Book Title: Niryavaliyasuyakhandha Commentary
Author(s): Srichandra, Royce Wiles
Publisher: Royce Wiles
Catalog link: https://jainqq.org/explore/007576/1
JAIN EDUCATION INTERNATIONAL FOR PRIVATE AND PERSONAL USE ONLY
Page #1
--------------------------------------------------------------------------
________________ The Nira ya valiya suy a kk handha and its commentary by Sricandra Appendices Royce Wiles August 2000 A thesis submitted for the degree of Doctor of Philosophy of The Australian National University
Page #2
--------------------------------------------------------------------------
________________ Royce Wiles 2000
Page #3
--------------------------------------------------------------------------
________________ APPENDICES I Bibliography of the Svetambara canon .. .. .. .. i-xx, 1 p Commentators on the canon and their works ... 279 III Works of Ghasilala .. .. .. .. .. 286 I Extant manuscripts of the Nirayavaliyasuyakkhandha 288 V The Nirayavaliyasuyakkhandha-paryaya 300 Index to Appendices .. .. .. .. .. .. .. 302
Page #4
--------------------------------------------------------------------------
Page #5
--------------------------------------------------------------------------
________________ APPENDIX I BIBLIOGRAPHY OF THE SVETAMBARA CANON a descriptive listing of text editions, commentaries, studies and indexes based on editions held in the Library of The Australian National University, Canberra
Page #6
--------------------------------------------------------------------------
________________ CONTENTS Abbreviations Sources .. .. .. . .. . .. . ix XV Purpose and principles of organization O The canon as a whole .. 0.1 Complete editions.... 0.2 Selections .. Studies 0.4 Editions of commentaries Studies of commentaries 0.5 .. 0.6 Dictionaries and indexes 1.5 1 Angas .. .. . 1.1 Ayaranga .. 1.2 Suyagada .. 1.3 Thana 1.4 Samavaya .. Viyahapannatti 1.6 Nayadhammakahao 1.7 Uvasagadasao 1.8 Antagadadasao 1.9 Anuttarovavaiyadasao 1.10 Panhavagaranai 1.11 Vivagasuya .. 101 105 109 113 117 2 Upangas .. ... 2.1 Uvavaiya .. 2.2 Rayapasenaijja 2.3 Jivabhigama .. Pannavana .. 2.5 Jambuddivapannatti 2.6 Surapannatti .. 2.7 Candapannatti 2.8-12 Nirayavaliyasuyakkhandha 2.4 119 123 127 129 135 139 139 143 149 151 151 151 3.5 3.6 153 153 3 Prakirnakas / Painas 3.1 Arahanapadaya - Painayariya 3.2 Arahanapadaya - Virabhadra 3.3 Arahanasara (Pajjantarahana) 3.4 Aurapaccakkhana I, II .. Aurapaccakkhana - Virabhadra .. Bhattaparinna - Virabhadra 3.7 Candavejjhaya .. ... 3.8 Causarana (Kusalanubandhi) / Virabhadra 3.9 Devindatthaya 3.10 Gacchacara 3.11 Ganivijja .. 3.12 Isibhasiyaim ... 3.13 Joisakaranda .. 154 155 157 158 159 160 163
Page #7
--------------------------------------------------------------------------
________________ 164 164 3.14 Mahapaccakkhana .. ... 3.15 Maranavibhatti (Maranasamahi) .. 3.16 Samthara .. 3.17 Saravali 3.18 Tandulaveyaliya 3.19 Titthogali 3.20 Viratthao 165 167 4 Late Prakirnakas .. .. .. .. 4.1 Arahana- Sulasasavaya .. ... 4.2 Arahanapayarana- Abhayadeva .. 4.3 Divasagarapannatti 168 168 169 5 Epistemological works 5.1 Nandisutta .. 5.2 Joganandi .. 5.3 Laghunandi (Anunnanandi) 5.4 Anuogadaraim 176 176 177 181 181 6 Mulasutras .. .. 6.1 Uttarajjhayana 6.2 Dasaveyaliya 6.3 Avassayasutta Avassa yanijjutti Visesavasyakabhasya Avasyakacurni etc. ... 6.4 Sadavassayasutta .. 6.5 Pindanijjutti .. 6.6 Oghanijjutti .. " 7 Chedasutras . . . . 7.1 Ayaradasao (=Dasasuyakkhanda] 7.2 Kappa (Bthatkalpa) .. 7.3 Vavahara .. 7.4 Nisiha.. ... .. 7.5 Mahanisiha .. 7.6 Pancakappabhasya .. 7.7 Jitakappa .. viii
Page #8
--------------------------------------------------------------------------
________________ Abbreviations for canonical texts, their parts and commentaries on them! A Classified sequence Angas Ayar. Suy. Thana. Samav. Viy. Naya. Uvas. Antag. Anuttaro. Panha. Viva. Ayaranga Suyagada Thana Samavaya Viyahapannatti Nayadhammakahao Uvasagadasao Antagadadasao Anuttarovavaiyadasao Panhavagaranai Vivagasuya Upangas Uvav. RayPa. Jivabhi. Pannav. Jambuddi. SuraP. CandaP.) [NirayaSu. Niraya. Kappi. Kapp Vad. [Pu.] [PuCu.] [VaD.) Uvavaiya Rayapasenaijja Jivabhigama Pannavana Jambuddivapannatti Surapannatti Candapannatti Nirayavaliyasuyakkhandha Nirayavaliyo Kappiyao Kappavadimsiyao Pupphiyo Pupphaculao Vanhidasao Prakirnakas / Paimnas ArahPad. Arahanapadaya - Painayariya ArahPad.(V) Arahanapadaya - Virabhadra [ArahSa.] Arahanasara (Pajjantarahana) AuraPacc. Aurapaccakkhana I, II [AuraPacc.(V)] Aurapaccakkhana-Virabhadra BhattaP. Bhattaparinna-Virabhadra Cand. Candavejjhaya Causar. Causarana (Kusalanubandhi)--Virabhadra Dev Tha. Devindatthaya Gaccha. Gacchacara GaniVi. Ganivija IsiBhas. Isibhasiyaim Joiska. Joisakarandaga MahaPacc. Mahapaccakkhana Maran Vi. Maranavibhatti (Maranasamahi) Samth. Samthara SaraPa. Saravali As a practical measure I have adopted the text sequence and text abbreviations given in the listing of the first fascicule of the Comprehensive and critical dictionary of the Prakrit languages being published from the Bhandarkar Oriental Research Institute, Pune. ix
Page #9
--------------------------------------------------------------------------
________________ Tand. Tittho. ViTha. Tandulaveyaliya Titthogali Viratthao [ArahSu.. ArahPag. [DiSapa. Arahana- Sulasasavaya Arahanapayarana-Abhayadeva Divasagarapannatti Epistemological works Nandi. Nandisutta [JoNandi. Joganandi [LaNandi. Laghunandi (Anunnanandi) AnuOg. Anuogadaraim Mulasutras Utt. Dasave. Av. SadAv. PindNi. Ogha Ni. Uttarajjhaya Dasaveyaliya Avassayasutta Sadavassayasutta Pindanijjutti Oghanijjutti Chedasutras Dasa. AyarDas. BihKapp. Vava. Nis. MahaNis. [Panka.) JIy Kapp. Dasasuyakkhanda = next Ayaradasao (VIII Pujjasanakappa-Jinacariya, Theravali, Samayari) Kappa (Brhatkalpa) Vavahara Nisiha Mahanisiha Pancakappa Jitakappa Niijuttis (Ni.) AvNi. DasaveNi. UttNi. AyarNi. SuyNi. [OghaNi. [PindNi. KappNi. Avassaya Dasaveyaliya Uttarajjhaya Ayara Suyagada Oghanijjutti] Pindanijjutti] Kappanijjutti Bhasyas (Bha.) BrhKappBha. Brhatkalpabhasya (Prakrit) Vava Bha. Vyavaharabhasya (Prakrit) NisBha. Nisithabhasya (Prakrit) Vi vBha. Visesavasyakabhasya (Prakrit) [PanKaBha.] Pancakalpabhasya (Prakrit) Jiy KappBha. Jitakalpabhasya (Prakrit) Curnis / Cunnis (Cu.) AvCu. Avasyakacurni (Prakrit) AyarCu. Acarangacurni (Prakrit) SuyCu. Sutrakrtangacurmi (Prakrit) DasaveCu. Dasavaikalikacurni I, II (Prakrit) UttCu. Uttaradhyayanacurni (Prakrit)
Page #10
--------------------------------------------------------------------------
________________ Nandicu. AnuOgCu. NisCu. JiyKappCu. Nandisutracurni (Prakrit) Anuyogadvaracurni (Prakrit) Nisithacurni (Prakrit) Jitakalpacurni (Prakrit) Tikas (T7.) AyarTi. AvT7 (H) Ayarangatika Avassayatika / Haribhadra
Page #11
--------------------------------------------------------------------------
________________ B Alphabetical sequence Antag. Antagadadasao Anubg. Anuogadaraim AnuMgCu. Anuyogadvaracurni (Prakrit) Anuttaro. Anuttarovavaiyadasao ArahPad. Arahanapadaya - Painayariya ArahPad.(V) Arahanapadaya - Virabhadra ArahPag. Arahanapayarana- Abhayadeva [ArahSa.) Arahanasara (Pajjantarahana) [ArahSu.] Arahana- Sulasasavaya AuraPacc. Aurapaccakkhana I, II [AuraPacc.(V)] Aurapaccakkhana - Virabhadra Av. Avassayasutta AvCu. Avasyakacurni (Prakrit) AvNi. Avassayanijjutti AvTI (H) Avassayatika / Haribhadra Ayar. Ayaranga AyarCu. Acarangacurni (Prakrit) AyarDas. Ayaradasao (VIII Pujjasanakappa-Jinacariya, Theravali, Samayari) AyarNi. Ayaranijjutti Ayarii. Ayarangatika BhattaP. Bhattaparinna - Virabhadra BphKapp. Kappa (Bihatkalpa) BrhKappBha. Brhatkalpabhasya Cand. Candavejjhaya CandaP.] Candapannatti Causar. Causarana (Kusalanubandhi)- Virabhadra Dasa. Dasasuyakkhanda = Ayaradasao Dasave. Dasaveyaliya DasaveCu. Dasavaikalikacurni I, II (Prakrit) DasaveNi. Dasaveyaliyanijjutti DevTha. Devindatthaya [DISAPa.] Divasagarapannatti Gaccha. Gacchacara GaniVi. Ganivija IsiBhas. Isibhasiyaim Jambuddi. Jambuddivapannatti Jivabhi. Jivabhigama JiyKapp. Jitakappa JIyKappBha. Jitakalpabhasya JiyKappCu. Jitakalpacurni (Prakrit) Joiska. Joisakarandaga Kappi. Kappiyo KappNi. Kappanijjutti Kapp Vad. Kappavadimsiyo MahaNis. Mahanisiha MahaPacc. Mahapaccakkhana Maran Vi. Maranavibhatti (Maranasamahi) Nandi. Nandisutta NandiCu. Nandisutracurni (Prakrit) Naya. Nayadhammakahao Niraya. Nirayavaliyo NirayaSu. Nirayavaliyasuyakkhandha Nisiha NisBha. Nisithabhasya NisCu. Nisithacurni (Prakrit) Nis. xii
Page #12
--------------------------------------------------------------------------
________________ s OghaNi. Panha. [PanKaBha.] Pannav. PindNi. [Pu.] [PuCu.] RayPa. SadAv. Samav. Samth. Sara Pa. SuraP. Suy. SuyCu. SayNi. Tand. Thana. Tittho. Utt. UttCu. UttNi. Uvas. Uvav. Vava. VavaBha. [VaD.] Viva. ViAvBha. ViTha. Viy. ABORI Abhi. AKM Alpa. ANU BEI Bollee BORI BORI Cat. BSOAS CASS CCDPL CGRM CLIO CRL de Jong Oghanijjutti Panhavagaranai Pancakalpabhasya GSAI IA Pannavana Pindanijjutti Pupphlyao Pupphacalao Rayapasenaijja Sadavassayasutta Samavaya Samthara Saravali Surapannatti Soyagada Sutrakitangacarni (Prakrit) Suyagadanijjutti Tandulaveyaliya Abbreviations for sources (where necessary further details of these are provided in the next section "Sources"). Thana Titthogali Uttarajjhaya Uttaradhyayanacurni (Prakrit) Uttarajjhayanijjutti Uvasagadasao Uvavaiya Vavahara Vyavaharabhasya Vanhidasao Vivagasuya Visesavasyakabhasya Viratthao Viyahapannatti Annals of the Bhandarkar Oriental Research Institute Abhidhanarajendra of Vijayarajendra (see dictionary section, 1910-25) Abhandlungen fur die Kunde des Morgenlandes Alpaparicitasaiddhantikasabdakosah / Anandasagarasuri (1954-79) (see dictionary section) Australian National University, Canberra, Australia Bulletin d'Etudes Indiennes W. B. Bollee, personal library Bhandarkar Oriental Research Institute library, Pune Descriptive catalogue of the government collections of manuscripts deposited at the Bhandarkar Oriental Research Institute Bulletin of the School of Oriental and African Studies, London Centre for Advanced Study of Sanskrit, University of Poona, Library A Comprehensive and critical dictionary of the Prakrit languages Catalogue of the Gujarati & Rajasthani manuscripts in the India Office Library Catalogue of the Library of the India Office Centre for Research Libraries (US) J. W. de Jong, Canberra, personal library (after Prof. de Jong's death in January 2000 this library was relocated to the Univ. of Canterbury, Christchurch, NZ). Giornale delle Societa Asiatica Italiana Indian antiquary xiii
Page #13
--------------------------------------------------------------------------
________________ JA JAS JL JRK JSBI JSK LC(CN) LD NBC NCC NIA Patan PPN RW SAMP Weber WZKM WZKS ZDMG ZII Journal asiatique Jaina Agama series Jaina-laksanavali Jinaratnakosa, see Velankar, Hari Damodar Jaina sahitya ka brhad itihasa Jainendra siddhanta kosa (1970-73) (see listing of dictionaries etc.) Library of Congress (Control Number) L. D. Institute, Ahmedabad, Library New book collection (ANU library) New catalogus catalogorum New Indian antiquary Sri-Hemacandracarya Jain Jnanamandira, Patan, Uttara Gujarata Prakrit proper names/Mohanal Mehta (1970-72) (see dictionary listing below) Royce Wiles, Canberra, personal library South Asia Microfilm Project Weber's History of Indian literature Wiener Zeitschrift fur die Kunde des Morgenlandes Wiener Zeitschrift fur die Kunde Sudasiens Zeitschrift der Deutschen Morgenlandischen Gesellschaft Zeitschrift fur Indologie und Iranistik General abbreviations cty not held ANU, not seen / checked commentary folios manuscript(s) pages portraits M (MSS) port. xiv
Page #14
--------------------------------------------------------------------------
________________ SOURCES In addition to the holdings of The Australian National University Library I have included references to other published editions. Details of the main sources for this information are given below. Alsdorf, Ludwig. 1958. Itthiparinna: a chapter of Jain monastic poetry, edited as a contribution to Indian prosody. IIJ 2 (1958) 249-270. See also Bruhn 1996, 38. Balbir, Nalini. 1993. Avasyaka-Studien : introduction generale et traductions. Stuttgart: Franz Steiner. 2 v. ; 24 cm. (Alt- und Neu-Indische Studien ; 45,1). v.1 482 p. v. 2 203 p. Reviews. Herman Tieken. Asiatische Studien = Etudes asiatiques 48 (1994) 1415-25.-- Paul Dundas. Recent research on Jainism. Religious studies review 23.2 (1997) 117. Blumhardt, J. F. 1915. A Supplementary catalogue of Marathi and Gujarati Books in the British Museum/ by J. F. Blumhardt. London: British Museum. (Gujarati printed books, column 233). Bollee, Willem B. 1977-88. Studien zum Suyagada: die Jainas und die anderen Weltanschauungen vor der Zeitenwende: Textteile, Nijjutti, Ubersetzung und Anmerkungen. Wiesbaden: Franz Steiner. 2 v. ; 24 cm. (Schriftenreihe des Sudasien-Instituts der Universitat Heidelberg : Band 24, 31). Teil 1. x, 218 p.-Teil 2. viii, 301 p. Herman Tieken. 'Textual problems in an early canonical Jaina text' WZKS 30 (1986) 525. Criticism of Teil 1. ANU BL1312.3.S886 B64 Bruhn, Klaus. 1993. Jainology in Western publications I, Jain studies in honour of Joseph Deleu / edited by Rudy Smet and Kenji Watanabe. Tokyo: Hon-no-tomosha. p. 13-42. ANU NEW BOOKS COLLECTION MENZIES 2 064 239 Bruhn, Klaus. 1996. Ludwig Alsdorf's studies in the Arya. Berliner Indologische Studien 9-10 (1996) 7-53. Contents: SS1 Studies in the Prakrit Arya I (the context) 7-18.-SS2 Studies in the Prakrit Arya II (Uttaradhyayana) 18-38 [vantam apatum] (1955) 18-19.-The Story of Citta and Sambhuta (1957) 19-20.-Namipavajja (1962) 20-21.-Uttarajjhaya studies (1962) 21-23. The Arya stanzas of the Uttarajjhaya 23-38.-Itthiparinna (1958) 38.]--SS3 Les etudes jaina 38-42.-SS4 Studies in the Pali Arya 42-45 [Arya stanzas in Thera-therigatha (1966) 42.-Die Arya-Strophen des Pali-Kanons (1968) 43-45.-Bemerkungen zu einem metrischen Fragment des Mahaparinirvanasutra (1955) 45.-Verkannte Mahavastu-Strophen (1968-69) 45.]--SS5 Abbreviations and bibliography I (Jaina texts). 46-47. SS6 Abbreviations and bibliography II (modern works) 48-53. A "consolidated and systematic review" of Alsdorf's studies treating eleven separate publications giving critical comments and adding bibliographical information. Bruhn, K. and C. B. Tripathi. 1977. Jaina concordance and bhasya concordance. In, Beitrage zur Indienforschung: Ernst Waldschmidt zum 80. Geburtstag gewidmet. Berlin: Museum fur Indische Kunst. 571 p. ; 26 cm. (Veroffentlichungen des Museums Fur Indische Kunst Berlin: Band 4). p. [67]-80. Supplemented by Tripathi 1981. Caillat, Colette. 1968. Notes de bibliographie jaina. Journal asiatique 256 (1968) [145]-155. Catalogue of the Gujarati & Rajasthani manuscripts in the India Office Library / by the late James Fuller Blumhardt; revised and enlarged by Alfred Master. London: Oxford University Press, 1954. x, 167 p. ; 26 cm. Contents: Frontispiece [Two specimen manuscripts]-Foreword / S. C. Sutton, London XV
Page #15
--------------------------------------------------------------------------
________________ 17 Nov. 1953 [v]. - Abbreviations and bibliographical details ix-xi.- Gujarati manuscripts 2-133. Rajasthani manuscripts 141-56.- Index to Gujarati articles 157-65.- Index to Rajasthani articles 166-67. ANU Z6621.668G8 Catalogue of the Library of the India Office. 1938-57. Volume 2, part 1 (Revised edition). Sanskrit books / by Prana Natha and Jitendra Bimala Chaudhuri. London: H.M.S.O. 5 v.: 24 cm. ANU OS3 Z7049.13 v.2 pt. 1-5 A Comprehensive and critical dictionary of the Prakrit languages : with special reference to Jain literature. 1993-1996>. General editor A[mrit). Madhav]. Ghatage. Poona : Bhandarkar Oriental Research Institute.
