana,. 812 .. 1 tilaks, tree, . . . . . . . 843 , sign of, . . . . . . . 291 Tilak-Chandra, Chandra k., , . 851 Udayachandra, ., . . . . 297. 4 Tinsevelly, vi, . . . . . . 297 Udayamma- or Udayana-Givunda, m., 118, 120 tirigai-ayam, tax, . . . . . 112, 117 Udaya-fails, mo.. . . . . . 203 Tiruchchirapalli, ... Trichinopoly, 112, 117 add. Udayondiram, Bana plates from, 2, 3, 6 *. Tiruchchirapalli-rajya, di.. . . . . 111 Udayendiram, vi.. . . . . . 297 . 4 Tirakannan soliya-Enadi, Malaiyamar oh., 915 Uma, .a. Parvati, Tirukoilur, vi.. . . . . . .815. apadhmaniya, . 108 *.2, 291, 292, 827, 888 Tiramlaraya or 8&lava-Tirumalaraya, ch.,. 196 Upajati, mette, . . . . . Tiramangai, oi, . . , 294, 297, 507 aparika, oficial, . . . . . Tirumudikkari, Malaiyaman ch., . . 815 uparikara, do., . . . Tirumapaippadi, ni. . . . . 315 m. 1 Upendravajra, metro, . . . . Tiran iges varam, ., . . . . 315 *. 1 | Urniyar s.c. Woraiyur, . . Tiranalar, vi.. . . . 111, 112, 116, 117Uramalla, ... Urlam, . . . . 494 Tirappadaiwaradar, d., . . 298 ar anms, . . Tiruvippiramboda, s.a. Godimallam, . . . 2 Urlam, vi.. . Tivara, kings of, . . . . . . 13 Ufanas, 8.0. Kavya, The figures refer to pages: *. after figure, to footnotes; and add to the additions on pp. vii to viii The following other abbreviations are used :-ch.=chief; 60.=country; die district or division , do-ditto; dy.dynnety; E.-Xestern; f.=female; k=king; .male; mo.=mountain; ri=river; *. 4.=ame As, #w.=surnamo to.ee temple; i. village or town, W.-Western.
Page #424
--------------------------------------------------------------------------
________________ attam gram, . Utthanadvadasi, tithi, , cursive form of, v, for p and b in Prakrit, va, used for Vasa (Varsha), vadaki, a carpenter, Vada-Kongu, co., Vadnagar, vi., Vaidya or Vaidyaka, family, Vaishnava, Vaishnava-Dharma, quoted, vaisvadeva, Vakataka, dy., Vaiabbi, 8.a. Vala, * Vala, vi., Valabha, m., Vallabha, k., * Vallabha, sur. of W. Chalukya kings, Vallam-Bhatta. may * Vanga, co., Vangoka, m.,. Vaniji, a.a. Karur, V Varaguna, Pandya k., Varaba-svamin, m... Varanasi (Benares), vi., varana, tree, Valmiki, author, Vamasakti or Vamasakti-pandita-deva, Saiva teacher, Vamsastha, metre, . Vanavan, title of Pandya kings, Vanavan, the Chera k., PAGE . 10. 111, 117, 196, 208 Vargapala, m., Varman, dy., Varodaya-Bhatta, m., 828 338, 339 11 add. . 296 109 294, 295, 308, 309 358, 361 294, 309 . 110. 12 and add., 13, 14, 362 105, 106, 109, 110 106, 110 204 294, 295 296, 309 204 16 Varasena-gana, Vardhana kings, of Thanesvar, Varendra Research Society Museum, Varendri (north Bengal) di., Varendri-Brahmanas, . INDEX. vap-payir, tax on, varada or varada-mudra, pose of hand in images, 118, 120 292, 318 297, 306, 307, 308 * 7 307 #. 1 116, 349, 350, 356 . 356 294, 297, 298, 307 112 add., 117 163, 360 3 346, 348 119, 121 343 121, 123 193 345 . 356 356 348 189, 350 293, 305 vaeal-kadamai, tax, vasa or visana (varsha), the rainy season, Vasudatte, m., Vasudeva, Yadu k., vata (?), . Vatayayana, author, Vedas, . vedic sacrifice, Velangudi, vi., Velvikudi, vi., PAGE 112, 117 339 n. 5 353, 355 194, 202 108 317.4 6, 7, 16, 17, 197, 204, 307 . 293 295 . Vijayachandra, m... Vijaya-Devavarman, Sala kayana k., Vijayaditya (1), Bana k., Vijayaditya (II), dos Vijayaditya (III), do., Vijayanagara, dy., Vijayanagara, vi., Vijaya-Sena, Sena k., Vijaya-sri, * * . * 291, 292, 298, 295, 267, Venbai, vi., Vandarayanallur, vi, 306, 808 295, 297, 309 112 Venujja (Venhujja)=Vishnvarya, m., 328, 330 vessel, symbol in the left hand of a Naga image. 10 Vichitrachitta, sur. of the Pallava k. Mahendravarman I, Vidyakuta, vi., Vigrahapala (II), Pala k., Vigrahapala (III), do., Vijayabahu, sur. of the Bana k. Vikramaditya (III), Vijaya-bhupati, Vijayanagara k., * 111, 116, * 881 194, 195, 196 834 527 . 15,17 853 354 354 . 110, 111, 196 111, 112, 116, 194 360 116 add. * 2, 3, 6 2, 3, 6, 7 Vikramaditya, k., Vikramaditya (I), Bana k., 116 2, 3, 6 1, 2, 3, 6, 7 Vikramaditya (II), do., Vikramaditya (III), do., 3 Vikramaditya I., W. Chalukya k., 340, 843 Vikramaditya VI, do., 117, 118 Vikramadityavarman, s. a. the Baya k. Vikramaditya II, . * 2, 6 Vikramahendravarman II, Vishnukundin k., 384 1.2 Vikramaparaga, biruda of the Pandya k. Parantaka-Nedunjadaiyan, Vikramapura, s. a. Arasibidi, Vikramapura (Vikrampur), vi.,. . . 296 121, 123 188, 189, 190, 192, 356, 359 The figures refer to pages: s. after a figure, to footnotes; and add. to the additions on pp. vii to xiii. The following other abbreviations are used:-ok.-chief; co.-country; di.-district or division; do.ditto; dy.-dynasty: E.-Eastern; f.-female; k.-king; m.-male; mo.-mountain; ri-river; s. a. same; sur.Barname; te.temple; os. village or town; W.-Westeru.