; 29 cm. v. 1 Fasc. 1 1993 vi,*25, xxxvi, 1-104 p. RW Descriptive catalogue of the government collections of manuscripts deposited at the Bhandarkar Oriental Research Institute. v. 17: Jaina literature and philosophy. Agamika literature 1935-54. Compiled by Hiralal Rasikdas Kapadia. Poona : Bhandarkar Oriental Research Institute. [Janert 1965 $264] Part 1: (a) Angas, Upangas, Prakirnakas. 1935. xxi, 390 p. Part 2: (a) Chedasutras, Nandi. AnuOg. Appendices. 1936. xxii, 363, 24 p. The five appendices give examples of Jaina characters and symbols from MSS (p. 337-63). Also contains significant Addenda to Part 1 and 2. Part 3: (a) Mulasuttas (Utt., Dasa., Av., SadAv., PindNi., OghaNi., Paksikasutra. 1940. xxxii, 530 p. Part 4: (a) Miscellaneous (b) Ritualistic works (c) Supplement. 1948. xx, 276 p. Part 5: Ten appendices. Index of authors, works, classification of works by language, dated works, dated MSS, chronograms, cosmological data, proper names. 1954. 6, xxii, 298 p. ANU OS3 Z6620.15 P6 v.17 pt. 1-5 Devendra Muni. 1977. Jaina Agama sahitya : manana aura mimamsa : Jaina vangmaya ka paricayatmaka adhyayana = A Panoramic study of Jain canonical literature with comparative study of relevant Buddhist and Vedic texts. Udayapura, Rajasthana : Sri Taraka Guru Jaina Granthalaya. 32, 768 p. ; 23 cm. (Sri Taraka Guru Jaina granthamala ; pushpa 71). ANU BL1310.4.D48 1977 DLJP series list "Srisethadevacandralalabhaijainapustakoddharaphandanam prakasano" v. 1-126 (1911-79) printed in v. 5 of the dictionary Alpaparicitasaiddhantikasabdakosah (1954-79) (p. 22-26 (1st group), full citation in dictionary section below). Supplemented (especially for the Curni publications) by information given on the plate of Anandasagara (v.3, facing p. 9). Dundas. Paul, 1992. The Jains. London: Routledge, 1992. x, 276 p. ; 23 cm. (Library of religious beliefs and practices.) Review. Julia Leslie BSOAS 58 (1995) 584-87. ANU BL1351.2.D86 1992 Folkert, Kendall W. (1942-85) 1993. Scripture and community: collected essays on the Jains/edited by John E. Cort. Atlanta, Georgia : Scholars Press, 1993. xxiv, 450 p. ; 23 cm. (Studies in World Religions; no. 6). Contents: Foreword / William A. Graham ix-xi.- Introduction : Kendall Folkert and the study of the Jains / John E. Cort xiii-xxiv.-Published works of Kendall W. Folkert xxvxxvi.- List of illustrations xxvii- Part I Scripture, community and the history of Jain studies 1-211: 1. Introduction to Jainism 1-21.-2. Jain studies 23-33.-3. Scripture as a phenomenological category 35-39.4. Scripture and continuity in the Jain tradition 4152.-5. The 'Canons' of 'Scripture': text, ritual, and symbol 53-83.-6. The Jain scriptures and the history of Jainism 85-94.-7. Jain religious life at ancient Mathura : the heritage of late-Victorian interpretation 95-112.-8. 'Faith' and 'System : darsana in the Jain xvi
Page #16
--------------------------------------------------------------------------
________________ tradition 113-46.-9. Samosarana : the Jina at the center 147-52.-10. The Gaccha and Jain history 153-66.-11. The Jain sadhu as community builder 167-74.-12. Monastic ideals and the lay community in religion 177-86.-13. Notes on paryusan in Sami and Ved 189-211.- Part II. A Jain approach to non-Jains : the 363-account. 213-337 : 14. The problem of attitudes 215-27.-15. The 363-account : key elements 229-45.-16. The 363-account: the four main headings 247-77.-The 363-account: the structure of the whole 279-309.-18. The 383-account: texts 311-37-Part III. Four Jain philosophical compendia : 19. Introduction to the compendia 341-43.-20. Sarvasiddhantapravesaka [translated from the edition of Muni Jambuvijaya 1964] 345-57.-21. Rajasekhara, Saddarsanasamuccaya (translation based on edition by Haragovindadasa and Becaradasa Vira sam. 2436 [191071/359-82.-22. Merutunga Saddarsananirnaya (translation based on the text of Nagin J. Shah 1973) 383-97.-23. Jinadatta, Vivekavilasa (v.) 238-302 translation is based solely on the text of the compendium-section printed in R. B. Bhandarkar's Report for 1883-84") 399-409.-Bibliography 411-32.--Glossary of Sanskrit, Prakrit, Pali and Gujarati technical terms 433-41.-Index 443-50.-Reprinted works of Kendall Folkert. Several of the chapters are extracts from Folkert's 1975 PhD thesis (Jaina approaches to non-Jainas: patterns and implications (Harvard University)] while others have been written on the basis of his grant proposals. Review Paul Dundas. Recent research on Jainism. Religious studies review 23.2 (1997) 113-15. ANU BL1355.F65 1993 Emeneau, Murray Barnson. [1935) 1967. A Union list of printed Indic texts and translations in American libraries. New Haven, Connecticut : American Oriental Society. xv, 540 p. ; 26 cm. Reprint. New York: Kraus, 1967. ANU 3 Z7049.13.E5 Ghatage, A. M. 1942. A brief sketch of Prakrit studies. Progress of Indic studies 1917-42. Poona : BORI. [153]-174. Guerinot, Armand. 1906. Essai de bibliographie jaina : repertoire analytique et methodique des travaux relatifs au jainisme : avec planches hors texte. Paris : Ernest Leroux. xxxvii, 566 p. (Annales du Musee Guimet, Bibliotheque d'Etudes; 22). Contents: Avant-propos [i]-iii.--Introduction (survey of Jainism) [v]-xxxvii.-Essai de bibliographie jaina 1-484.-Index I Auteurs et ouvrages 485-508-II Auteurs jainas 509-18.-III Ouvrages jainas 519-31.-IV Index geographique 533-42.-V Index des periodiques 543-55 ("up to and including 1905" p. ii).-VI Index general 557-66.-- Table des matieres. The principal aim is to be an introduction to a catalogue of Jain authors and works. Only significant reviews have been listed, and only some Indian printings, especially those of Bhimasimha Manaka, a competent editor and bookseller of Bombay (Avant-propos). ANU BLZ7835. J2. G84 1906 Hanayama, Shinsho. 1961. Bibliography of Buddhism / edited by The Commemoration Committee for Prof. Shinsho Hanayama's Sixty-first Birthday. Tokyo: The Hokuseido Press, 1961. xii, 869 p. ; 26 cm. ANU OS rb1807 4227 Hara, Minoru and Michihiko Yajima. 1985. A Bibliography of Prakrit language and literature : being a provisional list of books, articles and reviews, arranged alphabetically according to authors/ compiled by Minoru Hara and Michihiko Yajima. Tokyo : [no publisher). [2], x, 152 p. ; 26 cm. Brief introduction in Japanese. Two alphabetic sequences p. 1-125, Additions 126-52, [7] loose pages of additional entries inserted at the end of the book, handwritten additions. Cover stamped Private circulation." xvii
Page #17
--------------------------------------------------------------------------
________________ Jain, Sagarmal and Arun Pratap Singh. 1983. Doctoral dissertations in Jaina and Buddhist studies : including Pali, Prakrit and Apabhransa. Varanasi : P. V. Research Institute. xi, 100 p. ; 22 cm. (Parshvanath Vidyashram series ; 30). Classified listing of theses (in English and Hindi) submitted to Indian universities. The earliest thesis listed is 1925, the latest 1983. ANU MENZIES ASIAN REFERENCE BLZ7835.J2J2 Jaina-laksanavali: Jaina paribhasika sabda-kosa = An authentic and descriptive dictionary of Jaina philosophical terms / sampadaka Balacandra Sastri. Dilli : Vira Seva Mandira, Vi[ra nir[vana samvat 2498-2505 [1972-79). 3 v. ; 27 cm. (Vira-Seva-Mandira granthamala ; granthanka 15). 1. bhaga, a-au 2498 (1972). [15], [87], 312, 22 p. "Bibliography." Alphabetical and chronological tables of authors cited. 2. bhaga, kakva-pausnakala, 2499 [1973]. 8, 730, 22 p. 3. bhaga, prakarana-hrasva, 2505 [1979]. xii, 48,[729]-1220 p. Introduction includes notes on Jain glossaries etc. (p. x). ANU LARGE BOOK PK965.844 v.1-3 Jaina sahitya ka brhad itihasa/ sampadaka Dalasukha Malavaniya ; Mohanalala Mehata. Varanasi: Parsvanatha Vidyasrama Sodha Samsthana. 1966 <1973>. 1-<>v. ; 22 cm. (Parsvanatha Vidyasrama granthamala <6, 7, 11, 12, 14, 20>). 1. bhaga Anga Agama / lekhaka Becaradasa Dosi. 1966. 76, 314 p. Angabahya Agama / lekhaka Jagadisacandra Jaina va Mohanalala Mehata. 1966. 18,442 p. Agamika vyakhyaen / lekhaka Mohanalala Mehata. 1967.8, 548 p. Karma-sahitya va Agamika prakarana/lekhaka Mohanalala Mehata va Hiralala Ra. Kapadiya. 1967. 17, 386 p. Laksanika sahitya / lekhaka Ambalala Pre. Saha. 1969. 40, 294 p. Kavya-sahitya / lekhaka Gulabacandra Caudhari. 1973. 11, 705 p. *7. Kannada, Tamila, evam Marathi Jainasahitya. 1981. ANU PK5001.A2M3 v.1-6 Janert, Klaus Ludwig. 1961. Verzeichnis indienkundlicher Hochschulschriften: Deutschland OsterreichSchweiz. Wiesbaden : Otto Harrassowitz. ix, 80 p. ; 21 cm. ANU OS3 Z3201.J3 Janert, Klaus Ludwig. 1965. An annotated bibliography of the catalogues of Indian manuscripts. Part 1. Wiesbaden: Franz Steiner. 175 p. ; 25 cm. (Verzeichnis der orientalischen Handschriften in Deutschland. Supplementband 1). ANU OS3 Z6605.07. V42 Bd. 1 Josi, Saloni N. 1987. Jaina Agamasahitya : cayanatmaka vangmayasuci. Master's thesis. Gujarat University, Ahmedabad. 127 p. ; 29 cm. RW Kapadia, Hiralal Rasikdas. 1941. A history of the canonical literature of the Jainas/ by Hiralal Rasikdas Kapadia. Gopipura, Surat : Hiralal Rasikdas Kapadia. ix, 272 p. ; 20 cm. Contents: Preface [iii]-iv.-Analysis [v]-ix.--Chapter 1. Genesis of the Jaina scriptures [1]-19.-2. Classifications of the Agamas [20]-58.-3. Redaction of the Jaina canon [59]-69.-4. The extinct Agamas of the Jainas (70)-110.-5. The extant Agamas of the Jainas (1111-170.-6. The canonical exegetical literature [171]-205.-7. Comparison and evaluation [206)-231.-Index 1. Names of authors and other persons and sects and the like [232]-240.--Index 2. Names of works, their sections, doctrines, metres etc. [241]264.--Additions and corrections [265)-272. RW xviii
Page #18
--------------------------------------------------------------------------
________________ Kohl, Josef Friedrich. 1937. Die Suryaprajnapti und ihr textgeschichtliches Verhaltnis zur Jambudvipaprajnapti nebst einem Spezimen. (Teildruck). Bonn, 1937. xlii, 18 p. ; 24 cm. Bonn, Phil. Diss. MahaNis. 1963. Studien zum Mahanisiha : Kapitel 1-5/ von Jozef Deleu und Walther Schubring. Hamburg: Cram, de Gruyter. x, 240 p. ; 27 cm. (Alt- und Neu-Indische Studien ; 10). ANU LARGE BOOK PK5003.A55M34 Nagraj, Muni. 1986- Agama and Tripitaka : a comparative study : a critical study of the Jaina and the Buddhist canonical literature = Agama aura Tripitaka : eka anusilana / English version by Mahendra Kumarji and K. C. Lalvani; edited by Bhupendra Swarup Jain and Raghunatha Sarma. New Delhi : Today & Tomorrow's Printers and Publishers.. v. <1->; 25 cm. Original published in 3 vols, 1969-91. ANU BQ4610.J3/N24/ 1986 v. 1 New catalogus catalogorum : an alphabetical register of Sanskrit and allied words and authors. 1966 <1988>. V. Raghavan (later volumes have different editors). Madras : University of Madras. v.1 Revised edition 1968. Latest available v.12 (up to pradhyana) 1988. ANU MENZIES ASIAN REFERENCE 26605.S3.A923 v.1-12 Roth. Gustav. 1983. Malli-jnata : das achte Kapitel des Nayadhammakahao im sechsten Anga des Svetambara Jainakanons : herausgegeben, ubersetzt und erlautert. Wiesbaden: Franz Steiner. 230 p. ; 25 cm. (Monographien zur indischen Archaologie, Kunst und Philologie ; 4). ANU BL1312.3.N3942 M3515 1983 Roth, Gustav. 1986. Indian studies : selected papers / by Gustav Roth. Delhi : Sri Satguru Publications. (Bibliotheca Indo Buddhica ; no. 32). ANU (BQ120.R672 1986 Schubring, Walther. 1935. Die Lehre der Jainas nach den alten Quellen dargestellt. Berlin : Walter de Gruyter. 251 p. ; 25 cm. (Grundriss der indo-arischen Philologie und Altertumskunde : Band 3, Heft 7). Review. Ludwig Alsdorf DLZ 57 (1936) 917-21. ANU BL 1351.542 Abridged translation. The doctrine of the Jainas:described after the old sources/translated from the revised German edition by Wolfgang Beurlen. Delhi : Motilal Banarsidass, 1962. viii, 335 p. ; 24 cm. 2. ed. 1978. Review of 2. ed.: Willem) Bollee) ZDMG 130 (1980) p. 661. ANU BL1351.5413 Schubring, Walther. 1944. Die Jaina-Handschriften der Preussischen Staatsbibliothek: Neuerwerbungen seit 1891 / unter redaktioneller Mitarbeit von Gunter Weibgen. Leipzig : Otto Harrassowitz. xiii, 647 p. ; 28 cm. (Verzeichnis der Handschriften im Deutschen Reich ; Teil 3, Reihe 1, Band 1). ANU OS3 Z6605.15.B4 Stache-Rosen, Valentine. [1980-81) 1990. German indologists : biographies of scholars in Indian studies writing in German. Second revised edition by Agnes Stache-Weiske. New Delhi : Max Mueller Bhavan. 271 p. ; 24 cm. ANU DS435.5.573 1990 Tatia, Nathmal and Muni Mahendra Kumar. 1981. Aspects of Jaina monasticism. Ladnun: Jain Vishva Bharati, 1981. xxix, 140 p. ; 25 cm. Contents: Publishers' note/R. K. Jain, 15 May 1981 v.-Preface (viil-xv. Introduction [xvii]-xxv.-Contents (xxvii]-xxix.- Chapter 1. The five vyavaharas or the sources of monastic legislation [1]-4.-2. The samacari or the ten rules of monastic deportment xix
Page #19
--------------------------------------------------------------------------
________________ (5)-10.-3. The asamahitthanas or the twenty occasions of the imbalance of mind AyarDas. chapter 1][11]-13.-4. The sabalas or the twenty-one types of monks with tainted conduct [14]-20.-5. The four stages of sin [21]-26.-6. Asayana or disrespectful conduct (Ayarbas. chapter 3) (27)-30.-7. Ganisampada or the qualifications of the ganin (religious head) [AyarDas. chapter 41 (31)-35.-8. Cittasamahitthanas or the ten stages of the concentrated mind (AyarDas. chapter 4] [36]-40.-9. The four monastic courses (41)-86.-10. The ideal monk (Utt.chapter 15, Dasave. chapter 10] [87]-95.11. The victor's penance (Ayar. chapter 9] [96]-107.-Appendix. A note on the word "monasticism" [108].-Bibliography (109)-112.-Sanskrit, Prakrit and Pali words [113]134.-English words [135)-140.--Corrigenda (141). Articles for the "Encyclopaedia of Jainism" to be published by Jain Vishva Bharati, Ladnun (I am uncertain if that was ever published). Tripathi, Chandrabhal. 1975. Catalogue of the Jaina manuscripts at Strasbourg. Leiden: E. J. Brill. xviii, 425 p. ; 5 leaves of plates ; 30 cm. (Indologia Berolinensis ; Band 4). Review. Colette Caillat OLZ 75 (1980) 71-73. ANU LARGE BOOK 26621.87753 1975. Tripathi, Chandrabhal. 1981. The Jaina concordance in Berlin: a bibliographical report. Studien zum Jainismus und Buddhismus : Gedenkschrift fur Ludwig Alsdorf / herausgegeben von Klaus Bruhn und Albrecht Wezler. Wiesbaden : Franz Steiner. (Alt- und Neu-Indische Studien ; 23). p. (301)-329. A supplement to Bruhn and Tripathi 1977. Velankar, Hari Damodar. 1944. Jinaratnakosa : an alphabetical register of Jain works and authors. Volume 1 Works (no more published). Poona : Bhandarkar Oriental Research Institute. x, 466 p. ; 27 cm. (Government Oriental Series Class C, no. 4). ANU Z7835.J2 V4 1944 v.1 Vogel, Claus. 1979. Indian lexicography. Wiesbaden: Otto Harrassowitz. [303]-401 p. ; (A History of Indian literature : v. 5 Scientific and technical literature, part 2, fascicle 4). ANU PK171.16 Windisch, Ernst. 1917-21 (1992). Geschichte der Sanskrit-Philologie und Indischen Altertumskunde [I., II. Teil sowie nachgelassene Kapitel des III. Teils. Teil I. Strassbourg : Karl J. Trubner, 1917.- Teil II. Berlin : Walter de Gruyter, 1920.Teil III. Leipzig : F. A. Brockhaus, 1921. [Reprint in one volume: "Um ein Namen- und Sachverzeichnis zum III. Teil erweiterter, ansonsten unveranderter Nachdruck der Ausgabe von 1917, 1920 und 1921." | Berlin: Walter de Gruyter, 1992. (Abhandlungen fur die Kunde des Morgenlandes ; 15, no. 3). ANU PK407.W5 1992 Winternitz, Moriz. [1933] 1971. [Geschichte der indischen Literatur.]? A history of Indian literature. Volume 2: Buddhist literature and Jaina literature : translated from the original German/by S. [V.) Ketkar and H. Kohn and revised by the author. Calcutta, 1933. xx, 673 p. Reprint. New York: Russell & Russell. ANU PK2903.W63 1963 v.2 2 For a full bibliographic history of this important work see Winternitz, Moriz. 1991. Kleine Schriften / herausgegeben von Horst Brinkhaus. Stuttgart : Franz Steiner. 2 v. (Glasenapp-Stiftung : Band 30), 1: viii-ix. XX
Page #20
--------------------------------------------------------------------------
________________ PURPOSE AND PRINCIPLES OF ORGANIZATION The aim of this compilation is to provide a comprehensive descriptive listing of published editions of the texts usually counted as belonging to the "Canon" of the Svetambara Jains. This listing was made primarily as an aid to my PhD research. These pages started out as a hand-list for my own use, in particular so that I would know which editions and which commentaries were available to me here in Canberra, the entries have therefore been compiled firstly from the holdings of The Australian National University Library. In order to present the wider context of published editions and studies I have added references taken from the sources listed above. I have not been able to see a number of important editions but have retained entries for those from other sources. All entries marked with an asterisk are derived from such secondary sources, some such entries still lack diacritics. Although I have tried to make the list reasonably comprehensive, I am sure many editions published in India and elsewhere have escaped me, as will have a number of translations, however, I hope to have registered the most important. The references to existing studies are only those that I have come across while preparing this listing, and no attempt has yet been made to systematically seek out the various articles on each text. Where possible I have also added to the descriptions evaluative comments from scholars. For each text I have arranged information under the following headings (where appropriate): Author: Attributions are indicated where known. Title: For practical reasons I have used the Prakrit forms of the titles for the main headings and given here other forms. The abbreviations cited follow those of the Pune Prakrit dictionary (CCDPL). Content: As a temporary and rough guide I have simply quoted an extract from Winternitz (1933:2). References: For further information, especially on unpublished commentaries. Exegesis: If a commentary or sub-commentary has been published alone, I cite the publication details here. If it has been published with the text edition, I give a cross-reference to the edition listed in the next section. The Jinaratnakosa (JRK) gives considerable information on commentaries, however, because it is based on secondary sources the information is not totally reliable. I have rearranged this information into rough chronological sequence where the dates of commentaries are known. Undated commentaries are then given in alphabetical sequence by author or title. Editions: For each publication I have tried to give a standardized bibliographic description based largely on the title-page. Entries beginning with an asterisk however are taken from secondary sources, the references in square brackets at the end of such an entry indicating those sources. A slash (/precedes a statement of authorial or editorial responsibility. I have tried to distinguish carefully between publishers and printers. Dates: To convert Vikram dates I have subtracted the nominal conversion figure of 57; for Vira era dates, -526. Part way through creating the entries I decided to give more complete date information to aid identification of editions, this is necessary because some bibliographers cite only Vikram or Vira era dates. By giving all the original dates from the title-page etc. it will be easier to reconcile cases where different conversion figures are used. Dates with angled brackets, eg. 1969<< >, indicate that publication began in 1969 but has not been completed as far as the information I have is concerned If a date appears within the angle brackets that is the date of the last publication known to have appeared in the set. Dates such as 1980a, 1980b follow the normal pattern of date citation, however a date such as 1960z, means that the work was very likely published in the 1960s but the precise year is not known. Sources: Wherever possible I have extracted information on the sources for the text of each edition. 1 Cross-references: to refer to particular editions I have simply used the abbreviation for the text followed by a full-stop and then the year of publication; eg. Ayar.1934--is the Ayaranga edition published in 1934; Ayar.partial edition. 1978--is the Ayaranga partial edition published in 1978; Ayar.study. 1964-is the study of the Ayaranga published in 1964.
Page #21
--------------------------------------------------------------------------
________________ Sub-arrangement of bibliographic entries: Editions Complete editions of the text, with or without commentary. Partial editions, selections, anthologies, etc., arranged by date. Translations Complete translations, arranged by language and date. Partial translations, arranged by language and date. 5 Studies Arranged by author and date. 6 Indexes Arranged by date and including references to indexes in individual editions. The sections on the Avasyaka literature have a very limited compass because the material is so diverse and not yet well-documented. In January 1997 I gave a presentation based on an early form of this compilation to the Jain Studies panel at the Tenth International Sanskrit conference (Bangalore): "Towards a comprehensive bibliography of Jain literature." After that presentation I made twenty-five copies of the listing and mailed them out to Jain scholars in Europe, India, Japan and the United States. Although the listing has remained largely the same since then, I have endeavoured to remove typing errors and have continued to add references to editions and studies. Royce Wiles Canberra, 31 July 2000
Page #22
--------------------------------------------------------------------------
________________ This section provides a bibliographic overview of the more comprehensive published editions of canonical texts. Full bibliographical details for the editions of individual texts are given in the appropriate individual sections which follow. These editions are discussed in the Introduction (p. xiv-xxxiv). 0.1 COMPLETE EDITIONS 1 1 2 3 4 5 1 0 THE CANON AS A WHOLE 1 2 3 3.1 4 5 6 7 8 9 10 Dhanapatisimha Dugar Agamodaya Samiti Amolaka Rsi Agamaratnamanjusa Suttagame Ghasilala Mahavira Jaina Vidyalaya Jaina Visva Bharati (Ladanum) Sri Harsapuspamrta Jaina granthamala Jinagama granthamala (Byavara) 45 Agamasuttani (Badodara) 1874 <1900> 1911-49 1915-19 1941 or 1942 1953-54 1936-73 1968-<1989> 1974-89 1974-78 1979-94 1996 page 1 3 9 11 11 11 14 15 19 19 21 The edition sponsored by Dhanapatisimha Dugar 1874 <1900>1 *Acaranga-sutra : Ganadhara-Sudharmma-svami-krta-mula-sutra tadupari Sri-Hamsasurikrta-Dipika-tika Sri-Silangacarya-krta-Acaranga-tika evam Sri-Bhagavan-Payacandaji-krta[Gujarati]-bhasa/Sri-Bhagavan-Vijayasadhuna samsodhitam. Kalakatta: Nutana-Samskrta Press 1936 [1879]. [1], 437, 283 p. ; 26 x 31 cm. (Sriyukta Raya Dhanapatisimha Vahadura ka Agama-Sangraha; 1). [CLIO 1, 21; Schubring 1935, SS45.1; Univ. of Chicago Library catalogue] *Srisuyagadanga-sutra: dvitiyangam, tika tatha Balavabodha sahitam/Bhimasimha Manekakhya sravakem pritipurvaka prasiddha kodhum. Mumbapuri : Nirnayasagara Mudrayantra, samvat 1936. 1880. 28 1020 p. ; 28 cm. (Raya Dhanapatisimha Bahadura ka Jainagamasangraha; 2. = Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 2).ernitz 1933: 2, 438 n1; Schubring 1935, SS45.2; Univ. of Chicago Library catalogue] Sthananga sutra: trtiyanga: Ganadhara Sudharma Svami sankalita sutra tadupari Srimadabhayadeva Suri krta Samskrta tika aura Megharaja krta bhasa tika yuta / Brhannagari Launkagacchiya vacanacarya Sriramacandragani sisya Rsi Nanakacanda se samsodhita hoke mudrita huva. Banarasa : Jaina Prabhakara Jatau, samvat 1937. Isavi san 1880. 8, [4], 596 p. 11 x 30 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 3). *Atha tikavarttikasamvalitam Samavayanga: caturthangasutram prarambhyate. Banarasa : Jaina Prabhakara, samvat 1937. 1880. 254 [ie 508] p.; 12 x 30 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 4). [Emeneau SS3920; BORI Cat. 17:1, 71; Univ. of Chicago Library catalogue; Josi 1987, 61; An Illustrated AMg. dictionary 192338:1, xxxii, item 46] Atha Bhagavati-sutra-pancamanga-prarambha : Launkagacchiya-Sri-Rama-candra-Gani Although I have only been able to physically examine three volumes so far-Thana.1880, Uvav.1879 and NirayaSu.1885-I have been able to compile reasonably detailed descriptions of the other volumes by piecing together information from a number of sources, as indicated in each entry. According to the publication details traced so far, the edition seems not to have been completed, ie. I have yet to trace publication details for volumes 17, 18, 34, 35, 37-40, 42.
Page #23
--------------------------------------------------------------------------
________________ krta-Samskrtanuvada-yuta / Ganadhara-Sudharma-Svami-sankalita sutra tadupari SrimadAbhayadeva-Suri-krta Samskrta-tika aura Megharaja-Gani-krta (Gujarati]-bhasa-tika-yuta. Benares: s.n., samvat 1938 (1881). 4v.; 16 x 31 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 5). [CLIO 1, 379; Univ. of Chicago Library catalogue *Jnatadharmmakathanga-sutra : sasthama anga / Ganadharasudharmasvamikstamulasutra tad upari Srimadabhayadevacaryya Suriksta tika; Vijayasadhuna samsodhitam. Kalikata : Nutana Samskrta Yantra, samvatsare 1933 [1876). [3), 1530 p. ; 11 x 25 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 6). [CLIO 2, 1190; Emeneau $3922. Roth 1983, 9-10; Univ. of Chicago Library catalogue] *Upasakadasasutra : saptama anga / Ganadharasudharmasvamikstamula sutra tadupari Srimadabhayadevacaryya Surikrtatika ; Sri Bhagavan Vijayakta [Gujarati] bhasa samsodhita. Calcutta : s.n., 1933 [1876). [3], 4,233 p.: 11 x 25 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha : 7). (Emeneau 3924; CLIO 4, 2818; Univ. of Chicago Library catalogue *Sriantagadadasanam Tavva bhasya sahita prarambhithai. Calcutta : Satya Press. [1], 82, [1], p. ; 11 x 27 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 8). ["Volume contains no series statement." Univ. of Chicago Library catalogue.] (CLIO 1, 133] *Sri Anuttarovavaiyadasanam (Gujarati] Tavva bhasya sahita prarambhi thai. Calcutta : Satya Press, samvat 1931 [1874). [1], 18, [1] p.: 11 x 27 cm. Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 9). [CLIO 1, 133. Schubring 1944, 13; "Volume contains no series statement." Univ. of Chicago Library catalogue) *Prasnavyakaranakasutra : dasama anga / Ganadharasudharmasvamikstasutra tadupari Srimadabhayadevacaryya Surikrta tika ; Sribhagavan Vijayaksta (Gujarati] bhasa samsodhita. Calcutta : NutanasamskTtayantre, 1933 (1876). [4], 542 p. ; 11 x 25 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 10). [CLIO 3, 1957; Schubring 1944, 14; JRK 274; JSBI 1, 247; Univ. of Chicago Library catalogue *Vipakasutra/Ganadhara Sudharmasvamikrtamulasutra, tadupari Srimadabhayadevacaryya Surikstatika; Vijayakstabhasa samsodhita. Kalikata : Nutanasamsketayantra, samvat 1933 11876). 279 p. ; 11 x 26 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 11). [Emencau 3930; Univ. of Chicago Library catalogue Sri Ubabaisutra : prathama upanga / Ganadhara Sri Sudharmma Svami krta mulasutra, tadupari Saratharagache Sri Abhayadeva Suri krta tika : tadupari Lupaka-gache Sri Amstacandra Suri krta Bala valbodha ; Sri Satyavrate ke dvara samsodhita hokara. Calcutta : Sri Satyavrata, samvat 1936 (1879). [2], 164 [ie. 4, 364) p. ; 12 x 31 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 12). [Schubring 1935 $47; CLIO 1, 238; Univ. of Chicago Library catalogue] *Raya paseni ji sutra : dusara Upanga / Ganadhara Srisudharmmasvamiksta mulasutra, tadupari Malayagiri Acaryya krtatika, tadupari Megharajajiksta Valabodha. Kalakatta : Sri Yasodananda Sarkara ke Chapekhana, 1879.296 p. ; 26 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 13). [BORI Cat. 17:1, 174-75; Schubring 1944, 16; Univ. of Chicago Library catalogue *Atha-Sthananga-namnas ttiyangayopangam Jivabhigama-nama sutram / Sri MalayagiriSuri-ksta-vrtti-sahitam Gurjara-bhasa-yuktam ca prarabhyate. Ahmedabad : Times Press, 1883. 2 v. ; 13 x 32 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 14). (CLIO 2, 1168; Univ. of Chicago Library catalogue] *Pannavana-sutra : caturthopanga (Gujarati anuvada sameta) prarambha/Lonka-gacchiya Sri Ramacandra Gani krta Samskstanuvada yuta ; Nanakacandaji se samsodhita hoke mudrita hua ; Kalikacarya sankalita sutra, tadupari Malayagiri Suri krta Samskrta tika aura Paramanandarsi krta bhasa tika yuta. Benares: s.n., 1884. 3 v. ; 16 x 30 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 15). (CLIO 3, 1932; Univ. of Chicago Library catalogue]
Page #24
--------------------------------------------------------------------------
________________ Complete editions *Sri Jamvudvipa prajnapti sutra prarambhah/Ganadhara Sudharma Svami sankalita sutra, tadupari Sri Santicandra gani krta Samskrta tika, Sri Ramacandra Gani krta Samskrtanuvada yuta ; Rsi Amolakhacand se samsodhita. Banaras : Jaina Prabhakar Press, Amolakhcand Jati, 1890.698 p. ; 16 x 31 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 16). [Univ. of Chicago Library catalogue] [SuraP and CandaP. apparently never published (see Jain, Banarsi Das Ardha Magadhi reader. Lahore, 1923, liv)] 17-18 19-23 Nirayavaliya sutra prarambhah : bhaga 19 Kappiya, 20 Kappa vidamsiyaa 21 Pupphiya, 22 Pupphacala, 23 Banhidasa/Sri Ganadhara Sudharma Svami sankalita sutra, tadupari Candra Suri krta Samskrta tika; Sadaranga keta bhasa tika yuta, Pandita Visvanatha ji se samsodhita. 1. daphe. Banarasa : Jaina Prabhakara Presa, samvat 1941. San 1885 Isavi. 85 [ie. 1701 p.; 13 x 31 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 19-23). 24-33 *Atha Dasapa yanna mula sutra prarambhah / Ganadhara Sudharma Svami sankalitamula sutra ; Tandulavayali 24, Devinddastava 25, Ganivijja 26, Causarana 27, Santhara 28, Aurapaccarakana 29, Bhattaparijnana 30, Candra vijja 31, Mahapaccarakana 32, Maranavibhatti 33 : Pratapaji karake samsondhita (sic). Banarasa : Jaina Prabhakara Presa, Samvat 1942. [Isavi] 1886.73 [i.e. 146] p. ; 13 x 32 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 24-33). [Univ. of Chicago Library catalogue] *Kalpasutrah: trtiya chedasutrantargata dasasrutaskandhasya astamadhyayanam/Srimadbhadrabahusvami viracitam. Kalikata : Sriraya Dhanapatisimha Bahadura, 1894. 148 p.; 10 x 30 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 36). [Univ. of Chicago Library catalogue *Uttaradhyayana : sampurnatam agamat / Bhagavanavijayasadhuna samsodhitam. Calcutta ; [Government Press?], samvat 1936 (1879). [1], 1109 p. ; 13 x 31 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 41). (CLIO 2, 2827; Emeneau $3959; JRK 42; Univ. of Chicago Library catalogue] *Dasavaikalika-sutra / Sri Sayyambhavodgararupam ; Gurjarabhasasahitamavacurisamvalitam, Samayasundaropadhyayakrta Dipikasanatham, Sriharibhadrasuri krta Brhadvrtti virajitam. Mumbapuri : Nirnayasagara, samvat 1957 [1900].722 p. ; 27 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 43). (Univ. of Chicago Library catalogue] *Anuyogadvarasutra / Ganadhara Sudharma Svami ksta mulasutra tadupari Sri Hemacandra Suri krta tika: tadupari bhasatikasameta: Srimohanamunina samsodhitam. Kalikata : Nutana SamskTtayantra, 1935 (1878). [1], 660 p. ; 13 x 31 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 44). CLIO 1, 134; Univ. of Chicago Library catalogue *Nandi-sutra/Ganadhara-Sudharmmasvami-krta-mula-sutra tadupari Sri-Malayagiri-krta-tika, tadupari bhasa Valavodhasameta ; Sribhagavan Vijayasadhuna samsodhitam. Kalikata : Nutanasamsksta Yantra, samvat 1935 (1878). p. [1], 520 p. ; 13 x 30 cm (RayaDhanapatisimha-Bahadura-ka Agama-samgraha ; v. 15). [CLIO 2, 1715) Agamodaya Samiti and Sresthidevacandra-Lalabhar-Jainapustakoddhara Phanda (DLJP)/ Sagarananda Suri.? The Agama texts that issued from these two publishers (1911-49) make up one of the more accurate editions of the canon printed. The editor for almost all of them was Sagarananda Suri (1874-1949) formerly Anandasagara, also called Agamoddharaka-although this is usually not stated explicitly in 2 There is a year-by-year listing of some publications in the Alpaparicitasaiddhantikasabdakosah (1954-79:1, 4 n.5 (Sampadakiya vaktavya)).
Page #25
--------------------------------------------------------------------------
________________ the publications. From the information given in the Alpaparicitasaiddhantikasabdakosah(1954-79: 3. plate facing p. 9,5, 16-17, 22-26) Sagarananda was responsible for at least 87 titles published by the Agamodaya Samiti and the DLJP fund. The indexes listed here after the series (1923, 1928, 1937, 1948) cover publications by both publishers, however seven curnis edited by Sagarananda are also indexed in the Alpaparicita ... but are not listed. 1911 *Sriyasodevapranitavivaranasametam Sripaksikasutram. [ / edited by Anandasagara). Bombay: Nirnayasagara Press, 1911.5[ie 10), 78 (ie. 156] p. ; (Sresthi-Devacandra-LalabhaiJaina-Pustakoddhara ; 4) [Emeneau 3967; CLIO 3:1836; DLJP list] *Upadhyayasrimadvinayavijayaganiviracita Kalpasutravrttih Subodhikabhidhana [/edited by Anandasagar). Suryapura : Gopipura Jaina Printing Works, 1911. 2, [2], 600 p. ; 1 plate ; 13 x 28 cm. (Sresthi-Devacandra-Lalabhai-Jaina-pustakoddhara ; no. 7). [Emeneau $3943. CLIO 2, 1232; DLJP series list) 1914 *Dasa-sruta-skandhe Paryusana-kalpakhyam Bhadrabahu-Svami-viracitam Kalpa-sutram, Yuga-pradhana-Kalikacarya-katha-samyuktam [/ edited by Anandsagara). Bombay: Nirnaya-sagara Press, 1914. 2, 1, 68, [1], 5, [1], p. ; 1 plate ; 12 x 26 cm. (Sresthi-DevacandraLalabhai-Jaina-pustakoddhara ; no. 18). [CLIO 2, 1231; DLJP list 2nd ed. 1933. 1915 *[Lalitavistara (cty on Caityavandanasutra) with Municandra's Panjika / edited by Anandasagara, 1915. (Sresthi-Devacandra-Lalabhai-Jaina-Pustakoddhara series ; 29). [BORI Cat 17:3, 225; DLJP series listing! 1915-16 *[Hemacandracurya-viracita-vitti-yuktam ... Anuyogadvara-sutram/edited by Anandasagara] Bombay : Nirnaya-sagara Press, 1915-16.2 v.; 12 x 26 cm. (Sresthi-Devacandra-LalabhaiJaina-pustakoddhara ; no.s 31, 37). [CLIO 1, 134; DLJP series listing) 1916 Srimadganadharavarasudharmasvamipranitam Srutakevalibhadrabahusvamidrbdhaniryuktiyuktam, srimacchilankacaryavihitavivrtiyutam (part 2 Vivaranayutam Sriacarangasutram. Mahesana : Agamodayasamitih, Virasamvat 2442. Vikramasamvat 1972-73. Kraista 1916. 2 v. ; 12 x 26 cm. [CLIO 1,21] Sricaturdasapurvadharasrutasthavirapranitam CandrakulinasrimadabhayadevasurivihitaSrimaddronacaryasodhita vrttiyutam Srimadaupapatikasutram. Mehesana : Agamodayasamiti, Vira samvat 2442. Vikramasamvat 1972. Kraista 1916. 2, 119, [1] [ie 4, 238, 2] p. ; 12 x 26 cm. *Sriman-Malayagiry-Acarya-vihita-vivarana-yutam Srimad-Devavacaka-Gani-drbdham Sriman-Nandi-sutram ... Bombay: Nirnaya-sagara Press, Vikramasamvat 1973 [1916)]. 2. 254, [1] [ie. 4, 508, 2) p. ; 12 x 27 cm. [CLIO 2, 1715; Nandi.1968, 79 (fourth group) The Agamodaya Samiti series, no. 16 (BORI Cat. 17:2, 294). Reprinted. 1924. 1916-17 Srimad Bhadrabahu-Svami-sukta-niryuktikani ... Sri-Santi-surivarya-vivrtani Srimanty Uttaradhyayanan / edited by Anandasagara). Bambai : Devacanda Lalabhai Jaina Pustakoddhara Samstha, 1916-17. 3 v. ; 12 x 27 cm. (Sresthi Devacanda Lalabhai Jaina Pustakoddhara Fund series; no. 33, 36, 41). [CLIO 2, 2827; Alsdorf 1966. Foreword; DLJP series list) 3 This dictionary (full details p. 34) seems to have been prepared by Muni Kancanavijaya on the basis of material gathered by Sagarananda. Forty-four source works are given in the list of abbreviations in volumes 3 (p. 6-8) and 5 (p. 16-17). Thirty-six were his editions (including the Upadesamala and the Tattvarthasutra) the remainder being indexed either from manuscripts (five) or other editions (three). More works are indexed in these volumes than are listed in the 'Sannapatrakam.' Another work edited by him was *Hemacandra's Abhidhanacintamani: with Sesas and Siloncha as well as Hemacandra's Linganusasana and Nighantusesa, Sudhakalasa's Ekaksaranamamala and Purusottamadeva's Dvirupakosa, here styled Sabdabhedaprakasa / edited by Sagarananda Suri]. Surat, 1946. (DLJP 92). [Vogel 1979, 336 n. 135]
Page #26
--------------------------------------------------------------------------
________________ 1916-17 Srimadacaryabhadrabahutataniryuktiyutam : Purvadharacaryavihitabhasyabhusitam Srimadbhavavirahaharibhadrasurisutritavrttyalankrtam Srimadavasyakasutram. Mehesana : Agamodaysamiti [sic], Virasamvat 2442-43. Vikramasamvat 1972-73. Kraistasya 191617. 4 v.; 12 x 27 cm. ; [Agamodaya-samiti-siddhanta-sangraha; no. 1, 2, 3, 4]. 1917 1918 Complete editions Srimacchilankacaryavihitavivaranayutam Srimatsudharmasvamiganabhrddrbdham Srimatsutrakrtangam. Mehesana : Agamodayasamiti, Virasamvat 2443. Vikramasamvat 1973. Kraistasya san 1917. 427 [ie. 854] p.; 12 x 27 cm. (Agamodaya Samiti series; no. 18). [CLIO 4, 2666; Tripathi 1975, 91] Reprint 1950-53; 1978. 1919 Srimatsudharmasvamiganabhrdviracitam Candrakulinanavangivrttikarakasrimadabhayadevasuriviracitatikopetam Srisamavayangasutram. Mehesana : Sriagamodayasamitih, Virasamvat 2444. Vikramasamvat 1974. Kraista san 1918. 2, 160 [ie 4, 320] p. ;12 x 26 cm. [CLIO 4, 2267] Reprint with list of corrections 1985. Srimacchayyambhavasurisvarasutritam Srimaddharibhadrasurivarasisyabodhinisamjnakam Vivaranayutam Sridasavaikalikasutram. [ / edited by Anandasagara]. Bombay : Sheth Devchand Lalbhai Jain Pustakoddhar Fund, Virasamvat 2444. Vikramasamvat 1974. Kraista 1918. [ii] [ie. 4], 286 [ie. 572] p; 12 x 22 cm. (Sresthi Devacandra Jainapustakoddhara; no. 47). [CLIO 1, 702; DLJP series list] Srimadbhadrabahusvamipranita-sabhasya-srimanmalayagiryacaryavivrta Sripindaniryuktih/ [edited by Anandasagara] Suratasiti: Devacandra Lalabhai Jainapustakoddharaphanda, Bhagavadvirasya 2444. Vikramanrpasya 1974. Isukhriste 1918. 2, 179, [1] p. ; 1 leaf of plates; 12 x 27 cm. (Sresthi Devacandra Lalabhai-Jainapustakoddhara; no. 44). [CLIO 3: 1916; DLJP series list] 1918-19 Srimacchyamacaryadrbdham Srimanmalayagiryacaryavihitavivaranayutam Sriprajnapanopangam. Mehesana : Agamodayasamiti, Virasamvat 2444-45. Vikramasamvat 1974-75. Kraista 1918-19. 2 v. ; 12 x 26 cm. [CLIO 3, 1932] 1918-20 Srimatsudharmasvamiganabhrtprarupitam Srimaccandragacchalankarasrimadabhayadeva surisutritavivaranayutam Srimatsthanangasutram. Mehesana Sriagamodayasamitih, Virasamvat 2445-. Vikramasamvat 1975-. Kraista 1918-20. 2 v; 12 x 27 cm. (Agamodaya series; no. 21, 22). [CLIO 4, 2604; BORI Cat. 17:1, 55] Reprint with list of corrections 1985. 1918-21 Srimadbhagavatisutram / Srimatsudharmasvamiganibhrtprarupitam Srimadgautamaganadharivacananugatam; Srimaccandrakulalankarasrimadabhayadevasurisutritavivaranayutam. Mehesana : Agamodayasamiti, Virasamvat 2444-47. Vikramasamvat 1974-77. Kraista 1918-21. 2 v. in 3; 12 x 27 cm. [CLIO 1, 380] Srimat Jnatadharmakathangam : Candrakulalankarasrimadabhayadevasurisutritavivaranayutam. Mehesana : Agamodayasamiti, Virasamvat 2449. Vikrama sam. 1975. Kraista 1919. 253 [ie. 506] p.; 12 x 27 cm. [CLIO 2, 1190] *Sriprasnavyakaranangam: Srimatsudharmasvamiganabhrtprarupitam Srimaccandrakulalankarasrimadabhayadevasurisutritavivaranayutam. Bombay: Agamodayasamiti, Virasamvat 2445. Vikramasamvat 1975. Kraista 1919. 165 p.; 12 x 27 cm. [CLIO 3, 1957] Sristhanangakhyattyangasambaddham Caturdasapurvadharaviracitam Srimanmalayagiryacaryasutritavivaranayutam Srimajjivajivabhigamopangam [ / edited by Anandasagara]. Prathamasamskare. Bombay: Sheth Devchand Lalabhai Jain Pustakoddhar Fund, Virasamvat 2445. Vikramanrpasya 1975. Kraista 1919. f. [2], 466, [1]; 12 x 27 cm. (Sresthi-DevacandraLalabhai-Jaina-pustakoddhara; granthankah 50). [CLIO 2, 1168; DLJP list] Bombay: Agamodaya Samiti, 1919 (Schubring 1935 SS47). 7
Page #27
--------------------------------------------------------------------------
________________ 1920 1922 1923 1924 1925 Srimanmalayagiryacaryavihitavivaranayutam Srisuryaprajitaptyupangam. 4, [1], 297 [ic. 8, [2], 594] p.; 12 x 26 cm. Mehesana : Agamodayasamiti, Virasamvat 2445. Vikramasamvat 1975. Kraista 1919. [Agamodaya Samiti series, no. 24]. Srutakevalisrimadbhadrabahusvamiviracitaniryuktisrimatpurvacaryaviracitabhasyayuta: 1927 Navangivrttisodhakanirvrttikulabhusanasrimaddronacaryasutritavrttibhusita Srimati-Oghaniryuktih. Mehesana : Agamodayasamiti, Virasamvat 2445. Vikramasamvat 1975. Kraista 1919. 227 [ie. 454] p.; 12 x 27 cm. Edited by Sah Venicandra Surcandra. Srimaccandrakalina [sic] Srimadab[h]ayadevacarya vihitavivaranayutam Srimadupasaka dasangam. Mahesana: Agamodayasamiti, Virasamvat 2446. Vikramasamvat 1976. Kraistasan 1920. 54 [ie.108] p.; 12 x 27 cm. [CLIO 4, 2818] *Srimad-Antakrd-dasanuttaropapatika-dasa-Vipaka-srutani : ... Abhayadevacarya-vihitavivarana-yutani. Mahesana : The Agamodaya Samiti, 1920. foll. [1], 96 [ie. 2, 192] p.; 12 x 27 cm. (Agamodaya Samiti granthamala ; 23). [CLIO 1, 129; Tripathi 1975, 72]. Prameyaratnamanjusanamnya vrttya yutam Srimajjambudvipaprajnaptinamakopangam/ Srisanticandraganiviracitaya [ / edited by Anandasagara]. Bombay : Nirnayasagara Press, Srivirasamvat 2446. Vikramasamvat 1976. Kraistasan 1920. 2 v. ; 12 x 27 cm. (Sresthi Devacandra Lalabhai Jainapustakoddhara; granthankah 52, 54). [CLIO 2, 1138; Emeneau $3933; Roth 1983, 222; DLJP list] Srinir[a]yavalikasutram/ Sricandrasuriviracitavrttiyutam; Danavijayaganibhih samsodhitam. Amadavada(rajanagara)madhye [Ahmedabad]: "Prakasayitri Sriagamodayasamitih, Virasamvat 2448. Vikramasamvat 1979. San 1922. 42 [ic. 84] p.; 12 x 26 cm. (Srivirasamajagrantharatnam; 2). Pratnapurvadharanirmitam Sritandulavaicarikam Srimadvijayavimalaganidrbdhavrttiyutam, savacurikam ca Catuhsaranam. Bombay: Sheth Devchand Lalbhai Jain Pustakoddhar Fund, Virasamvat 2448. Vikramasamvat 1978. Kraista 1922. 78 [ic. 156] p. ; 12 x 27 cm. (SresthiDevacandra-Lalabhai-Jaina pustakoddhare granthanka; ;59). Srimadanandavimalacaryantikachrimadvanararsivihitavrttiyutam Srimad Gacchacaraprakimakam. Mehesana : Agamodaya Samiti, Virasamvat 2450. Vikrama samvat 1980. Kraista san 1923. 42 p.; 12 x 27 cm. [Agamodaya-Samiti series; no. 36, 46]. Srianuyogadvarani : Srimanmaladharagacchiyahemacandrasurinirmitavrttiyutani. Bombay : Agamodayasamiti, Vikramasamvat 1980. Kraistasan [1923]. f. [1], 271, [2]; 12 x 27 cm. *Visesavasyakasatkah pathyagathah Sripradyumnasariviracitam Vicarasaraprakaranam ca Manikyasagaraviracitacchayayuktam. Ahmedabad: Agamodaya Samiti, 1923. 8, 180 p. [Emeneau 3971] 1924-27 Sriman purvadhara Acaryavarya Jinabhadraganiksamasramanakrta Srimalladhari Acaryasri Hemacandracaryakrta vrtti sahita Srivisesavasyaka bhasantara. Bombay : Agamodaya Samiti, San 1924-27. Vira samvat 2450-53. Vikrama samvat 1980-83. 2 v. ; 27 cm. Srimanmalayagiryacaryapranitavrttiyutam Srimaddayyaganisisyacaryavaryasrimaddevavacakaksamasramananirmitam Srimannandisutram. Bombay: Agamoday-Samiti, Virasamvat 2450. Vikramasamvat 1980. San 1924. 254 [ie. 508] p.; 12 x 27 cm. Reprint of 1916 edition. Srimatrajaprasniyasutram: Srimanmalayagiripranitavttiyuktam. Bombay: Agamoday Samiti, Vira samvat 2451. Vikrama samvat 1981. Kraista 1925. 149 [ic. 298] p. 13 x 27 cm. [Agamodaya Samiti series; no. 42]. [CLIO 3, 2056; JRK 330] Srutasthavirasutritam Catuhsaranadimaranasamadhyantam Prakimnakadasakam chayayutam. Bomday [sic]: Shree Agamoday Samiti, Vira sam. 2453. Vikrama sam. 1983. San 1927. [Agamodaya Samiti; 46]. 8
Page #28
--------------------------------------------------------------------------
________________ 1928-36 Srimanmalayagiryacaryakrtavivaranayutam, Srutakevalisrimadbhadrabahusvamisutritaniryuktiyuta-Sriavasyakasutram. Bombay: Sriagamodayasamiteh, Virasamvat 2454-62. Vikramasamvat 1984-92. [1928-36]. 3 v.; 12 x 28 cm. (Sriagamodayasamitigranthoddhare, granthanka 56, 60. Sresthi Devacandra Lalabhai Jainapustakoddhare; granthankah 85). Sridasasrutaskandhantargatam Sriparyusanakalpakhyam Sribhadrabahusvamiviracitam Srikalpasutram: anekasundarataravividhavarnakacitrakalitam: yugapradanakalika"caryakathadvayasamyuktam/samsodhakah Srivijayameghasurivipadah. Rajanagare: Sriagamodayasamiti, Virasamvat 2459. Vikramasamvat 1989. Kraistasya san 1933.91 [ie 182] p.; 15 x 29 cm. (Sresthi-Devacandra-Lalabhai-Jainapustakoddhare; granthankah 82). *Sadhusadhvidaivasikaratrikapaksikacaturmasikasamvatsarika pratikramanani prakirnakavidhisamyutani Sadavasyakasutrani. Ratlam : Sresthi Rsabhadevaji Kesarimalaji Samstha, samvat 1992 [1935]. [BORI Cat 17:3, 134n] 1933 1935 1936 Complete editions 1936-37 Sri-Jinabhadraganiksamaramanadrbdham Srikotyacaryakrtapracinatamavivarana vytam Srivisesavasyakasutram [| Anandasagara Suri]. Ratalama : Srirsabhadevajikesarimalajinamakasvetambarasamstha, Virasamvat 2463. Vikramasamvat 1993. Kraista san 1936-37. 2 v.; 13 x 27 cm. 1958 *[Laghu vrtti on Viyahapannatti without mula]. Ratalama : Rsabhadevaji Kesarimalaji Jaina Svetambara Samstha, 1935. 298 p.; 12 x 27 cm. 1947-49 Sriprajnapanopangam: Suvihitadhurandharasahityasa udhananyastambhopamaSriharibhadrasurisutrita-Pradesavyakhyasankalitam. [Ratlam]: Malavadesantargatasriratnapuriyasrirsabhadevakesarimalaji ityabhidhana Svetambara Samstha, Virasamvat 2473-76 [1947-49]. 2 v.; 13 x 27 cm. 1978 Yugapradhanasrutake valibhagavacchribhadrabahusvamisutritam Srisantisagarakalpitakalpakaumudyakhyavivaranasamvalitam Srikalpasutram. Prathamasamskarane. Ratnapuriya [Ratlam]: Srirsabhadevaji Kesarimalaji namni Svetambarasamstha, Vira samvat 2462; Vikrama samvat 1992; Kraista san 1936. 4, 240 p. ; 12 x 27 cm. 1950-53 Srimatsutrakrtangam : Srisudharmasvamisandrbdham ; Sribhadrabahusvaminirmitaniryuktiyutam, tadvrttikarasrimacchilankacaryavihitavivaranasusobhitam, vividhapratyantaratippanadyalankrtam ca / samsodhakah sampadakasca Srimadacaryacandrasagarasurivarah. Mumbai: Srigodiparsvanathajainaderasarapedhi, Virasamvat [2476?]-2479 [1950-53]. 2 v.; 13 x 28 cm. (Srigodiparsvajainagranthamala; saptmampuspam). Reprint of 1917 edition. 1985 Sripindaniryuktib: Srimadbhadrabahusvamipranita sabhasya Srijayakirtisurisisyasriksamaratnasutrita'vacuryupeta: Sriviraganiracitayah Sisyahitayah Srimanekasekharasurikrtaya Dipikaya adyantabhagau ca/sampadakah Muni Kancanavijayah. 1. samskaranam. Surata: Sresthidevacandralalabhaijainapustakoddharakosasya, Virasam. 2454. Vikramah 2014. Sake 1880. Khristabdah 1958. 19, 177 [ie. 38, 354] p.; 1 plate; 13 x 28 cm. (Sresthidevacandra-Lalabhai-Jainapustakoddharake granthankah 105.) *Acarangasutram Sutrakrtangasutram ca / Srimatsudharmasvamiviracitam ; Bhadrabahusvamiviracitaniryukti-Srisilankacaryaviracitatikasamanvitam; sampadakah samsodhakasca Acaryamaharajasrisagaranandasurisvarah, Munirajasripunyavijayajimaharajasang hitapracinasamagryanusarega suddhi-vrddhipatrakadivividhaparisistadibhih pariskarta Munib Jambuvijayah, sahayake Munih Dharmacandravijayah. Dilli Motilala Banarasidasa Indolajika Trasta, 1978. 288, 400 [72] p. ; [1] leaf of plates; port. ; 29 cm. (Lala Sundaralala Jaina Agamagranthamala; bhaga 1). Re-edition of Ayar.1916, Suy.1917. Sthanangasutram Samavayangasutram ca: dvadasangyam trtiyam caturtham ca / Pancamaganadhara-Bhagavatsudharmasvamiviracitam; Acaryapravarasriabhayadevasuriviracitavrttisamalankrtam; sampadakah samsodhakasca Acaryamaharajasrisagaranandasurisvarah; Munirajasripunyavijayajimaharajasangrhitapracinasamagryadyanusaram 9
Page #29