Page #425
--------------------------------------------------------------------------
________________ 382 EPIGRAPHIA INDICA. (Vol. XVII. PAGE PAGS Vikramendra or Vikramendravarman I, Vishnu 335 Vyaghra, k. of Pundra,. . . 316 .. 3 Vy ghratati, or Vyaghratati-mandala, province. . 311, 326 Vyasa, sage,. . . . 16, 108, 334, 348 . Watson Museum of Antiquities, Rajkot, Wheel of Buddhist Law, emblem on seal, Winter season (hemanta), . . Woraiyur, pi.. . . . . . . 108 add. 188 . 11 . 258 . . . Vikramendravarman II, do.. . 385 Vilembali, ti., . . 335,337 Vilveli, k., . . . 293, 306 Vinayachandra, ... . * 831 viniyuktaka, official, . 109, 325 vipra, a Brahmina, . . . 814 Viprapith, *. a. Tiruvippirambedu, 2, 6, 7 viragal, Virajja (Virirya), . . . . . . 330 virams, . . . . . . 1, 291 Virans, Viranarya or Veranachatya, ., 197 & R. 204 Virapratapa, title of Vijayanagara kinga . 117, 195 Vinpuroga, binida of the Pandya k. Parantaka. Nedunjadaiyan, . . . . . . 295 Vira-Vijayariya- Maharaya, Vira-Vijayariya or Vijayaraya, 1. a. Vijaya-bhupati . 195 Virochans, mythical k., . . . . . 2,6 Virupaksha, te., . 111, 117, 208, 204 Virupaksha (II), Vijayanagana k, 194, 195, 196, 208, 204 Virupa kahapuram, .. a. Somalapuram, 197, 207 Virupaksharya, 7., . . 197, 204 Visarga . . . . . . 194, 292 vishaya, a district, . . . . $16, 818, 846 Vishayapati, official, .' . 326 Vishnubhadra, ... . . . . .848 Vishudharmottariya, quoted,. 924 . 1 Vishnu, god,. . 2, 6, 14, 15, 16, 17, 118 add. 194, 306, 308, 326, 353, 355, 356, 361 Vishnu, image, . . . . . 355, 356 Vishmukundin, family,. . 334, 335, 337, 838, 339 Vishnuvardhena Yasodharman, .. Yneddharman, 193 vithi, a division, . . * 318 & 2 Vittharasa-Odeya, ch., . . . . 196 vritti, a share, . . . 197, 204 Vyaghradeva, feudatory, . . . . 13, 14 %, consonants doubled before, . . 2, 335, 338 y, inserted after consonants with the e-sign, in Tamil, . . . . . . . 292 . . . . . 292 ya and yu, anundaika forma of, . . Yadu, myth. k., . . . . 116, 194, Yammegenuru, vi, . . . . . 197, 204 Yasodhars, commentator, . . . 317.4 Yasodharman, Malana ch., . . . 193 Yavabhumi or Yavadvipe, .. a. JAVA, 312, 316, 326 Yayati, myth. k., . . . . . 843 years, of reign, 8, 11, 294, 296, 308, 311, 328, 330, 334, 335, 337, 352, 353, 354, 355, 359, 362 years, of the cycle - Krodhi, . obl. . . . . . 8, 9, 118, 120 Plavanga, . . . . 111, 116, 117 Sarvajit, . . . . 121, 123, 196, 203 sarvari, . . . . . 196 Vyaya,. . . . 196 Ye-poti, co. . . . . . . .314 Yuddhakesari Perumbanaikkarap, . a. Suttakolari Perumbansikkaran, . . 294 add., 295, 309 Yudhishthira, epic hero,. . . 826, 848 Yuan-Chwang, 353, 354, 358 Yupa inscriptions, . . . . . .314 1 The figures refer to pages: . after a figure, to footnotes; and add to the additions on Pp. vii to zili The following other abbreviations are used:-ch, -chief; co.-country: di district or division; do..ditto dy.- ds nasty; E. - Eastern ; 1.-female; k.=king; m.-male; mo, mountain; ri, river: # 4.-.e api ant sumame; to.templo; pi, village or town; W. - Western,
Page #426
--------------------------------------------------------------------------
_