--------------------------------------------------------------------------
________________ vihitena suddhipatrakena tatha aparair api nanavidhaih parisistadibhih pariskarta ; Munih Jambuvijayah. 1. samskarana. Dilli : Motilala Banarasidasa Indolajikala Trasta, 1985. 38, 411, 5, 150 p. ; 29 cm. (Lala Sundaralala Jaina Agamagranthamala : bhaga 2). Reprintings of editions of 1918 and 1918-20, with lists of corrections. According to Muni Kancanavijaya (Alpaparicita ...) Sagarananda also edited the following Curnis: 1928 *Jinadasa-Gani-viracita Srianuyogadvara-curni tatha Haribhadra-Acarya-viracita Anuyoga dvara-sutra-vitti. Ratalama : Srilsabhadevaji Kesarimalaji Svetambarasamstha, Vira samvat 2454. Vikrama samvat 1984. Kraista 1928. 90, 128 p. ; 12 x 27 cm. * [Nandi Curni with Haribhadra's Vttti / edited by Sagarananda Suri] Ratalama : Rsabhadevaji Kesarimalaji Svetambara Samstha, Vikrama samvat 1984 (1928). 1928-29 * Srimad Ganadh *Srimad Ganadhara-Gautama-Svami-sandrbdham ... Srimad-Bhadrabahu-Svami-sutritaNiryukti-yutam Srimaj-Jinadasa-Gani-Mahattara-krtaya Curnya sametam Srimad Avasyaka-sutram. Indore : Jaina-bandhu Press, 1928-29.2 v. ; 12 x 27 cm. 1933 Prasiddhya Srijinadasaganimahattararacita Sridasavaikalikacurni": Srutakevalibhagavac chayyambhavasurisutritasutrya Srutakevalisrimadbhadrabahusvamisandrbdhaniryuktika. Ratalama : Sri Rsabhadevaji Kesarimalaji Svetambarasamstha, Vira samvat 2459. Vikrama sam. 1989. Kraista 1933. 1, [ie. 2), 380 p. ; 12 x 27 cm. 1941 Srimanti Uttaradhyayanani : Jinadasaganimahattara krtaya Curnya sametani. Ratnapura [Ratlam) : Srirsabhadevaji Kesarimalajityabhidha Srisvetambarasamstha, Vira samvat 2459. Vikrama samvat 1989. Kraista san 1933. 284 p. ; 12 x 26 cm. Sriacarangacurnih / bahusrutakimvadantya Srijinadasaganivaryavihita. Malavadesantargataratnapuriya (Ratalamagata) : Srirsabhadevajikesarimalaji Svetambarasamstha, Vikramasya samvat 1998. Srivirasya 2468. Kraistasya 1941.382 p. ; 12 x 26 cm. * SrT-Sutrakrtangacurni with Nijjutti and Jinadasa's Cunni/ edited by Mohanlal M. Badami. Ratlam : Sri Rsabhadevaji Kesarimalaji Svetambara Samstha, 1941. 466 p. ; 12 x 27 cm. Attributed to Anandasagara in Alpaparicitasaiddhantikasabdakosah, v. 3 plate facing page Indexes to this series: 1923 Agamodayasamitau parisiste prathame vibhago dvitiyah Visesavasyakagathanamakaradih kramah : tatha dvitiye parisiste dvitiyo vibhagah Visesavasyakavisayanamanukramah. Amadavada : Agamodayasamitih, Virasamvat 2479. Vikramasamvat 1979 ; Kraistasan 1923. [2], [63] [ie. 126) p. ; 12 x 27 cm. 1928 Nandyadigathadyakaradiyuto visayanukramah : Srinandi-Anuyogadvara-AvasyakaOghaniryukti-Dasavaikalika-Pindaniryukti-Uttaradhyayananam sutrasutragathaniryuktimulabhasyabhasyanam akaradikramah ankasuddhih laghubrhams ca visa yanukramah = An Alphabetical index of the aphorisms etc. occurring in Nandisutra, Anuyogadvara, Avasyaka, Oghanir/yfukti, Dasavaikalika, Pindaniryukti and Uttaradhyayanasutra : along with detailed lists of subjects treated in these seven Agamas. Mumbayyam: Sri Agamodayasamiteh karyavahakah Jivanacandra Sakaracandra Jhaveri, Virasamvat 2454 [1928). f. 183 [ie. 366 p.) ; 12 x 26 cm. (Sri- gamodayasamiti Granthoddhara ; granthakah 55). 1937 Sriacarangadyekadasangyah Angakaradi : 1 Sutradyakaradi 2 Sutradyankasuca 3 Laghubrhadvisayanukramau. Ratnapuriya (Ratalama) : Srigsabhadevajikesarimalaji Svetambarasamstha, Virasamvat 2463. Vikramasamvat 1993. Kraistasan 1937. [141], 48, 161 p. ; 12 x 27 cm.. 1948 Sriagamiyasuktavalyadi: Agamiyasuktavali 1, subhasita 2, sangrahasloka 3, lokoktayah 4. Suryapuriya (Surat) : Srijainapustakapracarakasamstha, Vikramasamvat 2005 (1948). 74 p. ; 12 x 27 cm. (Sriagamoddharasangrahe bhagah 8). 10
Page #30
--------------------------------------------------------------------------
________________ Complete editions Upangaprakirnakasutravisayakramah: Sriaupapatika-Rajaprasniya-JivajivabhigamaPrajnapana-Candrasurya prajnaptiyugma-Jambudvipaprajnapti-UpangapancakamayaNirayavalika-Catuhsaranadiprakirnakadasakanam sutrasutragathanam akaradikramah laghur brhams ca visa yanukramah. Suryapure (Surat] : Srijainapustakapracarakasamstha, Vikramasamvat 2005. Virasamvat 2475. I. sa. 1948. 72, 108 p. ; 25 x 12 cm. (Sriagamoddharasangraha ; 2) <1977 or 1978-> Sriagamoddhrta vividhavisayasamuccayah / Anandasagarasurisvaraih visista ttamasailya sankalita ; punarsankalanamargadestarah ... Srimanikyasagarasuri-varenyah ; punarsankalana-sampadakasamsodha[ka]sca-Punyoda yasagarah. Lunavada, Ji. Pancamahala, Gujarata : Srianandamanikyaprakasana, Vira Ni. sam. <2504 > [1978]. Vi. sam. 2034 >[1977]. Agamo. sam. <28->. Manikya. sam. <3- >.; <1977 or 1978- >; 24 cm. Bhaga 1 Niksepavisaya-chandovisayascah ["Dvipancad-visaya" ityaparabhidhaya prasiddhah). 16, 58 p. Contents: Teosrinum teosrine ja sadara / Punyodaya 3.-Kamika prakasakanu pana 4.-Kincad maru pana 5.-Agamoddharaka eka avalokana / Punyodaya Sagara, Amadavada, 10 Feb. 1978 (6)-16.- Niksepa 1]-39.Chandonusasanam [14] Chandah [2] [40]-45.--Suddhipatraka [46].--Niksepavisayaradika suci [47]-58. **Pratayah 500." ANU NBC 2 118 354 1915 Amolaka Rsi, text of 32 Agamas with Hindi translation, 1915-195 *Acaranga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1915. 638 p. ; 13 x 23 cm. Reprint. Ayar. 1960. *Suyagadanga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1915. 587 p. ; 13 x 23 cm. Reprint Suy. 1963. 1916 * Thananga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1916. 900 p. ; 13 x 23 cm. *Samava yanga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1916. 332 p. ; 13 x 23 cm. 1917 *Vivahaprajnapti (Bhagavati) sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1917. 3090 p. ; 13 x 23 cm. *Upasakadasanga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina) : Jaina Sastroddhara Mudralaya, 1917. 156 p. ; 13 x 23 cm. * Vipaka sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1917. 204 p. ; 13 x 23 cm. *Uvavai sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1917.216 p. ; 13 x 23 cm. 1918 *Inata dharmakathanga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918. 792 p. ; 13 x 23 cm. 5 Because I have yet to examine these publications in detail, the information here is provisional. The quality of the texts and translations has been characterized as poor by Schubring (Schubring Ayar. 1966, 5). They seem also to have been rereleased in Haidarabada, Vira samvat 2446 [1920) under the general title Jain sutra battisi, by Raja Bahadur Lala Sukhdevsahay Jvalaprasad Jaumhri (Schubring 1935, p. 4-5, n.4; JSBI 2, 325n.la).
Page #31
--------------------------------------------------------------------------
________________ * Prasnavyakarana sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918. 228 p. ; 13 x 23 cm. *Rajaprasniya sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918. 304 p. ; 13 x 23 cm. *Jivabhigama sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918.768 p. ; 13 x 23 cm. Suryaprajnapti sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918. 400 p. ; 13 x 23 cm. Niriyavalikadi panca sutra / Amolaka Rsiji Maharaja kyta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918. 180 p. ; 13 x 23 cm. *Brhadkalpa sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918. 96 p. ; 13 x 23 cm. *Vyavahara sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918. 180 p. ; 13 x 23 cm. 1919 *Antagadadasanga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sa hita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919. 139 p. ; 13 x 23 cm. * Anuttarovavai dasanga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919.40 p. ; 13 x 23 cm. *Pannavanna sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919. 1358 p. ; 13 x 23 cm. *Jambudvipa prajnapti sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919. 624 p. ; 13 x 22 cm. *Nandi sutra / Amolaka Rsiji Maharaja Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919.211 p.; 13 x 23 cm. *Anuyogadvara sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina) : Jaina Sastroddhara Mudralaya, 1919. 379 p. ; 13 x 23 cm. *Uttaradhyayana sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919.651 p. ; 13 x 23 cm. *Dasavaikalika sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919. 144 p. ; 13 x 23 cm. *Avasyaka sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksima) : Jaina Sastroddhara Mudralaya, 1919. 47 p. ; 13 x 23 cm. [JSBI 2, 173 item u] *Dasasrutaskandha sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919. 148 p. ; 13 x 23 cm. [LC] *Nisitha sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, Vira samvat 2446 [1919). 246 p. ; 13 x 23 cm. Reprints:6 1960 Sri Acaranga sutra / Sri Amolaka Rshiji dvara anuvadita; sampadakah Sobhacandra Bharilla. 2nd corrected edition. Dhuliya (Pascima Khanadesa): Sri Amola Jnanakata, Vira samvat 6 The introduction to Ayar. 1960 indicates that revised versions of Suy. 1915 and Thana. 1916 had been undertaken in a plan to republish the work of Amolaka Rsi. The fourth edition of a Hindi prose version of Amolaka Rsi's Pradyumnakumaracarita (1980)--first published in samvat 2010 (1953)-- lists on the back cover the following revised texts Ayar., Suy., Antag. (mula only), Av. (mula only). I have not been able to trace further details. 12
Page #32
--------------------------------------------------------------------------
________________ Complete editions 2486 [1960). 4, 4, 300 p. ; 23 cm. (Amolakashiji Smaraka granthamala, puspa sankhya 66). Reprint of Ayar. 1915. 1963 *[Sutrakrtanga Sutra / edited by Muni Sri Kalyanarsiji and Sobhacandra Bharilla.] Dhuliya, 1963. (Amolakarsiji Maharaja Smaraka granthamala ; puspa sankhya 68). [Bollee 197788:1, 3] Reprint of Suy.1915. 3.1 "Agamaratnamanjusa," 1941 or 1942 Sagarananda Suri (see Agamodaya Samiti edition above) prepared the 45 texts of the canon to be inscribed on copper-plates, now preserved in the Agama-Mandira in Surat, and on marble slabs in the Agama-mandira, Palitana. The texts were also printed on large format paper in about 500 copies which where distributed to various Bhandaras and learned monks. The copy originally presented to Punyavijaya is now housed in the L. D. Institute (C. Tripathi, MahaNis. 1994, p. 13). This edition is termed Agamaratnamanjusa in Pannav.1969 (v.2, 44243) where the year of publication is given as 1998 V.S. (1941) (2468 Vira N.S. (1942]). A characteristic feature of this edition is that at various places the text of the sutra has been abridged by placing the sign of zero (O). In doing so the editor, has not followed any old manuscript, method or tradition, it is in fact an abridged version. Some silent "corrections" have also been introduced (Pannav. 1969:2, 461). Ghastlala, 32 Agamas, 1936-73 1936 Sri Upasakadasangasutram : Samskrta-Hindi-Gujarati-tika-sametam / vrttiracayita Ghasilalaji Maharaja. 1. avrtti. Karaci: Sri Svetambara Sthanakavasi Jaina Sangha, Vira samvat 2463. Vikrama samvat 1992. I. sa. 1936. 20, 565 p. ; 25 cm. <1942- > Sridasavaikalikasutram : Samsksta-Hindi-Gurjara-bhasasamalarikstam/vsttiracayita Gha silalaji ; niyojaka Samiramallaji tatha Kanhaiyalalaji. Avrtti 1. Limadi, Pancamahala : Sthanakavasi Jaina Srisangha, Vira samvat <2469->; Vi. samvat <1998->; I. san<1942-> v. <1->; 25 cm. Reprint 1957-60. 1948 Sri Anuttaropapatikasutram : Arthabodhinivrttisamalankrtam: Hindi Gurjara bhasha sahitam/ vsttiracayita Ghasilalaji ; niyojaka Samiramallaji tatha Kanhaiyalalaji. Avrtti 1. Rajakota, Kathiyavada: Sri Sve(tambara). Stha[nakavasi). Jaina Sastroddhara ka Samitih, Vira samvat 2474 [1948). 12, 160 p. ; 24 cm. Reprint 1959. 1950 Sri Nirayavalikasutram: Hindigurjarabhasanuvadasahitam/Ghasilalaji Maharaja-viracitaSundarabodhinitikasamalankrtam ; niyojakau Munisri Samiramallaji Maharajah ; Munisri Kanhaiyalalaji Maharajasca. Rajakota, Saurastra : Sri Svestambara). Stha[nakavasi). Jainasastroddharaksamiti, Vira samvat 2494 [1948). 1 plate of portraits. 20, 455 p. ; 25 cm. Sri Antakrtadasangasutram : Munikumuda Candrika tika samalankatam, Hindigurjara-bhasasahitam / tikaracayita Ghasilalaji, niyojaka Samiramallaji tatha Kanhaiyalalaji. Rajakota, Kathiyavada : Sri Svestambara). Stha nakavasi). Jaina-Sastroddharaka-Samitih, Vira samvat 2477 [1950). [1] leaf of plates ; 25, 267 p. ; 21 cm. Reprint 1958. Sri Avasyakasutram : Ghasilalaji-viracitamunitosinyakhyaya vyakhya samalarkrtam Hindi Gurjara-bhasasahitam/niyojako Muniratna Gabbulalaji; Munisri Samiramallaji; Mun[i]sri Kanhaiyalalaji. Rajakota, Saurastra : Sri Sve. Stha. Jainsastroddhara Samitih, Vira samvat 2478. Vikrama samvat 2007. Isvisana 1951.4, 341 p. ; 3 leaves of plates (portraits); 24 cm. Reprinted 1958. 1951 1952 Sri Vipakasutram : Ghasilalajimaharaja-viracitaya Vipakacandrika-tikaya samalankstam Hindi-Gurjara bhasanuvadasa hitam /Gavvulalajimaharajah ; Munisrisamiramalaji
Page #33
--------------------------------------------------------------------------
________________ Maharajah Kanhailalaji Maharajasca. Prathamavsttih. Rajakota, Saurashtra : Sri Svetambara). Stha[nakavasi). Jainasastroddharasamitih, Vira samvat 2479 [1952). [3] pages of plates, 702, 84 p. ; 24 cm. Reprint 1959. 1952-71 Sri-Acarangasutram / Ghasilalajimaharajaviracitaya''caracintamanivyakhyaya samalan kstam Hindigurjarabhasa'nuvadasahitam. Rajakota, Saurastra : Sri [Akhila Bharatiya Sve[tambara). Stha[nakavasi] Jainasastroddharasamitih. Vira samvat 2478-83 [1952-57). 4 v. ; 25 cm. 1957-60 *[Dasave. text with Hindi and Gujarati translation / by Ghasilalaji.) Rajakota : Jaina Sastroddhara Samiti, 1957-60. [2 v?] 1958 *Antakrtadasangasutram = Antakrita Dashanga sutra / Ghasilalaji-Maharaja-viracitaya Munikumudacandrikakhyaya vyakhyaya samalankrtam Hindigurjarabhasanuvadasahitam. Dvitiyavrttih. Rajakota, Saurastra : Sri Akhila Bharatiya Svetambara Sthanakavasi Jainasastroddhara Samiti, Vira samvat 2484 [1958]. 5, 16, 37, 217, 22 p. ; 21 cm. Reprint of 1950 edition. *INandi sutra with Muni Ghasilalaji's Sanskrit Vyakhya (Jnanacandrika) and his Hindi and Gujarati translations.] Rajkota : Jaina Sastroddhara Samiti, V.S. 2014 (1958). *[Reprint of 1951 Avasyaka edition by Ghasilala). Rajakota : Jainasastroddhara Samiti, 1958. 1959 Anuttaropapatikasutram = Anuttaropapatika sutram / Ghasilalaji-Maharaja-viracitaya Arthabodhinyakhyaya vyakhyaya samalankrtam Hindigurjarabhasanuvadasahitam. Dvitiyavsttih. Rajakota, Saurastra : Sri A[khila). Bharatiya Svetambara Sthanakavasi Jainasastroddhara Samiti, Vira samvat 2485 [1959). 2, 4, 4, 13, 16, 4, 17-35, 148 p. ; 25 cm. Reprint of 1948 edition. Sri-Vipakasutram= Shri Vipaka sutram/Ghasilalaji-Maharaja-viracitaya Vipakacandrikatika samalankrtam Hindigurjarabhasanuvadasahitam. Dvitiyavrttih. Rajakota, Saurastra : Sri Akhila Bharatiya Svetambara Sthanakavasi Jainasastroddhara Samiti, Vira samvat 2485 [1959). 10, 33, 706, 84 p. ; 25 cm. Reprint of 1952 edition. Aupapatika-sutram= Aupapaatika sutra / Ghasilalaji-Maharaja-viracitaya Piyusavarpinyakhyaya vyakhyaya samalankrtam ; Hindigujarabhasanuvadasahitam. Rajakota, (Saurastra): Sri Akhila Bharatiya Svetambara Sthanakavasi Jainasastroddhara Samiti, 2485 [1959). 5, 3, 39, 737, 24 p. ; 24 cm. [BORIJ 1959-61 Uttaradhyayana-sutram = Uttaradhyayana sutram/ [Ghasilala; Kanhaiyalalaji). Rajakota : Sri Akhila). Bha[rata). Sthanakvasi Jaina Sastroddhara Samiti, 1959-61. 1960 Dasasruta skandha sutram = Dashashrutskandhsutram / Ghasilalaji-viracita ya Muniharsini'tikaya samalankrtam Hindigurjarabhasanuvadasahitam ; niyojakah Srikanhaiyalala. 2. avstti. Rajkota, Saurastra : A[khila). Bha[rat). Sve[tambara). Sthanakavasi Jaina Sastroddhara Samiti, Vira samvat 2486. Vikramasamvat 2016. Isvisan 1960.44, 451 p.; 25 cm. *[Bhatkappa with Sanskrit vyakhya and Hindi-Gujarati translation] / Ghasilala. Rajkota : Jaina Sastroddhara Samiti, 1960. 1961 Upasakadasangasutram = Upasakdasangsutram / Ghasilalaji-Maharaja viracitaya Acaramanimanjusakhyaya vyakhyaya samalankstam Hindigurjarabhasanuvadasahitam. Trtiyavrttih. Rajakota, Saurastra : Sri Akhila Bharatiya Svetambara Sthanakavasi Jainasastroddhara Samiti, Vira samvat 2487 [1961]. 6, 2, 40, 532 p. ; 25 cm. Third reprint of 1936 edition. 1961-72 Bhagavati-sutram = Bhagavati sutram/Ghasilalaji-Maharaja-viracitaya Prameyacandrika khyaya vyakhyaya samalankstam Hindi-Gurjara-bhasa'nuvadasahitam. Prathama-avsttih. 14
Page #34
--------------------------------------------------------------------------
________________ Complete editions Rajakota, Saurastra : Sri (Akhila Bharatiya] Sve[tambara). Stha[nakavasi). Jainasastroddharasamitih, Vira samvat 2489-98 [1961-72). 17 v. ; 25 cm. 1962 Prasnavyakarana-sutram = Prashnavyakarana sutram / Ghasilalaji-Maharaja-viracitaya Sudarsinyakhyaya vyakhyaya samalankstam Hindi-Gurjara-bhasa'nuvadasahitam ; niyojakah Srikanhaiyalalaji-Maharajah. 1. avstti. Rajkota : Sri A[khila). Bharata). Sve[tambara). Sthanakavasi Jaina Sastroddhara Samiti, Vira samvat 2488. Vikrama samvat 2018. Isavisan 1962. 8,3, 40,952 p. geneal. table ; 25 cm. <1962- > Sri-Samavayangasutram = Samavayangasutram / Ghasilalaji-Maharaja-viracitaya Bhavabodhinyakhyaya vyakhyaya samalankstam Hindi-Gurjara-bhasa'nuvadasahitam. Prathama-avsttih. Rajakota (Saurastra) : Sri A[khila). Bha[ratiya). Sve[tambara). Stha[nakavasi). Jainasastroddharasamiti, Vira samvat <2488->. <1962- >.v. ; 25 cm. 1963 Sri Jnatadharmakathangasutram = Shree Jnatadharama kathanga sutram / Ghasilalaji Maharaja viracitaya Anagaradharmamstavarsinyakhyaya vyakhyaya samalankstam HindiGurjara-bhasa 'nuvadasahitam. Prathama-avsttih. Rajakota, Saurastra : Sri A[khila). Bharata). Sveftambara). Stha nakavasi). Jainasastroddharasamiti, Vira samvat 2489[1963). 3 v. ; 25 cm. 1964-65 Sri-Sthanargasutram = Sthanang sutram / Ghasilalaji-Maharaja-viracitaya Sudhakhyaya vyakhyaya samalankrtam Hindi-Gurjara-bhasa'nuvadasahitam. Prathama-avrttih. Rajakota (Saurastra): Sri A[khila). Bha[rata). Sve[tambara). Sthanakavasi Jaina Sastroddhara Samiti, Vira samvat 2490-92 [1964-66). 5 v. ; 25 cm. 1965-66 Sri Rajaprasniyasutram = Raajprashniya sutram : Ghasilalaji-Maharaja-viracitaya Prameyacandrikakhyaya vyakhyaya samalankrtam Hindi Gurjara-bhasa'nuvadasahitam/ niyojakah ... Panditamuni-Srikanhaiyalalaji-Maharajah. "Prathamo-avsttih." Rajakota, Saurastra : Akhila). Bharatiya) Sve[tambara Stha[nakavasi] Jainasastroddharasamitipramukhah Sresthi-Sri-Santilala-Mangaladasabhai-Mahodayah. Vira-samvat 2491 92 (1965-66). 2 v. ports. ; 25 cm. 1967-68 Sri Anuyogadvarasutram / Ghasilalaji-Maharaja viracitaya Anagaradharmamsta varsinyakhyaya vyakhyaya samalankstam Hindi-Gurjara-bhasa'nuvadasahitam. Rajakota, (Saurastra) : Sri Akhila). Bhafratiya). Sve(tambara). Stha[nakavasi). Jainasastroddhara Samiti, Vira samvat 2493-(2494?] [1967-68). 2 v. ; 25 cm. 1969 J(ai)nacarya-Jainadharmadivakara-pujya-Sri-Ghasilalavrati-viracita-bhasyasamalankstam (1) Srivyavaharasutram = Shree Vyavhar sutram : evam Curnibhasyavacurisamalankrtam (2) Sribshatkalpasutram = Shree Bruhatkalpa sutram / niyojakah SrikanhaiyalalajiMaharajah. 1. avrtti. Rajakota, Saurastra : Sri A[khila) Bha[rata). Sve[tambara Sthanakavasi Jaina Sastroddhara Samiti, Vira samvat 2495 ; Vikrama-samvat 2025. Isvisan 1969.7, 15, 272, 40, 10, 156, 23 p. ; 3 leaves of plates ; 25 cm. Sri-Nisithasutram = Shree Nishith sutram : Jainacarya-Jainadharmadivakara-Sri-pujyaGhasilala-vrati-viracitaya Curnibhasyavacurirupaya vyakhyaya samalankstam / niyojakah Kanhaiyalala. Rajakota, Saurastra : Akhila). Bha[rata). Sve[tambara. Stha[nakavasi). Jainasastroddharasamiti, Vira samvat 2495. Vikrama samvat 2025. Isvi san 1969. 20, 458, [1], 60 p. ; 3 leaves of plates ; 26 cm. 1969-71 Sri-Sutrakrtangasutram/Ghasilala-vrativiracitaya Samayarthabodhinyakhyaya vyakhyaya samalankstam Hindi-Gurjara-bhasa'nuvadasahitam. Prathama-avsttih. Rajakota, Saurastra : Sri Akhila). Bha[ratiya). Sve(tambara). Sthanakavasi Jaina Sastroddhara Samiti, Vira samvat 2495-<>. Vikrama 2025<>. [1969-71). 4 v. ; 25 cm. (Josi 1987, 48] 1971-73 Sri-Jivabhagamasutram / Ghasilalalaji (sic)-Maharaja viracitaya Prameyadyotikakhyaya vyakhyaya samalankstam; niyojakah Srikanhaiyalalaji. 1. avitti. Rajakota ; A[khila). Bha[rat] Sveltambara). Stha nakavasi). Jainasastroddharasamiti. Vira-samvat 2497-99. Vikramasamvat 2027-29. Isavisan 1971-73.2 v. ; illus; 26 cm.
Page #35
--------------------------------------------------------------------------
________________ 1973 *Sricandraprajnapti- sutram/Ghasilalaji Maharaja-viracitaya Candajnaptiprakasikakhyaya vyakhyaya sammalankrntam (sic) niyojakah Kanhaiyalalaji. 1. avrtti. Rajkot : Sri A. Bha. Sve. Stha. Jainasastorddhara Samiti, 1973. 8, 715 p. ; 25 cm. (CRL catalogue 74-902919) 1974-80 Sri-Prajnapanasutram/Ghasilalaji-Maharaja-viracitaya Prameyabodhinivyakhya vyakhyaya samalankstam Hindi-Gurjara-bhasa 'nuvadasahitam; niyojakah Srikanhaiyalalaji Maharajah. Prathama-avstti. Rajkot : Sri A[khila). Bha[rata). Sve[tambara). Sthanakavasi Jaina Sastroddhara Samiti, Vira-samvat 2500-07. Vikrama samvat 2030-37. Isavisan 1974-80.5 v. ; 25 cm. 1977-80 Sri-Jambudvipaprajnaptisutram / Ghasilalaji-Maharaja-viracitaya prakasikakhyaya vyakhyaya samalankstam Hindi-Gurjara-bhasa'nuvadasahitam ; niyojakah Srikanhaiyalalaji-Maharaja. Ahmadabada : Akhila). Bhajratiya). Svetambara). Stha[nakavasi] Jainasastroddharasamiti, Vira samvat 2503-04. Vikrama samvat 2034. Isavisan 1977-80.3 v. ; 25 cm. Suttagame edition 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie : [sutthuruvena Pupphabhikkhuna sampadio. Padham avstti. Gudagamva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 1953-54.2 v. ; 19 cm. Contents v. 1: Prakasakiya [1]. Suttagame para lokamata [2]-10.-Suyana 11-12.Prastavana /Jinacandabhikkhu(13)-26.-Sanksipta-Ardhamagadhi-vyakarana 27-46.Suttanukkamaniya 47.-Ayare (1)-99.-Suyagadam 101-182.-Thane 183-315.Samavae 316-383.-Bhagavai-Vivahapannatti 384-939.-Nayadhammakahao 9411125.--Uvasagadasao [1127)-1160.-Antagadadasao [1161)-1190.-Anuttarovavaiyadasao [1191)-1198.-Panhavagaranam [1199)-1239.-Vivagasuyam [1241)-1287. Contents v. 2: [Details about publishing committee][41-9.-Prakasakiya 10-16.-Jaina dharme ke dasa niyama 17-18.-Suyana 19-20.-Sadbhasamayam Virastotram 21.Gurustutih (and other short pieces 22-26.-Pattavali 27-29.-Pasangiyam kinci 3031.-Sirisuttagamaganthassa sararuvabhumiya 32-33.-Nidamsanam 34-36. -- Tulanatmaka adhyayana 37-50.--Sampadakiya (51)-66.- Vyakarana-sesa 67-71.Suttanukkamaniya [72].-Ovavaiyasuttam [1]-40.-Rayapasenaiyam [41]-103.-J ivajivabhigame (105)-264.[Donor details 2).-Pannavanasuttam (265)-533.Jambuddivapannatti (535)-672.-Candapannatti (673)-754.-Nirayavaliyao (755)772.- Pupphiyao [773]-788.-Pupphaculiyo [789]-791.-Vanhidasao (792)-796.Vavaharo [7971-829.-Bihakkappasuttam [831)-848.-Nisihasuttam [849]-917.Dasasuyakkhandho (918-946.-Dasaveyaliyasuttam 1947]-976.-Uttarajjhayanasuttam 19771-1060.- Nandisuttam [1061]-1083.-Anuogadarasuttam (1085)-1163.Avassayasutta [1164)-1172.-1. parisittham Kappasuttam [1]-42.-2. parisittham Savayavassae Samaiyasuttam (43)-45.-3. parisittham Savayavassaya(padikkamanasuttam 45-52. Review A. N. Upadhye ABORI 41 (1960) 160-161. ANU BL1310.58 1954 v. 1, v. 2 Mahavira Jain Vidyalaya, 1968 <1999>7 Nandisuttam : Siridevavayagaviraiyam. Anuogaddaraim ca : Siriajjarakkhiyatheraviraiyaim/ sampadakah Punyavijayo Munih ; Dalasukha Malavaniya, Amstalala Mohanalala Bhojaka ity etau ca. Bambai: Sri Mahavira Jaina Vidyalaya, Vira sam. 2494 [1968]. 11, 54, 70, 127,467 p.; 25 cm. (Jaina-Agama-granthamala; granthanka 1). 8 7 Review of the series by Colette Caillat. 1983. The recent critical editions of the Jain Agama, ZDMG Supplement 5, XXI Deutscher Orientalistentag vom 24. bis 29 Marz 1980 in Berlin (Wiesbaden : Franz Steiner, 1983). p. 234-40. 8 Muni Jambuvijaya. 1993. The Jaina Agama series. In Jain studies in honour of Jozef Deleu / edited by Rudy Smet and Kenji Watanabe. Tokyo : Hon-no-Tomosha, 1993. xvi, 504 p. 22 cm. p. 1-12. "This article has been compiled on the basis of the introduction of volume 1 (1968) of the Jaina Agama series." 16
Page #36
--------------------------------------------------------------------------
________________ Complete editions 2 (1) 2 (2) Ayarangasuttam = Acarangasutram / sampadaka Muni Jambuvijayah ; sahayako Muni Dharmacandravijayah. Bambai: Sri Mahavira Jaina Vidyalaya, Vira samvat 2503 [1977). 89, 422 p. 25 cm. (Jaina-agama-granthamala; granthanka 2, (1)). Suyagadangasuttam= Sutrakrtangasutram: Pancamaganaharabhayavamsirisuhammasamiviraiyam biiyam Angam/ sampadakah Muni Jambuvijayah; sahayaka Muni Dharmacandravijayah. Bambai: Sri Mahavira Jaina Vidyalaya, Vira samvat 2504 [1978]. 11, 82, 376 p.; 25 cm. (Jaina-Agama-granthamala , granthanka 2 (2)). Thanangasuttam Samavayamgasuttam ca = Sthanangasutram Samavayangasutram ca : Pancamaganaharabhayavamsirisuhammasamiviraiyam taiyam cauttham ca Angam / sampadakah Muni Jambuvijayah ; sahayakah Muni Dharmacandravijayah. Bambai : Sri Mahavira Jaina Vidyalaya, Vira samsvat) 2511. Vikrama sam 2041. I. sa. 1985. 86,713 p.; 25 cm. (Jaina-Agama-granthamala; granthanka 3). Vivahapannattisuttam: Pancamaganaharaajjasuhammatherabhagavamparamparasankaliavayananugayam 'Bhagavatisuttam' ti pasiddhanamagam pancamam Angam / sampadakah Becaradasa Jivaraja Dosi (sahayakah (v.2) parisistadinirmata (v.3) Amstalala Mohanalala Bhojaka). Bambai: Sri Mahavira Jaina Vidyalaya, Vira samvat 2500-08. Vikrama sam. 2030-38. I. sa. 1974-82. 3 v. ; 25 cm. (Jaina-Agama-granthamala, granthanka 4). Nayadhammakahao = Jnatadharmakathangasutram : pancamaganaharabhaya-vamsirisuhammasamiviraiyam chatham Angam / sampadakah, Muni Jambuvijayah ; sahayakah Muni Dharmacandravijayah. Bambai: Sri Mahavira Jaina Vidyalaya, Vira sam. 2516 [1989). 33, 129, 570 p. ; 25 cm. (Jaina-agama-granthamala; granthanka 5). Sirisamaijavayagaviraiyam Pannavanasuttam/sampadakah Punyavijayo Munih: Dalasukha Malavaniya ; Amrtalala Mohanalala Bhojaka ityetau ca. Bambai : Sri Mahavira Jaina Vidyalaya, Vira sam. 2495-97 [1969-71). 2 v. ; 25 cm. (Jaina Agama series, granthanka 9. bhaga 1-2). Dasaveyaliyasuttam / Sirisejjambhavatherabhadantaviraiyam: Uttarajjhayanaim, Avassa yasuttam ca / anegatherabhadantaviraiyaim : sampadakau Punyavijayo Munih ; Pandita Amftalala Mohanalala Bhojaka iti ca. 1. samskarana. Bambai : Sri Mahavira Jaina Vidyalaya, Vira sam. 2503 [1977]. 91, 664 p. ; 25 cm. (Jaina-Agama-granthamala ; 15). Painnayasuttaim : Vivihatherabhadantaviraiyaim / sampadakau Punyavijayo Munih, Mohanalalatmajah Pandita-Amstalala-Bhojakas ca. 1. samskarana. Bambai : Sri Mahavira Jaina Vidyalaya, Vira sam. 2510_<2513> [1984 <1989>1. <3> v. ; 25 cm. (Jaina-Agamagranthamala , no. 17). [v.3 1989 not yet seen] 18 (1) *Anuyogadvarasutram : Part I: the text critically edited by Punyavijaya with three commentaries, Curni by Jinadasa Gani Mahattara, Vivrti by Haribhadra Suri, Vrtti by Maladhari Hemacandra Suri / critically edited by Jambuvijaya. Bombay: Sri Mahavira Jaina Vidyalaya, , v. ; 25 cm. (Jaina-Agama-granthamala; no. 18 (1)). [Proof-copy seen Jaisalmer December 1998] 7 Jaina Visva Bharati or Ladanum edition 1974 89 This edition has been produced from the Terapanth centre in Ladanum, Rajasthan, under the direction of Acarya Tulsi and his designated successor Yuvacarya Mahaprajna (see also Dundas 1992, 223). Acarya Tulsi first suggested the project in 1955, however only in 1957 did the editing begin. It was completed in 1980 (Uvangasuttani 1989, 13-14). The aim of the project was to edit the thirty-two 9 The following booklet gives an overview of the process of creating this edition: Agama-sampadana ki samasyaem / Yuvacarya Mahaprajna ; sampadaka Muni Vimalakumara. Ladanum: Jaina Visva Bharati, 1993. 'chaha', 116 p. ; 18 cm. Contents: 1. Agama sampadana ka itihasa 1-35.-2. Agama sampadana ki samasyaen (361-37.-3. Pathasampadana ki paddhati [38] 45.-4. Eka prati ko adhara manakara svikyta patha ki samasyaem [46]-53.-5. Pahantara ki parampara (541-66.-6. Uccarana hetuka patha parivartana (671-69.-7. Patha-samsodhana aura anubhava (70)-71.-8. Sanksipta aura vistTta patha [72]-81.-9. Varnaka aura java pada ki samasya
Page #37
--------------------------------------------------------------------------
________________ Agamas and make them easy for individuals to get hold of (p. 27). As part of the larger project a number of dictionaries have also been prepared: Agama sabdakosa (1980, detailed below); Ekarthaka kosa (1984), Nirukta kosa (1984); and Desi sabdakosa (1988) details of the last three dictionaries are given in the separate section on dictionaries below). 1974 or 1975 Angasuttani: Niggantham pavayanam / sampadaka Muni Nathamala [Yuvacarya Mahaprajna]. Ladanum, Rajasthana: Jaina Visva Bharati [Samsthana], Vikrama samvat 2031 [1974 or 1975]. 3 v. ; 25 cm. (1) Ayaro. Suyagado. Thanam. Samavao. 97, 954, 51 p. 2. samskarana. Vikrama samvat 2049. 1992. (2) Bhagavai: Viahapannatti. 56, 1048, [45] p. 2. samskarana. Vikrama samvat 2049. 1992. (3) Nayadhammakahao, Uvasagadasao, Antagadadasao, Anuttarovavaiyadasao, Panhavagaranaim Vivagasuyam. 55, 813, 47 p. 2. samskarana. Vikrama samvat 2048. 1992. "Original text critically edited." Parts 1-3 of a complete edition of the canon. Contents v. 1: Granthanukrama [8].-Prakasakiya [9]-12.-Sampadakiya / Muni Nathamala [13]-29.-[Dvitiya samskarana / Yuvacarya Mahaprajna [29]].-Bhumika / Acarya Tulasi [30]-44.-Editorial [= English version of Sampadakiya] [45]-52.-- [Foreword = English version of Bhumika] [53]-70.-Visayanukkama [71]-97.-Sanketanirdesika [98] Ayaro [1]-250.-Suyagado [251]-486.-Thanam [487]-823.Samavao [825]-954. Parisista 1. Sanksipta-patha, purta-sthala aura purti adhara-sthala [1]-40.-Parisista 2. Alocya-patha tatha vacanantara [41]-51. Contents v. 2: Granthanukrama [8].--Prakasakiya/Acarya Tulasi [9]-12.-Sampadakiya / Muni Nathamala [13]-21. - Bhumika / Acarya Tulasi [23]-27.-Preface [ = English version of Prakasakiya] [29]-34.-Editorial [ = English version of Bhumika] [35]-44.-- Bhagavai visayanukkama [45]-55.-Sanketa nirdesika 56.-Bhagavai Viahapannatti 1-1048. Parisista 1. Sanksipta-patha, purta-sthala aura purti adhara-sthala [1]-44.Parisista 2. Purakapatha [45]. Contents v. 3: Granthanukrama [8].-Prakasakiya [9]-12.-[Dvitiya samskarana [12]].-- Sampadakiya/Muni Nathamala [13]-20.-Bhumika/Acarya Tulasi [21]-30.-Preface [= English version of Bhumika] [31]-40.-Visayanukkama [41]-54.-Sanketa nirdesika [55]. Nayadhammakahao [1]-391.-Uvasagadasao [393]-537.-Antagadadasao [539]610. Anuttarovavaiyadasao [611]-633.-Panhavagaranaim [635]-713.-Vivagasuyam [715]-813.-Parisista 1. Sanksipta-patha, purta-sthala aura purti adhara-sthala [1]-47. ANU BL1312.2 1975 and PK5003.A52 1974 v.1, 2, 3 Agama sabdakosa: angasuttani sabdasuci = Word-indexes of Angasuttani / sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana: Jaina Visva Bharati, Vikrama samvat <2037->. <1980->.< 1 v. >; 25 cm. ANU BL1310.6.A33 1980 v. 1 1987-89 Uvaigasuttani / sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2044-45. I[svi san]. 1987-89. 2 v. ; 25 cm. v. 1. Ovaiyam. Rayapaseniyam. Jivajivabhigame. 74, 515, 774 p. v. 2. Pannavana. Jambuddivapannatti. Candapannatti. Surapannatti. Upanga Nirayavaliyao. Kappavadimsiyao. Pupphiyao. Pupphaculiyao. Vanhidasao. 75, 1100 p. Contents v.1: Granthanukrama [8].-Prakasakiya [9]-11.-Sampadakiya / Yuvacarya Mahaprajna [13]-30.-Bhumika / Acarya Tulasi [31]-40.-Editorial / [ = English translation of Sampadakiya] [41]-59.-Introduction [ = English translation of Bhumika] [61]-70.-Visayanukrama [71]-74.-Sanketa-nirdesika [75]. Ovaiyam [1]-77.Rayapasenaiyam [78]-212-Jivajivabhigame [213]-515.-Parisista 1. Sanksipta-paha, [82]-87.-10. Samalocana aura hamara drstikona [90]-99.-11. Agama ki bhasa [100]-104.-12. Chandasastra [105].-13. Sahayoganubhuti [106]-107.-Parisista: Sthana aura vyakti [108]-116 [last page torn]. 18
Page #38
--------------------------------------------------------------------------
________________ 1987 1.2 8 Sri Harsapuspamgta Jaina Granthamala, 1974-78 Although I have not had the opportunity yet to compare these publications with other editions in detail, the printing of Uvav. (no. 141 below) is without doubt a re-typesetting of the Agamodaya-Samiti edition of 1916 with a number of minor format changes (eg. addition of hyphens, some additional numbering added in parentheses etc.). 1,3 Agama-sudha-sindhu / sampadakah samsodhakas ca Jinendravijaya-Gani. Lakhabavala-Santipuri, Saurastra: Sri Harsapuspamrta Jaina Granthamala, 1974-78. (Sri Harsapuspamrta Jaina granthamala ; 53, 54, 64, 66, 67, 70, 72-77, 79). [Universitat Tubingen library catalogue] 1,1 1,4 2-3 Complete editions purta-sthala aura adhara-sthala nirdesa [519]-534.-Parisista 2. Tulanatmaka [parallels in other texts] [535]-544.-Parisista 3. Saddasuci. 545-774.-Suddhi-patra [775]. Contents v. 2: Granthanukrama [8].-Prakasakiya [9]-11.-Sampadakiya / Yuvacarya Mahaprajna [13]-28.-Bhumika / Acarya Tulasi [29]-37.-Editorial [ = English translation of Sampadakiya] [39]-57.-Introduction [59]-67.-Visayanukrama [69]-75.-- Pannavanasuttam [1]-356.-Jambuddivapannatti [357]-588.-Candapannatti. Surapanpatti [5891-712-Nirayavaliyao. Kappavadimsiyao. Pupphiyao. Pupphaculiyao. Vanhidasao. [713]-785.-Parisista 1. Sanksipta-patha, purta-sthala aura purti adharasthala [789]-805.-Parisista 3. [sic] [Saddasuci] [807]-1093.-Suddhi patra [1094]1096. [Corrections to] Sabdakosa [1097]-1100. "Original text critically edited." Forms v. 4 (parts 1 and 2) of a complete edition of the Jaina Agama. ANU BL1312.5 1987 v.1, 2 Navasuttani: Avassayam, Dasavealiyam, Uttarajjhayanani, Nandi, Anuogadaraim, Dasao, Kappo, Vavaharo, Nisihajjhayanam/vacana pramukha Acarya Tulasi; sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana: Jaina Visva Bharati, Vikrama samvat 2044. I[svi san]. 1987. 140, 812, 29, 320 p. : four pages of plates; 25 cm. Contents: Granthanukrama [8].-Prakasakiya [9]-11.-Sampadakiya / Yuvacarya Mahaprajna [13]-45.-Bhumika / Acarya Tulasi [47]-66.-Editorial [68]-102.Introduction [103]-121.-Visayanukrama [122]-137.-Sanketa nirdesika [139]-140.-- Avassayam [1]-23.-Dasavealiyam [25]-88.-Uttarajjhayanani [89]-244.-Nandi [245]-288.-Anuogadaraim [289]-421.-Dasao [423]-560.-Kappo [561]-595.Vavaharo [597]-661.-Nisihajjhayanam [663]-712.-Parisista 1. Sanksipta-patha, purtasthala aura adhara-sthala nirdesa [1]-12.-Parisista 2. Tulanatmaka [Nandi and Samavao] [13]-29.-Suddhi patra [30].-Parisista 3 Navasuttani saddasuci [15 505 words]. [1]319. Atirikta suddhi-patra 319-320. Forms v.5 of a complete edition of the Jaina Agama. 4 ANU NBC + 1 484 435 *Srimadacaramga-sutram : (mulam) / Sudharmasvami-nirmitam. Lakhabavala-Santipuri, Saurastra, 1974. 12, 140 p. (Sri Harsapuspamrta Jaina granthamala; 53). 4 p. *Srimatsutrakrtanga-sutram : (mulam). Lakhabavala-Santipuri, Saurastra, 1974. 142, 254 p (Sri Harsapuspamrta Jaina granthamala ; 54). *Srimatsthananga-sutram : (mulam). Lakhabavala-Santipuri, Saurastra, 1975. 256, 457 p. (Sri Harsapuspamrta Jaina granthamala; 66). *Srimatsamavayanga-sutram : (mulam). Lakhabavala-Santipuri, Saurastra, 1975. 460, 557 p. (Sri Harsapuspamrta Jaina granthamala ; 67). 19 *Srimadbhagavatisutraparanamnah Srimadvyakhyaprajnaptisutrasya purvadhatmakah 2-3. vibhagah. 1976-77. 2 v. (Sri Harsapuspamrta Jaina granthamala ; 64, 70). v. 1: 16, 444 p. ; v. 2: 16, 446, 842 p. Srimadanuttaropapatikadasa *Srimadjnatasutra-Srimadupasakadasa-SrimadantakrddasaSrimatprasnavyakarana-Srimadvipakasutreti-sadamga-sutratmakah 4. vibhagah. 1976. 16, 496 p. (Sri Harsapuspamrta Jaina granthamala ; 66).
Page #39
--------------------------------------------------------------------------
________________ *Srimadaupapatika-Rajaprasniya-Jivajivabhigamakhyopangatrayatmakah 5. vibhagah. 1977. 12, 439 p. (Sri Harsapuspamsta Jaina granthamala ; 72). 1985 Sri Aupapatikasutram : Srimaccaturdasapurvadharasrutasthavirasankalitam Srimadabhayadevasurisvara sandrbdha-Srimaddronacaryasamsodhitavivaranayutam/ sampadakah samsodhakas ca Vijayajinendra surisvarah. Lakhabavala, Santipuri, Saurastra : Sri Harsapuspamsta Jaina granthamala, 1985. 8, 123 p. ; 13 x 26 cm. (Sri Harsapuspamsta Jaina granthamala; granthankah 141). Contents: Abhara [2].-Prastavana / Jinendrasuri [3-4). -- Suddhipatrakam [4]-8.Srimada upapatikasutramla-123b. This is a retypesetting of Uvav.1916, eg. the footnotes of Uvav.1916 are repeated verbatim, with occasional minor additions however, many hyphens are added to break up long compounds, and there are a number of insertions and additional numbers which tend to be between parentheses. The pagination is different from Uvav.1916. RW *Sriprajnapana-sutratmakah 6. vibhagah. 1976. 12, 394 p. (Sri Harsapuspamsta Jaina granthamala ; 73). *Srijambudvipaprajnapti-Sricandraprajnapti-Srisuryaprajnapti-SrimadupangapancatmakaSrinirayavalikakhyopangastakatmakah 7. vibhagah. 1978. 26, 504 p. (Sri Harsapuspamsta Jaina granthamala ; 74). *Prakirakadasakatmakah matantarena ca Prakirnakadasakantargataprakirakadvayopetah 8. vibhagah. 1975.5, 139 p. (Sri Harsapuspamsta Jaina granthamala ; 75). *Sri Nisitha-Brhatkalpa-Vyavahara-Dasasrutaskandha-Jitakalpa-pancakalpasutratmakah 9. vibhagah. [1975). 288 p. (Sri Harsapuspamrta Jaina granthamala ; 76). *Sri Mahanisitha sutratmakah 10. vibhagah [Press-copy edition of MahaNis. edited by Vijayendra Suri of the Tapa-gaccha, prepared by Muni Jinendravija ya Gani at Jamnagar Lakha-baval, Santipuri, Saurashtra, Vira sam. 2507 [1981). 240 p. (Sri-Harsa-puspamrtaJaina-granthamala ; 77). [Tripathi, MahaNis.1994, 13] "A limited xerox edition" (R. Pagariya, MahaNis. 1994, [2]). Used for the edition of 1994. "Handschrift, photomechan. Druck. [1975)." (Universitat Tubingen library catalogue). *Sri Kalpasutram (Barasa-sutram). 1976. 134 p. (Sri Harsapuspamrta Jaina granthamala ; 73). 1993 *Sri Kalpasutram : Barasa-sutram : sacitram / Bhadrabahusvami-viracitam Sri Paryusana-kalpakhyam ; sampadakah samsodhakas ca Vijayajinendra Surisvarah. Lakhabavala, santipuri, Saurastra : Sri Harsapuspamsta Jaina granthamala, 1993. 8,117 p.: 41 p. of plates : col. ill. ; 15 x 30 cm. (Sri Harsapuspamrta Jaina granthamala ; granthankah 73). [DKS-4848. DK Agencies Recent Sanskrit, Prakrit and Pali publications Ref. No. CIR-1378 / 1994-95, item 173, CIR-1503/95-96 item 41] *Srimadavasyakasutra... Srimadoghaniryukti-sutradvayatmakah 12. vibhagah. 1976. 15, 207 p. (Sri Harsapuspamsta Jaina granthamala ; 79). *Sridasa vaikalikasutra-...-Pindaniryukti-...-Srimaduttaradhyayanasutra-sutratrayatmakah 13. vibhagah. 1975. 16, 200 p. (Sri Harsapuspamrta Jaina granthamala ; 75). 141 *Srinnadisutra-...-Srimadanuyogadvarasutreti-sutradvayatmakah 14. vibhagah. 1976.5, 144 p. (Sri Harsapuspamsta Jaina granthamala ; 76). 1985 Sri Aupapatikasutram : srimaccaturdasapurvadharasrutasthavirasankalitam Srimada bhayadevasurisvara sandrbdha-srimaddronacaryasamsodhitavivaranayutam/ sampadakah samsodhakas ca Vijayajinendrasurisvarah. Lakhabavala, Santipuri, Saurastra : Sri Harsapuspamrta Jaina granthamala, Vira 2511. Vikrama sam. 2041. San 1985. 8, 123 p.; 13 x 26 cm. (Sri Harsapuspamrta Jaina granthamala, granthankah 141). 20
Page #40
--------------------------------------------------------------------------
________________ Complete editions 166 Sri Jnata-dharmakathangam : pujya Ganadharapranitam navargivittikara-pujyacaryapungava Srimadabhayadevasurisvaravivrtam sasthamanga/ sampadaka (sic) samsodhakasca Srivijayajinendrasurisvarah .... Prathamavrttih. Santipuri, Baya, Jamanagara : Sri Harsapuspamrta Jaina Granthamala, Vira Samsvat) 2513 [1987]. 16, 542 p. ; 14 x 26 cm. (Sri Harsapuspamsta Jaina Granthamala, 166). Jinagama granthamala, Byavara, Agama Prakasana Samiti, (Sthanakvasi) 1979_94 1-2 Acaranga sutra (prathama Anga : mala patha, Hindi anuvada-vivecana-lippana-parisista yukta / Sudharmasvami-pranita ; sampadaka-vivecaka Sricanda Surana "Sarasa'. Byavara, Rajasthana : Sri Agama Prakasana Samiti, Vira Nirvana samvat 2507 [1980). 2 v. ; 25 cm. (Jinagama granthamala ; granthanka 1, 2). Upasakadasanga sutra : mulapatha, Hindi anuvada, vivecana, parisista yukta : pancama Ganadhara Bhagavatsudharma-Svami-pranita saptama Anga / samyojaka tatha pradhana sampadaka Yuvacarya Sri Misrimalaji Maharaja 'Madhukara'; anuvadaka-vivecakasampadaka Chaganalala Sastri. Byavara, Rajasthana : Sri Agamaprakasana Samiti, Vira Nirvanasamvat 2037. Vi. sam. 2037. I. san 1980. 3, 3, 2, 20, (5), 233 p. ; 25 cm. (Jinagama granthamala, granthanka 3). Jnatadharmakathanga sutra : Pancama Ganadhara Bhagavatsudharma-Svami-pranita sastha Anga : mulapatha, Hindi anuvada, vivecana, parisista yukta / samyojaka tatha pradhana sampadaka Yuvacarya Srimisrimalaji Maharaja 'Madhukara'; sampadaka-vivecaka-anuvadaka Sobhacandra Bharilla. Byavara, Rajasthana : Sri Agamaprakasana-samiti, Viranirvanasamvat 2508 [1981). 16, 60, 576 p. ; 24 cm. (Jinagama-granthamala, granthanka 4). Antakrddasasutra : pancama Ganadhara Bhagavatsudharma-svami-pranita astama Anga : mulapatha, Hindi anuvada, vivecana, parisista yukta/ samyojaka tatha pradhana sampadaka Srimisrimalaji Maharaja 'Madhukara'; anuvadana-vivecana-sampadana Ba. Bra. Jaina Sadhvi Divyaprabha. Byavara, Rajasthana : Sri Agamaprakasana-samiti Viranirvanasamvat 2508 [1981). 32, 202 p. : ill. ; 25 cm. (Jinagama-granthamala; 5). Anuttaropapatikadasanga : Pancama Ganadhara Bhagavatsudharmasvami-prasita navama Anga: mulapatha, Hindi anuvada, vivecana, parisista yukta/adya samyojaka tatha pradhana sampadaka Misrimalaji Maharaja 'Madhukara'; anuvadaka-vivecaka Sadhvi Muktiprabhaji. Byavara, Rajasthana : Sri Agamaprakasana-samiti, 1981. 32, 99 p. ; 25 cm. (Jinagamagranthamala ; granthanka 6). Sthanangasutra : Pancama Ganadhara Bhagavatsudharma-Svami-pranita trtiya Anga : mulapatha, Hindi anuvada, vivecana, parisista yukta / samyojaka tatha pradhana sampadaka Yuvacarya Srimisrimalaji Maharaja 'Madhukara'; anuvadaka-vivecaka Hiralala Sastri. Byavara, Rajasthana : Sri Agamaprakasana-Samiti, Viranirvanasamvat 2508. Vi. sam. 2038. I. san 1981. 66, 754 p. ; 25 cm. (Jinagama granthamala, granthanka 7). Samavayangasutra : Pancama Ganadhara Bhagavatsudharma-Svami-pranita caturtha Arga: mulapatha, Hindi anuvada, vivecana, parisista yukta / samyojaka tatha pradhana sampadaka Srimisrimalji Maharaja 'Madhukara'; anuvadaka, vivecaka, sampadaka Hiralalaji Sastri. Byavara, Rajasthana : Sri Agamaprakasanasamiti, Viranirvanasamvat 2508 [1982). 14, 104, 259 p. ; 25 cm. (Jinagama granthamala ; granthanka 8). 9-10 Sutrakstangasutra : Pancama Ganadhara Bhagavat Sudharmasvami-pranita dvitiya Anga : mala patha, Hindi anuvada-vivecana-tippana-parisista yukta / samyojaka tatha pradhana sampadaka Sri Misrimala ji Maharaja 'Madhukara'; sampadaka-anuvadaka-vivecaka Sricandra Surana 'Surasa'. 2 v. ; 26 cm. Byavara, Rajasthana; Sri Agama Prakasana Samiti, Vira Nirvana samvat 2508 [1982). (Jinagama granthamala; granthanka 9, 10). Vipakasruta : Pancama Ganadhara Bhagavatsudharma-Svami-pranita gyarahavam Arga: mulapatha, Hindi anuvada, vivecana, parisista yukta / samyojaka tatha pradhana sampadaka
Page #41
--------------------------------------------------------------------------
________________ Srimisrimalaji Maharaja Madhukara'; anuvadaka Rosanalala Jaina ; sampadaka Sobhacandara Bharilla. Byavara, Rajasthana : Sri Agamaprakasana-Samiti, Viranirvana samvat 2508 [1982]. 50, 156 p. ; 25 cm. (Jinagama granthamala ; granthanka 11). Nandisutra : Sridevavacakaviracita : mulapatha, Hindi anuvada, vivecana, parisista yukta / samyojaka tatha pradhana sampadaka Srimisrimalaji Maharaja 'Madhukara'; anuvadanavivecana Jaina Sadhavi Umaravakuivara 'Arcana'; sampadana Kamala Jaina "Jiji.' Byavara, Rajasthana : Sri Agamaprakasana-samiti, Viranirvanasamvat 2508 [1982]. 29,219 p. ; 25 cm. (Jinagama granthamala ; granthanka 12). Aupapatikasutra : Caturdasapurvadharasthavirapranita prathama Upanga : mulapatha, Hindi anuvada, vivecana, parisista yukta / samyojaka tatha pradhana sampadaka Yuvacarya Srimisrimalaji Maharaja 'Madhukara'; anuvadaka-vivecaka Chaganalala Sastri. Byavara, Rajasthana : Sri Agamaprakasana-samiti, Viranirvanasamvat 2508 [1982]. 42, 198 p. ; 25 cm. (Jinagama-granthamala ; granthanka 13). 14, 18, 22, 25 Vyakhyaprajnaptisutra : Pancamaganadhara Bhagavat Sudharmasvami-pranita : pancama Anga : Bhagavatisutra : mulapatha, Hindi anuvada, vivecana, tippanayukta / samyojaka tatha pradhana sampadaka Yuvacarya Srimisrimalaji Maharaja 'Madhukara'; sampadaka-vivecaka-anuvadaka Amara Muni, Sricanda Surana 'Sarasa'. Byavara, Rajasthana : Sri Agamaprakasanasamiti, Viranirvanasamvat 2509-12 [1982-86). (Jinagama-granthamala; granthanka 14, 18, 22, 25). 4 v. ; 25 cm. Rajaprasniyasutram: dvitiya-Upanga, mulapatha, Hindi anuvada, vivecana, parisista yukta / samyogaja tatha pradhana sampadaka Sri Misrimalaji Maharaja 'Madhukara'; sampadakavivecaka-anuvadaka Sri Ratana Muni ji. Byavara, Rajasthana : Sri Agamaprakasanasamiti, Viranirvanasamvat 2509 (1982). 40, 244 p. ; 25 cm. (Jinagama-granthamala; granthanka 15). <16, 20, 27> Prajnapanasutra : Sri Syamaryavacaka-sankalita caturtha Upanga : mulapatha, Hindi anuvada, vivecana, tippanayukta / sampadaka-vivecaka-anuvadaka Jnanamuniji ; saha sampadaka Sricanda Surana 'Sarasa.' Byavara, Rajasthana : Sri Agamaprakasana-samiti, Viranirvanasamvat 2509-<2512> (1983-<1986>). v. <1-3> ; 25 cm. (Jina gamagranthamala, granthanka <16, 20, 27 >). Prasnavyakaranasutram: dasamamangam: mulapatha, Hindi anuvada, vivecana, parisista, sabdakosa sahita / samyojaka tatha pradhana sampadaka Misrimalaji Maharaja Madhukara'; anuvadaka Pravinatsiji ; sampadaka Sobhacandra Bharilla. Byavara, Rajasthana : Sri Agama Prakasana-Samiti, Vi. sam 2040 [1983]. 35, 319 p. ; 25 cm. (Jinagama-granthamala, granthanka 17). Viy. see v. 14. Uttaradhyayanasutra : mulapatha, Hindi anuvada, vivecana, parisista, tippanayukta / samyojaka tatha pradhana sampadaka Misrimalaji Maharaja Madhukara'; anuvadakavivecaka-sampadaka Rajendramuni. Byavara, Rajasthana : Sri Agama Prakasana-Samiti, Vi. sam 2510 [1984]. 110, 732 p. ; 25 cm. (Jinagama-granthamala, granthanka 19). Pannav. see v. 16. Nirayavalikasutra : Kappiya, Kappavadimsiya, Pupphiya, Pupphaculiya, Vanhidasa / anuvadaka-sampadaka Devakumara Sastri ; mukhya sampadaka Sobhacandra Bharilla. Byavara, Rajasthana : Sri Agamaprakasana Samiti, Viranirvana samvat 2511 [1985]. 31, 144 p. ; 26 cm. (Jinagama-granthamala; granthanka 21). Viy.see v. 14. Dasavaikalikasutra : mulapatha, Hindi anuvada, vivecana, parisista yukta / Sri Sayyambhavasthaviraviracita ; adyasamyojaka-pradhanasampadaka Misrimalaji Maharaja *Madhukara'; anuvadaka-vivecaka-sampadaka Mahasati Puspavati. Byavara, Rajasthana : 22
Page #42
--------------------------------------------------------------------------
________________ Complete editions Sri Agamaprakasana Samiti, 1984.. 80,452 p. ; 25 cm. (Jinagama-granthamala, granthanka 23). Reprint 1993. 24 Avasyakasutra: mulapatha. Hindi anuvada, vivecana, tippana yukta / adyasamyojaka tatha pradhana sampadaka Misrimalaji ; anuvadaka-vivecaka-sampadaka Suprabha 'Sudha.' Byavara, Rajasthana : Sri Agama Prakasana Samiti, Viranirvana samvat 2520. Vikrama samvat 2051. I. san 1994. 2. samskarana. 68, 130 p. ; 25 cm. (Jinagama-granthamala ; granthanka 24.) Viy. see v. 14. Jambudvipaprajnaptisutra : Sthavirapranita sastha Upanga : mulapatha, Hindi anuvada, vivecana, parisista yukta / adyasamyojaka tatha pradhana sampadaka Misrimalaji Maharaja Madhukara'; anuvadaka-sampadaka Chaganalalasastri. 2. samskarana. Byavara, Rajasthana : Sri Agama Prakasana-Samiti, Viranirvana samvat 2520 [1994]. 59, 417 p. ; 25 cm. (Jinagama-granthamala , granthanka 26). Pannav. see v. 16. Anuyogadvarasutra / Aryaraksitasthaviraviracita : mulapatha, Hindi anuvada, vivecana. parisista yukta / adyasamyojaka-pradhanasampadaka Misrimalaji Maharaja 'Madhukara'; anuvadaka-vivecaka Sri Kevalamuniji ; sampadaka Devakumara Jaina, mukhyasampadaka Sobhacandra Bharilla. Byavara, Rajasthana : Sri Agama Prakasana-Samiti, Viranirvana samvat 2513 (1987). 47, 501 p. ; 25 cm. (Jinagama-granthamala; granthanka 28). *Suryaprajnapti-Candraprajnapti : Srutasthavirapranita-Upangasutradvaya : mulapatha, prastavana tatha parisista yukta / sampadaka Kanhaiyalalaji 'Kamala'; mukhya sampadaka Sobhacandra Bharilla. Byavara, Rajasthana : Sri Agama Prakasana-Samiti, (1989). 1. samskarana. 48, 248 p. ; 25 cm. (Jinagama-granthamala , granthanka 29). 30-31 Jivajivabhigamasutra : Srutasthavira pranita-Upangasutra : mulapatha, prastavana artha, vivecana tatha parisista adi yukta / sampadaka Rajendramuniji ; mukhya sampadaka Sobhacandra Bharilla. Byavara, Rajasthana : Sri Agama Prakasana-Samiti, 2515-17 [198991). 2 v. ; 25 cm. (Jinagama-granthamala , granthanka 30, 31). Trini chedasutrani : Dasasrutaskandha. Brhatkalpa. Vyavaharasutra : mulapatha, Hindi anuvada, vivecana, tippana yukta / samyojaka tatha adya sampadaka Misrimalaji Maharaja *Madhukara'; anuvadaka-vivecaka-sampadaka Kanhaiyalalaji Ma[haraja). 'Kamala'. 1. samskarana. Byavara, Rajasthana : Sri Agamaprakasana Samiti, Vira nirvana sam. 2517. Vikrama sam. 2048. 1992 I. 81, 462 p. ; 25 cm. (Jinagama-granthamala ; 32). 32a Nisithasutra : mulapatha, Hindi anuvada-vivecana-tippana yukta / adya samyojaka tatha pradhana sampadaka Misrimalaji Maharaja 'Madhukara'; anuvadaka-vivecaka-sampadaka Kanhaiyalalaji Maharaja). 'Kamala' ; Sri Tiloka Muniji Maharaja). 1. samskarana. Byavara, Rajasthana : Sri Agamaprakasana Samiti, Vira nirvana sam. 2517. Vikrama sam. 2048. 1991 I. 97, 458 p. ; 25 cm. (Jinagama-granthamala ; 32a). 10 45 Agamasuttani / samsohaya-sampayaga Muni Diparatnasagara. Badodara : Agama Sruta Prakasana, 1996. 2052 [1995]. 45 v. ; 22 cm. ANU NBC 2 118 391-435 Ayaro. 8, 120 p. [Text numeration does not match Ayar. 1975) Suyagado. 8, 112 p.. Thanam. 8, 160 p. Samavao. 4, 2, 72, 5-8 p. Bhagavai. 8, 504 p. Nayadhammakahao. 8, 172 p. Uvasagadasao. 4, 64, 5-8 p. Antagadadasao. 4, 32, 5-8 p. Anuttarovavaiyadasao. 4, 8, 5-8 p. Panhavagaranam. 4, 32, 5-8 p.
Page #43
--------------------------------------------------------------------------
________________ Vivagasuyam. 4, 40, 5-8 p. Uvavaiam. 4, 40, 5-8 p. Rayapaseniyam. 4, 63, 5-8 p. Jivajivabhigama. 8, 152 p. Pannavana. 8,200 p. Surapannatti. 4, 64, 5-8 p. Candapannatti. 4, 64, 5-8 p. Jambuddivapannatti. 8, 120 p. Nirayavaliyanam. 1-4, 8, 5-8 p. Kappavadimsayanam.4, 4, 5-8 p. Pupphiyanam. 4, 12, 5-8 p. Pupphaculiyanam. 4, 4, 5-8 p. Vanhidasanam. 4, 4, 5-8 p. Causaranam. 4, 4, 5-8 p. Aurapaccakkhanam. 4, 5, 5-8 p. Mahapaccakkhanam. 4, 12, 5-8 p. Bhatta parinna. 4, 12, 5-8 p. Tandulaveyaliyam. 4, 16, 5-8 p. Samtharagam. 4, 8,5-8 p. Gacchayaram. Candavejjhayam. 4, 20, 5-8 p. Ganivijja. 4, 8, 5-8 p. Devindatthao. 4, 20, 5-8 p. Maranasamahi. Virastava. 4, 44, 5-8 p. Nisiham. 8, 80 p. Brhat kappo. 5, 16, 5-8 p. Vavahara. 4, 28, 5-8 p. Dasasuyakkhandham. 4, 24, 5-8 p. Jiyakappo. Pancakappabhasa. 8, 160 p. Mahanisiha. 8, 144 p. Avassayam. 4, 12, 5-8 p. Ohanijjutti. Pindanijjutti. 8, 108 p. Dasaveyaliam. 4, 36, 5-8 p. Uttarajjhayanam. 8, 104 p. Nandisuyam. 4, 24, 5-8 p. Anuogadaraim. 4, 64, 5-8 p. 0.2 SELECTIONS FROM CANONICAL TEXTS10 1923 Jain, B[anarsi]. D[as]. Ardha Magadhi reader. Lahore, 1923. lxv, 178 p. ; 22 cm. Contents: Preface v.-Ardha-Magadhi grammar [ix-xxxviii.-Ardha-Magadhi language and literature ixl fie. xxxix-liii.-Bibliography liv-lxv.-Ardha-Magadhi reader. 1. Miyaputte darae (Viva. 1.1] 1-12.-2. Mehe kumare [Naya 1.1, variants from Naya.1877,191913-38.-3. Tavasa-parivvayaga (extracts 3-6 from Acar. 1, copied from Acar. 1916] 38-46.--4 Ayathasamanuvase 45-46.-5. Indiyabhogaim 47-48.-6. Ittaramaranam 48.-7. Panavaho (Panha. 1] 49-51.-8. Mokkhamagge (Suy. 1.11] 5255.-9. Bala-pandiyamaranam (Utt. 5] 55-57.-10. Anagarakiccaim [Suy.14] 58-61.11. Parisahovasagga [Suy. 1.3.1) 61-62.-12. Cittasambhuya (Utt. 13-14] 63-74.-13. Ayarappanihi (Dasave. 8) 74-78.-Note to translation[s] 79.-[Translations unless noted are reprints from Jacobi's SBE] 1. The child Miyaputta / B. D. Jain. 80-93.-2. Prince Meha / B. D. Jain 94-119.-3. Ascetics and hermits. 120-26.-4. Prosecution of one's object 127-28.-5. Sensual pleasures 129-30.6. The death called ittara 131-32.-7. Injury to life/B.D. Jain. 133-36.-8. The path 137-41.-9. Death foolish and wise 142 10 This and the following sections are not comprehensive; rather they are places to enter appropriate works from the ANU Library collection until I have an opportunity to cover a wider range of material. 24
Page #44
--------------------------------------------------------------------------
________________ Complete editions 146.-10. The duties of a monk 147-50.-11. Trials and persecutions 151-153.-12. Citra and Sambhuta 154-66.-13.) The treasure of right conduct/B. D. Jain 167-72.-Index of words explained in footnotes 173.-Index of important words and subjects 174-78. Reprint. Delhi : Sri Satguru Publications, 1982. ANU PK 1255.J34 1982 1932 Jaina Siddhanta pathamala: Samskrtachayayuta: Dasavaikalika Uttaradhyayana sutra chaya sathe sampurna tatha Bhaktamara adi atha stotra, pucchisunam ane Tattvarthadhigama sutra mula patha sahita / chaya samyojaka Saubhagyacandraji. Limbadi, Kathiavada : Sriajaramara Jaina Vidyasala. Prathamavsttih. [Vira] 2485. Vikrama samvat 1989 (1932). 12, 456 p. ; 18 cm. Contents: Nivedana 3-Prasangika vaktavya 4-5-Suddhi-patraka 6-12.-Dasavaikalika sutram 1-108. Sri Uttaradhyayana sutram 109-424.-Bhaktamarastotram 425-29.-Srikalyanamandirastotram 429-33. Sricintamani Parsvanatha stotram 434-35.-Sri Amitagatisuriviracita prarthana pancavimsatih 436-38.-Sri Ratnakarapancavimsatih 43840. Sri Paramananda pancavimsatih 441-42.-Svatma cintvana 442.-Pucchissu nam 443-45.- Sri Tattvarthasutram 445-55.--Tirthankarastotram 455-56.--Satistotram 456. "Prata 2000." ANU BL1310.5.J25 1952 1942-51 Sramana Bhagavan Mahavira. Ahmedabad: Sri Jaina Siddhanta Society, Vira samvat 2468 77. Vikrama samvat 1998-2007. 1942-51. 5 v. in 8 ; 25 cm. (Commemoration volume: 1-8). v. 1, pt. 1-2: Life (earlier existences of Mahavira] / by Muni Ratna Prabhavijaya. 2nd ed. Vira samvat 2474. Vikrama samvat 2004. 1948.; pt. 1. 106, 227, 26 p.-pt. 2. vii, 304, 32 p. v. 2, pt. 1-2: Life (of Mahavira, containing 116 sutras of the Kalpasutra and additional material?). Vira samvat 2468-77. Vikrama samvat 1998-2007. 1942-51. 12, 19, 284 p.-pt. 2. 8, 792, 31 p. v. 3: Ksamasramana Jin[a]bhadra Gani's Ganadharavada, along with Maladharin Hemacandra Suri's Sanskrit commentary edited by Muni Ratna-prabha Vijaya: with translation, digest of commentary and introduction / by Dhirubhai P. Thaker. Ahmedabad: Sri Jaina Grantha Parakasaka Sabha, Virasamat 2468. Vikram samvat 1998. 1942. Contents: Introduction (3]-36.-Ksamasramana Jin[a]bhadra Gani's Ganadharavada [text and English translation] [1]-538.--Corrections (534).-Advertising, 6 p). Cover-title: "Sramana Bhagavan Mahavira : v. 3. Ganadhara-vada." Reprint. Vira samvant [sic] 2470. Vikrama samvat 2006. 1950. Slight differences in pagination plus index p. 537-46. v. 4: Ksamasramana Jinabhadra Gani's Nihnava-vada : along with Maladharin Hemacandra Suri's comme[n]tary edited by Muni Ratna-prabha Vijaya : with translation, digest of Sanskrit commentary and introduction / by Dhirubhai P. Thaker. Ahmedabad: Sri Jaina Grantha Parakasaka Sabha, Virasamat 2473. Vikram samvat 2003. 1947. Contents: Preface: the text of the Nihnavada/Dhirubhai P. Thaker [1]-19.-Nihnavavada [text and English translation] [1]-340.--Corrections [341].--Index (343]-347- [Advertising, 32 p.) Cover-title: "Sramana Bhagavan Mahavira : v. 4 Nihnava-vada." v. 5, pt. 1: Ahmedabad: Sri Jaina Grantha Parakasaka Sabha, Virasamat 2474. Vikrama samvat 2004. 1948. Contents: Introduction 51-7. Sthaviravali (text and English translation] [11-332.Chronology (333)-336.-Appendix no. VI. Yuga-pradhana [337]-347.-Index [348]356.--[Advertising 32 p.) The sources are listed (Introduction p.6) but not clearly identified. Cover-title: "Sramana Bhagavan Mahavira : v. 5., p. 1., Sthaviravali." v. 5, pt. 2:Virasamat 2477. Vikrama samvat 2007. 1950. Contents: Sthaviravali (translation only] [1]-218. Chronology [219]-226.-List of the disciples of Vijayanemi Suri 228-29.--Corrections [232]-234.-Subject-index (235) 242.-[Advertising] 1-31. Cover-title: "Sramana Bhagavan Mahavira : v.5., p.2., Sthaviravali."
Page #45
--------------------------------------------------------------------------
________________ 1960 "[A]n effort to supply the English-knowing public with an accurate, comprehensive, and authentic account of the twenty-six previous bhavas (existences) and the twenty-seventh bhava of Sramana Bhagavan Mahavira" (Foreword v.1, pt. 1, p. 21). Sources for the extracts printed and translated are not given. First edition in 4 v. 1941-42 (v.1, pt. 1. Preface to second edition) ANU BL1371.V5 A Middle Indo-Aryan reader/ by Suniti Kumar Chatterji and Sukumar Sen. Calcutta : Calcutta University Press, 1960. 3rd. rev. ed. 2 v. ; 22 cm. Contents Part 1: Texts. Preface (iii)-iv.-[85 short extracts from published works, covering Asokan inscriptions, documents from Niya, Pali texts, literary Prakrits, Apabhramsa][1]101. Contents Part 2: Notes. Minimal grammatical notes in English on the texts)[103]-225.Abbreviations 226). First ed. 1953 although the notes to that selection of texts were never published. Revised ed. 1957. Part 1 has "Third edition, revised" glued onto front cover, while t.p. has "Revised second edition". Part 2 has printing date (?) 1961 (reverse of t.p.). Only two small passages of Ardha-Magadhi, both extracted from Jacobi's editions (Ayar. 1882, 12 verses, Kapp. 1879, 19 lines). ANU PK1471.C45 pts. 1, 2 Svadhyaya-sudha/ nirdesaka Kanhaiyalalaji Kamala'; samyojaka Vinaya Muni Vagisa. Bakhatavarapura Sanderava, Pali, Rajasthana : Agama Anuyoga Prakasana, Vira samvat 2503 [1977]. 12, 480 p. ; 15 cm. Contents: 1. Vira-stuti 10-13.-2. Mulasuttani (1) Dasavedaaliyasuttam 1-86.-3. Mulasuttani (2) Uttarajjhyayana suttam 87-335.-4. Nandi suttam 337-419.-5. Tattvartha sutra 421-43.-6. Bhaktamara stotram 444-53.-7. Sri Kalyana-mandirastotram 455-62.-8. Mahavirastaka stotram 463-64.-9. Sri Cintamani-Parsvanathastotram. 465-67.-10. Sri Ratnakarapancavimsatih 467-69.-11. Acarya Amitagati Surikrta dvatrimsika 470-76.-12. Subhasita 476-78.-13. Tirthankarastotram 479--14. Satistotram 479-80. 15. Uvasaggahara stotra 480. Compendium of bare texts. ANU BL1310.2. 585 1977 1977 1982 *Dhammakahanuogo: Dharmakathanuoga : mulamatra : Angadi Jinagamom ke mulapatha mem prarupita dharmakathaom ka vargikrta sankalana / sankalana Muni Kanhaiyalala "Kamala' Pandita Dalasukha Malavaniya. 1. samskarana. Ahamadabada; Agama Anuyoga Trasta, 1982.799 p. in various pagings; 28 cm. (Jainagama Anuyoga granthamala; nam. 1). [DK card] 1983a Dhammakahanuogo: Hindi anuvada sahita / sankalanakarta Muni Kanhaiyalala 'Kamala' evam Dalasukhabhai Malavaniya ; anuvada Devakumara Jaina ; pradhana sampadaka Sricanda Surana 'Sarasa'. Ahmadabada : Agama Anuyoga Trasta, Vira nirvana samvat 2509. Vikrama samvat 2040. Isvi san. 1983. 2 v. ; 28 cm. (Agama Anuyoga grantha ; 1). Bhaga 1. Prathama evam dvitiya skandha. 16, 2, 132, 24, 257, 379 p. ; 5 leaves of plates (portraits).--Bhaga 2. Trtiya se sastha skandha. 68, 124, 320, 79, 172, 40 p. Contents Bhaga 1: Prakasakiya [7]-8. - Prakkathana / Muni Kanhaiyalala *Kamala' [9]-15.-Prastuta Dharmakathanuyoga ka sanksipta paricaya 16. - Dharmakathanuyoga eka samiksatmaka adhyayana / Devendra Muni (1)-131 p. -Sanketika sabdasuci 132. -Visaya-suci [1]-24.-1. khandho : Uttamapurusakathanaka 1-257.-2. khandho : samanakahana gani [1]-379. Contents Bhaga 2: Prakasakiya [1]. --Anuyoga ki sarthakata : eka cintana / Muni Kanhaiyalala 'Kamala' [6]-7.-Sarketika sabdasuci [8]. Prastavana : Agama kathasahitya mimamsa / Premsuman Jaina [91-40. -- Visaya-suci [41]-68.-3. khandho : Sramani kathanaka [1]-124.-4. khandho: Sramanopasaka kathanaka [1]-320.-5. khandho: Ninhavakathaem [1]-79.-6.khandho: Prakirnaka kathacm [1]-172.-Parisista 1. Carita sandarbha sthala suci [1]-7.-2. Vyakti nama-suci (8) 40. 26
Page #46
--------------------------------------------------------------------------
________________ Complete editions Gujarati version in one volume 1987. ANU LARGE BOOK BL1310.2.D43 1983 v.1. v.2 1983b *Paiyasangaho / Muni Vimalakumara. 1. samskarana. Ladanun, Rajasthana : Jaina Visva Bharati Prakasana, 1983. [10], 215 p. ; 22 cm. [DKS-4163. DK listing 1988-96, item 259] "Selected Agamic texts, with critical notes, exposition and grammar" (DK listing). 1986 *Ganitanuyoga : Jaina Agamamata bhugola-khagola evam antariksa sambandhi samagri ka visayakrama se pramanika sankalana. 2nd ed., rev. and enl. Ahamadabada: Agama Anuyoga Trasta, 1986. I v. (various pagings) : ill. ; 28 cm. ANU BL1312.27 G36 1986 1987 Dharmakathanuyoga : Gujarati bhasantara / sankalanakarta Muni Kanhaiyalala Kamala' ane Dalasukhabhas Malavaniya ; anuvadaka Ramanikalala Manasukhabhai Saha. Amadavada : Agama Anuyoga Trasta, Vira Nirvana samvat 2513. Vikrama samvat 2043. Isvi san 1987. 1. avrtti. 16, 147, 26, 147, 251 p. ; 28 cm. Gujarati version of Dhammakahanuogo 198a above, in one volume, without original text. Devendra Muni's lengthy introduction to part 1 is also translated here. ANU NBC 2 118 362 1995 *Dravyanuyoga : Jainagamom mem varnita-jiva-ajiva visayaka samagri ka vinayanukrama se paramanika sankalana; mula evam Hindi anuvada/pradhana sampadaka Kanhaiyalala Ji 'Kamala'; sahayogi sampadaka Vinaya Muni ji "Vagisa", Muktiprabha, Divyaprabha ; pradhana paramarsadata Dalasukhabhai Malavaniya. Ahamadabada : Agama Anuyoga Trasta, <1995- >.v<3>; 28 cm. (Arham Gurudevasri Phateha-Pratapa Smrti puspa Agama Anuyoga granthamala; 8). [DK 5438. DK listing, Recent Sanskrit, Prakrit and Pali publications from India CIR-1625 / 1996-97, item 27] Contents v. 3: 64, 1539-2124 p. 1995 *Divya-dava : Agama-suktom ka Hindi padyanuvada / Muni Ganesamala ; paricaya Muni Rakesa Kumara. 1. samskarana. Curu, Rajasthana : Adarsa Sahitya Sangha, 1995. 128 p.; 22 cm. DKS-4985. DK Agencies Recent Sanskrit, Prakrit and Pali publications Ref. No. CIR-1534 / 1996-97, item 3] 0.3 STUDIES OF CANONICAL TEXTS 1925 von Glasenapp, Helmuth. Der Jainismus : eine indische Erlosungsreligion: nach den Quellen dargestellt. Berlin : Alf Hager, 1925. 505, 28 p. ; 20 cm. Contents: Vorwort [v]-vi.-Inhalt [vii]-x.-1. Einleitung 1-5.-2. Geschichte 6-80.-3. Schrifttum 81-137.-4. Lehre 138-313.-5. Gesellschaft [314]-357.-6. Kultus (358)440.--7. Schluss [441]-460.-Anmerkungen [461]-482.-Bibliographie (483) -488.Zu den Bildern [489]-488.-Index [493]-505. "Mit 3 farbigen und 28 schwarzen Tafeln." Reprint. Hildesheim : Georg Olms, 1964. 1984. ANU BL1351.65 1964 Translation. Shrotri, Shridhar B. Jainism : an Indian religion of salvation / translated by Shridhar B. Shrotri. New Delhi : Motilal Banarsidass, 1996 (forthcoming) [MLBD Newsletter May 1996, 13) 1926 Schubring, Walther. Worte Mahaviras : kritische Ubersetzungen aus dem Kanon der Jaina. Gottingen : Vandenhoeck & Ruprecht, 1926. ix, 152 p. (Quellen der Religionsgeschichte. Bd. 14, Gruppe 7). Reviews: H. Jacobi, Der Jainismus, Archiv fur Religionsgeschichte 18 (1915). 283 ff.E. Leumann, Zeitschrift fur Indologie und Iranistik 7 (1929), 157-62. ANU BL1310.59
Page #47
--------------------------------------------------------------------------
________________ 1928 1935 Devacandra, 1581-1655. *Agamasaroddhara / Devacandraji krta. Tritiyavrtti. Padara : Adhyatma Jnana Prasaraka Mandala, 1928. 11, 106 p. ; 21 cm. (Srimad Buddhisagarasuriji granthamala , granthanka 57). CRL catalogue Critical study of the Jaina Agamas. Schubring, Walther. Die Lehre der Jainas nach den alten Quellen dargestellt. Berlin: Walther de Gruyter, 1935.251 p. (Grundriss der indo-arischen Philologie und Altertumskunde ; Band 3 Heft 7.) ANU BL1351.542 BhKappNi.1998 contains in an appendix by Elfrun Linke to vol. 1, the glossary missing in Schubrings's Doctrine of the Jainas." Abridged) translation: The doctrine of the Jainas: described after the old sources / translated from the revised German edition by Wolfgang Beurlen. Delhi : Motilal Banarsidass, 1962. viii, 335 p.1978. Review of 2 by Willem Bollee Zeitschrift der Deutschen Morgenlandischen Gesellschaft 130 (1980) 661. ANU BL1351 .S413 1976 1941 Kapadia. Hiralal Rasikdas. A history of the canonical literature of the Jainas. Gopipura, Surat : Hiralal Rasikdas Kapadia, 1941. ix, 272 p. ; 20 cm. Contents: Preface lii]-iv-Analysis (5)-ix. Chapter 1. Genesis of the Jaina scriptures [1]-19.-2. Classifications of the Agamas (20)-58.-3. Redaction of the Jaina canon [59]-69.-4. The extinct Agamas of the Jainas [70]-109.-5. The extant Agamas of the Jainas [1101-170.-6. The canonical exegetical literature (171)-205.-7. Comparison and evaluation (206)-231.-Index 1. Names of authors and other persons and sects and the like [232]-240.-Index 2. Names of works, their sections, doctrines, metres etc. [241]264.- Additions and corrections [265)-272. RW 1947 Jain, Jagdish Chandra. Life in ancient India as depicted in the Jain canons (sic) (with commentaries) : an administrative, economic, social and geographical survey of ancient India based on the Jain canons. Bombay: New Book Company, 1947. 420 p. ; 25 cm. Contents: Preface[5]-7.-Bibliography (with abbreviations) 8-15.-Contents (16).Section 1. Introduction to the Jain canon. Chapter 1. The history of the Jain church [19130.-2. The canons of the Jains 31-43.-Section 2. Administrative organisation. Introduction [47).-1. Central administration 4960.-2. Fiscal administration [61]-63.3. Administration of justice. [64]-74.-4. Military organisation (751-81. - 5. Local government (82)-83.-Section 3. Economic aspects. Introduction (87).-1. Production [89]-110.-2. Distribution [111]-112.-3. Exchange [113]-122.-4. Consumption [123]- 134.Section 4. Social conditions. Introductory [1371-1. Social organisation (1391145.-2. The family [146]-151.-3. Position of women [152]-168.-4. Education and learning (1691-174.-5. Arts and sciences (175)-191.-6. Religious conditions [192]225.--7. Manners and customs. [226]- 242.-Section 5. Geographical material in the Jain canons. General outlook (245)-247.-1. Jain conception of the world (248-249.2. The Jain Aryan countries [250)-256.-3. Mahavira's itinerary (257)-262.-4. Geographical lexicon. [2631-366.-Section 6. Some important kings and dynasties. Introduction (369).-1. Sixty-three great men 371-76.-2. Kings and rulers (377)-400.Retrospect (401) 403.- Index (405) 420. Map: India at the time of Mahavira (500 BC) facing p. 252. Map: Places visited by Mahavira (500 BC) facing p. 256. Hindi translation published Varanasi, 1965. 2nd. revised and enlarged edition 1984. ANU BL1321.1.J3 1949 Law, Bimala Churn. Some Jaina canonical sutras. Bombay: Bombay Branch Royal Asiatic Society, 1949. xv, 213 p. ; 24 cm. (Bombay Branch Royal Asiatic Society Monograph ; no. 2). Contents: Author's note [v]. - Introduction /E. J. Thomas (vii)-viii.-Bibliography six 28
Page #48
--------------------------------------------------------------------------
________________ Complete editions xi.--Chapter 1. Jaina canon [1]-6.--2. Acaranga sutra 7-12.-3. Sutrakstanga [13]-24.4. Sthananga (25)-27.-5. Samavayanga [28-30.6. Vyakhya-prajnapti [31]-37.-7. Jnatadharmakatha [38] 42.-8. Upasakadasa [43]-46.-9. Antakrta-dasanga [471-54.10. Anuttaraupapatikadasa (55)-56.-11. Prasna-vyakaranani [57]-63.-12. Vipaka (64) 66.-13. Aupapatika [671-73.-14. Rajaprasniya [74]-77.-15. Jivajivabhigama [78]81.-16. Prajnapana [82]-83.-17. Jambudvipaprajnapti [84]-85.--18. Nirayavali [86]87.-19. Nisitha and Mahanisitha (88)-95.-20. Kalpa sutra 1961-103.-21. Nandi sutra and Anuyogadvara [104]-107.-22. Uttaradhyayana sutra (108)-146.-23. Avasyaka [147]-150.-24. Dasavaikalika [151]-156.-25. Tattvarthadigama sutra [157]-168.Appendix 1 Vividhatirtha-kalpa [169]-185.--Appendix 2 Principles of Jainism (186)210.-Index [211]-213. "In this monograph I have tried to present a critical account of the principal Jain canonical texts in the light of my comparative study of both Buddhist and Jain texts." "In the first chapter I have given a general account of the Jain canon, and in the following chapters a detailed treatment of some of the important Jain sutras has been made." [Author's note] "Jainism in fact on the literary side shows a much greater development than what is to be seen in the Buddhist texts." [E. J. Thomas, Introduction viii). ANU BL1310.L3 1952 *Sandesara, Bhogilal Jayachandbhai, b. 1916? Jaina Agamasahityamam Gujarata /Bhogilala Ja. Sandesara. Avrtti 1. Amadavada : Gujarata Vidyasabha, 1952. lii, 262 p. ; 22 cm. (Setha Punamacanda Karamacanda Kotavala-granthamala, gran. 1.; Setha Bholabhai Jesingabhai Adhyayana-Samsodhana Vidyabhavana Samsodhana granthamala ; granthanka 8.). (CRL catalogue] Gujarat as portrayed in Jaina Agamic literature; a study. Kohl, J. F. Einige Bemerkungen zur Zahlensymbolik und zum Animismus im botanischen System der Jaina-Kanon. In Studia Indologica : Festschrift fur Willibald Kirfel zur Vollendung seines 70. Lebensjahres / herausgegeben von Otto Spies. Bonn: Selbstverlag der Oriental ischen Seminars der Universitat Bonn, 1955.375 p. ; 21 cm. (Bonner Orientalistische Studien. Neue Serie. Band 3). p. 125-35. ANU PK 102.Z5K5 1955 1964 Vijaya Muni. Agama aura vyakhya-sahitya/lekhaka Vijaya Muni; Muni Samadarsi Prabhakara. Agara : Sanmatijnana-pikha, 1964.97 p. ; 24 cm. (Agama-sahitya-ratna-mala; 9). Contents: Agama-sahitya : eka anucintana / Muni Samadarsi Prabhakara 1-52.Vyakhya-sahitya : eka parisilana / Vijaya Muni 53-97. ANU BL1310.V5 1964 Jaina, Jagadisacandra. Jaina Agama sahitya mem Bharatiya samaja (500 B.C.-1000 A.D.). Varanasi: Caukhamba Vidyabhavana, 1965. 20, 620 p. ; 21 cm. Hindi translation of the 1947 work listed above. Univ. of Poona Q31:21:90Y1 / 152J5 / 129693 1965 1966 Jainagama-nirdesika : paintalisa Jainagamom ka visaya-nirdesana / sampadaka Muni Kanhaiyalala 'Kamala'. Dilli : Agama Anuyoga Prakasana, Vira samvat 2492. Vikrama samvat 2023. Isvi san 1966. 25, 968 p. ; 19 cm. Contents: Vijnapti.[4]. Jainagama-nirdesika Agama-suci (5).-Visaya-nirdesana mem prayukti Agamom ki praityam (list of editions analysed to create this directory] [61-7.Prastavana-prabhavana [9]-25.- [Analyses) [11 Anga agamas] 1-526 [12 Upanga agamas) 537-755.- [4 Mula agamas) 757-843.- [4 Cheda agamas) 845-916.-[10 Prakirnakas) 919-940.- Pindaniryukti. 941-959.-Parisista 1 Maha Nisitha sutra ka visaya-nirdesana 961-968. ANU BL1312.9.K34 1966
Page #49
--------------------------------------------------------------------------
________________ 1969-91 *Agama aura tripitaka; eka anusilana / lekhaka Muni Nagarajaji ; sampadaka Muni Mahendrakumaraji Prathama' (tatha) Muni Mahendrakumaraji 'dvitiya'; bhumika / E. Ena. Upadhye ; Eka avalokana / Sukhalalaji Sanghavi. I. samskarana. Kalakatta : Jaina Svetambara Terapanthi Mahasabha, 1969-91. 3 v. ; 25 cm. (Univ. of Chicago library catalogue] Contents: 1. Itihasa aura parampara-2. Bhasha aura sahitya-3. Tattva, acara, va kathanuyoga. Parts of v. 1 chapter 14 published in 1974 as King Bimbisara and king Ajatasatru....v.1 translated into English 1986. 1974 King Bimbisara and King Ajatasatru in the age of Mahavira & Buddha / by Muni Nagraj; foreword by Ramesh Chandra Pandey ; translated by Muni Mahendra Kumar 'Dviteeya.' Ladnun, Rajasthan : Agama & Sahitya Prakashan, Jaina Vishva Bharati, 1974. viii, 90 p. ; 18 cm. Contents: 1. Srenika Bimbisara 1-37.-2. Ajatasatru Kunika (38)-74.-Bibliography 7582.-Index [83]-90. Translation of selections of v. 1 of Agama aura Tripitaka 1969-91. ANU PAMPHLET DS451.9.B55N3313 1977 Devendra, Muni. Jaina agama sahitya : manana aura mimamsa : Jaina vanmaya ka paricayatmaka adhyayana. 1. samskarana. Udayapura : Sri Taraka Guru Jaina Granthalaya, 1977.32, 768 p. ; 23 cm. ANU BL1310.4.D48 1977 1978 K. K. Dixit. Early Jainism. Ahmedabad : L. D. Institute of Indology, 1978. 8, 99 p. ; 25 cm. (LD series ; 64). Contents: Foreword/Nagin J. Shah. [3].--Bibliography (4).--Preface / K. K. Dixit (5)6.--Table of contents [71-8.-Chapter 1. Some noteworthy features of the Jaina speculation as occuring in Acaranga I and Sutrakstanga I [1]-21.-2. A historical evaluation of Uttaradhyayana and Dasavaikalika. [22]-33.-3. Sutrakstanga II : a historical evaluation. (34)-41.-4. The four old Chedasutras (AyarDas., BrhKapp., Vava., Nis.]. [42]-53.-5. Acaranga II. [54]-61.--The five Anga texts of the form of a storycollection [Naya., Uvas., Antag., Anuttaro., Viva.] [62]-75.--7. Prasnavyakarana (76)80.-8. Rsibhasita [81]-85.-9. A special relevance of [the] Suttanipata for Jaina studies 186-92.-Index 1. Sanskrit and Prakrit terms. [93]-96.-Index 2. Names of persons, works etc. [97]-99. ANU BL 1351.2.D53 1978 *Indranandi, 10th cent. Srutavatara ani Srutapancamikriya. 1.fi.c. 2.) avrtti. Solapura : Jaina Samskrti Samrakshaka Sangha, 1978. 6, 49 p. ; 20 cm. (Jivaraja Jaina granthamala). (CRL catalogue In Marathi and Sanskrit. On the history of Jaina canonical literature; includes a manual for the worship of Sarasvati, goddess of learning, according to Jaina ritualism. 1981 *Deo, Shantaram Bhalchandra. Jaina canonical literature : an appraisal. Ist ed. Mysore : Dept. of Jainology and Prakrits, University of Mysore, 1981. vi, 41 p., [1] leaf of plates : port. ; 23 cm. (Department of Jainology and Prakrits series ; 4). (CRL catalogue "Dr. A. N. Upadhye memorial lecture series, 1." "Lecture 1" (p. 1-13): Dr. A. N. Upadhye and his contribution to Jaina studies. 1983 *Malvania, Dalsukh Bhai. Jainagama aura Palipitakagata kucha samana visayom ki carca. Poona, India : Bhandarkar Oriental Research Institute, 1983. xvii, 51, [1] p. ; 23 cm. 1984 Jagdishchandra Jain. Life in ancient India as depicted in the Jain canon and commentaries : 6th century BC to 17th century AD. New Delhi : Munshiram Manoharlal, 1984. xxiv, 507 p.; 22 cm. 30
Page #50
--------------------------------------------------------------------------
________________ Complete editions Contents: Preface to the second edition (xi)-xv.-Preface to the first edition [xvii]-xix.Abbreviations xxi-xxiv.- Section 1. Introduction to the Jain canon. Chapter 1. The history of the Jain sangha (3)-27.-2. The Jain canon [28]-41.-3 The antiquity of the canon. [42]-60.-Section 2. Administrative organisation. Introduction [62].-4. Central administration (63)-77.-5. Administration of justice. (78)-81--6. Crime and punishment [82]-92.--7. Military organisation [93]-103.-8. Fiscal administration [104]-107.-9. Local government [108]-110.-Section 3. Economic aspects. Introduction [112].-10. Production (113)-145.-11. Distribution [146-147.-12. Exchange [1481-163.-13. Consumption [164]-182.-Section 4. Social conditions. Introductory [184]--14. Social organisation (185)-193.-15. The family (194)-200.-16. Position of women [2011-222.17. Education and learning (223)-230.-18. Arts and sciences (231)-260.-19. Manners and customs. [261-284.-Section 5. Religious conditions. Introduction (286).-20. The Samanas [287]-311. 21. Other schools and sects (312)-318.-22. Popular deities [319]330.-Section 6. Geographical material in the Jain canon. Introduction (332)-334.-23. Jain conception of the world (335)-336.-24. The Jain Aryan countries (3371-343.-25. Mahavira's itinerary (344)-349.-26. Geographical lexicon. (350)-432.--27. Non-Aryan countries. [433)-439-Section 7. Important kings and dynasties. Introduction (442)-443.28. Sixty-three great men (444) 447.-2. Kings and rulers (448)-473.-Retrospect [4741478.--Bibliography (479)-487.--Index (excluding the new sections, 6 and 7] [488)-507.Errata (509-10). Map: Places visited by Mahavira (500 BC) facing p. (344). Map: India at the time of Mahavira (500 BC) facing p.[350). First edition 1947. Hindi translation published 1965. RW 1986 Nagraj, Muni, Agama and Tripitaka : a comparative study: a critical study of the Jaina and the Buddhist canonical literature = Agama aura Tripitaka : eka anusilana / English version by Mahendra Kumarji and K. C. Lalvani , edited by Bhupendra Swarup Jain and Raghunatha Sarma. New Delhi : Today & Tomorrow's Printers and Publishers, 1986-< >. v. <1->; 25 cm. Contents v. 1: History and tradition : Prastavana (1985) / Muni Nagaraja (vl-vii.A Review / Sukhlala Sanghvi (ix)-xvi.-Introduction to the first Hindi edition (1969) / Muni Nagraja xvii)-xxiii. Chapter 1. Mahavira and Buddha 1-4.-2. Contemporary religious teachers 5-24.-3. Gosalaka 25-58.-4. Chronology 59-176.-5. Previous births. 177-87.-6. Birth and initiation 188-235.-7. Spiritual exertions 236-49.-8. Hardship and forbearance 250-65.-9. Omniscience and enlightenment 266-71.-10. The monastic order and its expansion 272-347.-11. Monks and nuns 348-68.-12. Leading followers (Upasakas) 369-419.-13. Defiant disciples. 420-39.-14. Follower kings 440-532.15. Liberation 533-60.-16. Wanderings and monsoon camps 561-69.-17. The Niganthas and Nigantha Nataputta in the Tripitakas [sic] 570-621.-18. Codes and books on conduct and discipline 622-56.--Appendix I. Nigantha and Nigantha Nataputta in Tripitakas : original Pali 659-735.-2. Bibliography 739-59.--Literary gems by the same author [761]-762. Planned in three volumes I. History and tradition II. Literature and teachings. III Philosophy and ethics (p. xvii). Original in Hindi published in 3 vols, 1969-91. ANU BQ4610.J3/N24/ 1986 v. 1 *Jaina, Komala. Jaina Agama mem nari. Devasa, Madhya Pradesh: Padmaja Prakasana, 1986. 15, 263 p. ; 25 cm. 1986 1991 1992 Durch Entsagung zum Heil : eine Anthologie aus der Literatur der Jaina : ausgewahlt, aus dem Prakrit und Sanskrit ubersetzt und eingeleitet/ von Adelheid Mette. Zurich : Benziger Verlag, 1991. 195 p. ; 19 cm. ANU BL1310.32.G4 D87 1991 Seminar on Jaina Agama (1986: Ahmedabad, India) *Seminar on Jaina Agama = Jaina Agama sahitya / editor K. R. Chandra. Ahmedabad : Prakrit Jain Vidya Vikas Fund, 1992. 19,304 p. ; 22 cm. (Vidya Vikas Fund; v.9. Shreshti K. L. Smarak Nidhi ; v. 7). [DK 97116. DK listing, Recent Sanskrit, Prakrit and Pali publications from India CIR-1586 / 1996-97, item 243] 31
Page #51
--------------------------------------------------------------------------
________________ 0.4 COLLECTED EDITIONS OF COMMENTARIES 1989 Niryukti-sangrahah / Bhadrabahusvamiviracitah ; sampadakah samsodhakas ca Srijinendrasuri. Prathamavrttih. Lakhabavala, Santipuri, Saurastra : Sri Harsapuspamrta Jaina granthamala, Vira sam. 2515. Vikrama sam. 2045. San 1989. 20, 600 p. ; [1] plate ; 19 cm. (Sri Harsapuspamsta Jaina granthamala). Contents: Alpa vaktavya / Jinendrasuri [3]-5.--Sanksipta kramah 6.-Anukramah 7-13.-Suddhipatrakam [14]-20.-1. Avasyakaniryuktih. 1-189.-2. Srimati Oghaniryuktih (190)-265.-3. Sripindaniryuktih [266-327.-4. Sridasavaikalika-sutraniryuktih [328]-364.-5. Sriuttaradhyayanasutra-niryuktih 365-419.-6. Sri Acaranganiryuktih 420-454.--7. Sri Sutrakrtanganiryuktih (455)-475.-8. Sridasasrutaskandhaniryuktih [476]-481.-9. Paryusanakalpadhyayananiryuktih 481-490.-10. Niryukti-gathanam akaradikramah (491)-600. "750 Pratayah." ANU BL1310.4 B432 1989 1995 The Nijjuttis on the seniors of the Svetambara Siddhanta : Ayaranga, Dasaveyaliya, Uttara jjhaya and Suyagada : text and selective glossary/Willem B. Bollee. Stuttgart : Franz Steiner, 1995. ix, 197 p. ; 24 cm. (Beitrage zur Sudasienforschung Sudasien-Institut Universitat Heidelberg ; Band 169). Contents: Ayaranga Nijjutti 1-27.--"Appendix: Schubring's selection of words from the notes to his Worte Mahaviras (numbers refer to pages)." (about 150 words.] 27-29.Dasaveyaliya Nijjutti 31-73. [Based on editions of Leumann (1892), who worked from MSS, and DLP [Dasave.1918b), the text in the latter edition was used for the 1989 Niryuktisangrahah text).--Uttarajjhaya Nijjutti 75-117.-Suyagada Nijjutti 119-36.--Glossary 137-79. Bibliography 181-93. Corrigenda for Materials for an edition and study of the Pinda- and Oha-Nijjuttis ... 1994 194-97. Reviews: Herman Ticken, Asiatische Studien = Etudes asiatiques 1996 (681)-683; Paul Dundas, BSOAS 60 (1997) 152-53. RW 0.5 STUDIES OF COMMENTARIES ON CANONICAL WORKS 1934-35 Kapadia, H. R. The Jaina commentaries ABORI 16 (1934-35) 292-312. 1976 Herman Tieken. Textual problems in an early canonical Jaina text WZKS 30 (1986) 5-25. 1977 Alsdorf, Ludwig. Jaina exegetical literature and the history of the Jain canon. In, Mahavira and his teachings/ editorial board A. N. Upadhye, Nathmal Tatia [et al). Bombay: Bhagavan Mahavira 2500th Nirvana Mahotsava Samiti, 1977. iv, 462 p. ; 25 cm.; p. 1-8. 1991 Khadabadi, B. K. *Reflexions on the Jaina exegetical literature. In. Aspects of Jainology v. 3: Pt. Dalsukh Bhai Malvania Felicitation volume 1 / editors M. A. Dhaky; Sagarmal Jain. Varanasi: P. V. Research Institute, (1991), p. 27-33. [Bruhn 1996, 51] 0.6 DICTIONARIES AND INDEXES RELEVANT TO THE CANONI 1880 Hemacandra (1088-1172). *[Desinamamala / edited with critical notes by R. Pischel). Bombay 1880.(Bombay Sanskrit series ; no. 17). Second edition 1938. *Jaina siddhanta pravesika / Gopal Dasji Baraiya, 1909. [JL 3, x] 1909 11 The only English to Prakrit dictionary I have traced is by H. R. Kapadia The Student's English-Paiya dictionary with three appendices (1941, xii item 38). 32
Page #52
--------------------------------------------------------------------------
________________ Complete editions 1910-34 *Vijayarajendra12 Abhidhanarajendrah : kosah : sa ca Srisarvajnaprarupita-gana dharanirvatitadya ''svinopalabhyamana 'sesasutra-tadvrtti-Bhasya-Niryukti-Curnyadinihitasakaladarsanika-Siddhantaitihasa-Silpa-Vedanta-Nyaya-Vaisesika-Mimamsadipradarsitapadarthayukta 'yuktatvanirnayakah : brhadbhumiko-podghata-PraktavyakrtiPraktasabdarupavalyadipari istasahitah/Srimadvijayarajendrasurisvara-viracitah; MuniSridipavijaya-Sriyatindravijayabhyam samsodhitah. Ratalama : SrijainasvetambarasamstaSanghena, Srivira samvat 24362461]. Srirajendrasuri samvat 428]. Srivikramabdah 1967[1991]. Khristabdah 1910-34. 7 v. ; ports. ; 34 cm. Contents v. 1 (Srivira samvat 2440. Srirajendrasuri samvat 7. Srivikramabdah 1970. Khristabdah 1913). [4], 15, 35, 13, 54, 8, 18, 893 p.: (plate Vijayarajendra).--Abharapradarsanam [1-4]. Granthakarta ka sanksipta jivana-paricaya (1)-15.-plate listing Vijarajendra's 55 books' from 1846-97; verso gives a sample of his handwriting (subhamyusaya)]. -Sri Saudharma Brhattapagachiya pattavali.-plate of Vijayadhanacandra (1839-1920)], pupil of Vijayarajendral.-Prastavana [1]-18.-Akara se kakara taka sabdom ke antargata kosthaka mem aye hue sabdom ki akaradi krama se suci 19-27.-Avasyaka katipaya sanketa [included analysis of the Svetambara 'canon'] 2835.-Upodghatah [1]-13.-(dedicatory verse to Vijarajendra).-Abhidhanarajendraparisistani. [1.] Siddhahemasabdanusasanam Adhyaya 8 [1]-54.-2. Atha PrakstaSutranam akaradyanukramanika (1)-8,-3. Sanksiptaprakstasabdarupavalih (1)-18.Abhidhanarajendrah'a'- 'ahohiya' [1]-893. Contents v. 2 (Srivira samvat 2436. Srirajendra suri samvat 4. Srivikramabdah 1967. Khristabdah 1910) 4, 1107, [ie. 1187) p.: (plate of Vijayarajendra and Vijayadhanacandra-Prastavana [1]-4.-'a'-'ahapannatta' [1]-1107 [ie 1187).-Abharapradarsanam [1-4]. Contents v. 3 (Srivira samvat 2431. Srirajendrasuri samvat 9. Srivikramabdah 1971. Khristabdah 1914) 15, 1362, p.: (plate of Vijayarajendra plate of Vijayadhanacandra) Abhara-pradarsanam [1]-[4].--Tstiyabhagaprastavah (1)-15.- 'e'-'choha' [1]-1362. Contents v. 4 (Srivira samvat 2440. Srirajendrasuri samvat 7. Srivikramabdah 1970. Khristabdah 1913) 1.51363)-2777 p.: (plate of Vijayarajendra-plate of Vijayadhanacandra -Abhara-pradarsanam [1]-[4).-Caturthabhaga-ghantapathah 11-17. Granthanirmanakaranam/ Srimadupadhyayamohanamunayah 17.-'ja'-'nomaliya' 17, [1363)-2777. Contents v. 5 (Srivira samvat 2448. Srirajendrasuri samvat 15. Srivikramabdah 1978. Khristabdah 1921): (plate of Vijayarajendra)--Abhara-pradarsanam [1-4].-plate of Vijayadhanacandra) -- 'pa'-'bhola' [1]-1627. Contents v. 6 "Punarmudrita" (Srivira samvat 2461. Srirajendra suri samvat 28. Srivikramabdah 1991. Khristabdah 1934): (plate of Vijayarajendra-Abharapradarsanam [1-4].-plate of Vijayadhanacandra)--'ma'-'vrasu' [1]-1468. Contents v. 7 "Punarmudrita" (Srivira samvat 2461. Srirajendrasuri samvat 28. Srivikramabdah 1991. Khristabdah 1934): (plate of Vijayarajendral-Abharapradarsanam [1-4].-plate of Vijayadhanacandra-sa-hva' [1]-1250.-Prasasti 1250-51. Prakrit and Sanskrit; introductory matter in Hindi. Vols. 6-7 edited by Bhupendrasuri and Yatindravijaya. Spine title: "Jain enclyclpaedia." The presence of the plate of Vijayadhanacandra (1839-1920) in the ANU set, even though some of the title-pages are dated before 1920, indicates that some of the volumes have been bound later. The plates are all printed "Bhavanagara Sri Mahodaya Presa." v. 2-4 have a small red sticker pasted on the first fly leaf (top right hand corner) "The 12 For details about Vijayarajendra (3 December 1827-1906), his life, works, lineage etc., see Srimad Rajendrasuri smaraka-grantha / samyojaka Yatindrasuri ; sampadaka-mandala Agaracandaji Nahata, Dalasukhabhai Malavaniya, Daulatasimha Lorha Aravinda', Balabhai Viracandra 'Jayabhikhu', Aksayasimha Dangi. Ahora (Maravara-Rajasthana): Sri Saudharmabrhattapagacchiya Jaina Svetambara Sri Sangha, Vira samvat 2482: Vikrama samvat 2013: I. san 1957: Saka samvat 1878: Rajendra samvat 50.26 cm. 39,875 p., [28] leaves of plates : ill. ; 26 cm. "Srimad Rajendrasuri-ardhasatabdi mahotsava ke avasara para" t.p. "Pratiyam 1000." ANU PK 1201.25 V5 1957. Useful essays are: Gurudeva-sahitya-paricaya p. 87-94: Sarasvatiputra Srimad Vijayarajendrasuri 135-43; and Srisaudharmabthattapagacchiya gurvavali 144-53. 33
Page #53
--------------------------------------------------------------------------
________________ Encyclopaedia is bound and covered by the Mahodaya Press, Bhavanagar." The plates may have been added to the volumes during binding after the completion of printing. ANU LARGE BOOK PK 1223.15 v. 1-7. Reprint 1985. * Abhidhanarajendrah = Abhidhanarajendrah : Prakrit Magadhi, Sanskrit / Vijayarajendra Suri, Delhi, India : B. R. Pub. Corp., New Delhi, India : Distributed by D. K. Publishers Distributors, 1985. 7 v.: ports. ; 29 cm. * Jaina gem dictionary / J. L. Jaini. Arrah, 1918. [JL 3, x] Attempt to give uniformity to the English equivalents of Jain technical terms, based on the 1909 Jaina siddhanta pravesika (JSK 1, 1). 1918 1923-38 *An illustrated Ardha-Magadhi dictionary: literary, philosophic, and scientific, with Sanskrit, Gujrati (sic), Hindi, and English equivalents, references to the texts & copious quotations/ by Ratnachandraji ; with an introduction by A. C. Woolner. Indaur : Sri Svetambara Sthanakavasi Jaina Kanpharansa, I. san 1923-38. Vira samvat 2449-64. Reprint 1977. An illustrated Ardha-Magadhi dictionary : literary, philosophic, and scientific, with Sanskrit, Gujrati, Hindi, and English equivalents, references to the texts & copious quotations / by Ratnachandraji ; with an introduction by A. C. Woolner. Tokyo : MeichoFukyu-kai, 1977.5 v. ; 24 cm. Contents v. 1: Introduction/A. Woolner [il-viii. Skeleton grammar of Ardha-Magadhi [/Banarsi Das Jain) ix-xxxii.-[folding chart) Alphabetical list of works consulted with a list of abbreviations used in the dictionary = Kosantargata sutroni yadi tatha sanketono khulaso xxxiii.-Grammatical abbreviations and their equivalents xxxv.-A guide to transliteration xxxvi.--Preface / Sardarmal Bhandari [xxxviil-xlvi.--Publisher's note Ixlviil-xlviii.- Translator's note / Pritamlal N. Kachhi (xlvix)-1.-Hints for the study of this dictionary [li]-liv.-Prastavana (=Hindi translation of Woolner's Introduction) [1]6.-Prakasaka ki ora se do sabda (=Hindi translation of Preface][71-14.-Kosa dekhane ke niyama (15)-18.-Citra-suci 19.--Ardhamagadhi-kosa 'a'-'ahohia' (1)-511. Contents v. 2 (I. san 1927. Vira samvat 2453): (photo of Kesarichand Bhandari (18711925)].-Citra-suci (1).-Publisher's note [2].--'a'-'nhusa' (1)-1002. Contents v. 3 (I. san 1930. Vira samvat 2456): Publisher's note [1]. Prakasakonum nivedana (3).-'ta-bohiya' [1]-701. Contents v.4 (I. san 1932. Vira samvat 2458): Publisher's note [1]-Citra parisista [4].'bhai'-'holavlaya' [1]-912.-Citra parisista : bhaga 2 (uvasagga / kausagga / nakkhattamandala)--bhaga 3. (tamukkaya / tavakkhetta / titthayara / disavidisa / divasamudda / nandisara / nirayavasa/pamana Suddhi patraka = Correction[s] v. 14 1-103 [reduced size in reprint?]. Contents v. 5 (Vira samvat 2464. Vikrama samvat 1995. I. 1938): Sampadakiya vaktavya/ Muni Ratnacandra (1)-4.-Prakasaka ka nivedana : abhara pradarsana [51-6.Maharastri va desya-Prakstantargata pramanagranthom (repharanseja) ke sanketom ka vivarana [71-14.--'ai'-'holia' [1]-665.-Desi-Praksta kosa [from the Desinamamala and earlier volumes of this dictionary] 'aakha'-'hola' (665)-857.-Suddhi-patra Devana gari) 1-12.-Errata (13)-21.-Postface about the reprint edition, in Japanese / Takahisa Koseki, 1-2). Vols. 2-4 have title on added t.p.: Sacitra Arddha-Magadhi kosha. Vol. 5 has title: The remaining part of Ardha-Magadhi quadrilingual dictionary, or, Maharashtri and Deshya Prakrit dictionary; title on added t.p.: Parisishta Arddha-Magadhi kosha, evam, Maharashtri va Desya Prakrta kosha. (Shri-Gulab-Vir-granthamala ; ratna 21). About 50 000 words, collected from 49 texts consisting of nearly the whole of the Svetambara "canon" together with all supplementary works. Manuscripts and the editions of Ray Dhanpatisimha Bahadur were indexed for the entries in v. 1-4 (Introduction, 1, i). A more complete list of sources is given in the fifth volume which is a separate sequence, these were drawn from DeNa Ma., PSM and other works In the postface the efforts to obtain a good copy of the text are described, having been unsuccessful the copy of Professor Matsunami Seiren was taken apart page by page, 34
Page #54
--------------------------------------------------------------------------
________________ each page was carefully repaired before being photographed. (See the brief notice about the reprint by J. W. de Jong IIJ 21 (1979) 213). ANU MENZ ASIAN REFERENCE PK1256.R3 1977 v.1-5 Reprint. 1988. *An illustrated Ardha-Magadhi dictionary: literary, philosophic, and scientific, with Sanskrit, Gujrati [sic], Hindi, and English equivalents, references to the texts & copious quotations / by Ratnachandraji; with an introduction by A. C. Woolner. Varanasi, India : Amar Publication; Delhi: Distributor, Bharatiya Vidya Prakashan, 1988. 5 v. : ill. ; 25 cm. 1924-34 *Brhat Jaina sabdarnava / B. L. Jain; completed by Shital Prasadaji. 1924-34. 2 v. [JSK 1, 1] v. 1 Barabanki. v. 2 Surat. A helpful source book (JSK 1,1). 1928 1931 1938 Complete editions Paia-sadda-mahannavo=Prakrta-sabda-maharnavah/karta Haragovindadasa Trikamacanda Setha. Calcutta: Pandit Hargovind Das T. Sheth, samvat 1985 [1928]. [97], 1278 p. Reprints. Varanasi: Prakrta Grantha Parisad, 1963. 64, 952, 3 p. ; 27 cm. (Prakrit Text Society series; 7). ANU ASIAN REFERENCE PK1223.S5 Dilli: Motilal Banarsidass, 1986. Abridged edition K. R. Candra, 1987, see below. The Desinamamala of Hemacandra / edited with the help of two MSS. and Pischel's edition of 1880 with an introduction, index of the text and commentary, and English translation of the text... by Muralydhar Banerjee. Calcutta: University of Calcutta, 1931. iv, 6, 258, 72 p. [Part 1: text with readings, introduction and index of words. No further parts published.] [de Jong] / ANU MENZIES MICROFORM PK1223.H45 ANU LARGE BOOK PK1223.S5 1986 The Desinamamala of Hemachandra / edited with critical notes (1880) by R. Pischel; with introduction, critical notes, and glossary by Paravastu Venkata Ramanujaswami. 2nd ed. Poona : Bhandarkar Oriental Research Institute, 1938. 31, 345, 120 p. ; 25 cm. (Bombay Sanskrit series; no. 17). Contents: Introduction / P. V. Ramanujaswami, 1 Feb. 1926 and 11 Nov. 1937 (to the second edition) [1]-26.- Introduction (to the first edition) / R. Pischel 15 March 1880. [27]-31.-Desinamamala [1]-345.-Glossary [index to the preceding text, with English definitions] [1]-92. Appendices 1. Words considered as desyas by others but as tadbhavas by Hemacandra [93]-98.-2. Alphabetical list of verbal substitutes taught by Hemacandra in his grammar and in this work [99]-118.-3. Alphabetical list of particles taught by Hemacandra in his grammar and in this work [119]-120.- Corrections [ref. for verse emendation incorrect] [121] Sources 1880: Pischel's text based on nine MSS:-A. Bikaner No. 271, samvat 1549, text only; B. Vadhvan no. 724, 90 (ie 91) folios, text and cty, probably 18th cent. [BORI no. 724 of 1875-76];-C. modern copy of a MS from Ahmedabad, prepared for Buhler. No. 184, 315 f., text and cty., original dated samvat 1587 [original now BORI 159 of 1881-82]; D. from Pali (near Jodhpur), Marwar, no. 270, 32 f., text and cty, incomplete;E. from Ahmedabad, belonging to Buhler, 20 f., text only, colophon [samvat?] 1575, incomplete [BORI 281 of 1880-81];-F. MS from Limadi, collated by Buhler's Pandits with C., close to B; G. from Bikaner, no. 271, 46 f., best text of the cty, damaged; H. Ahmedabad (government collection purchase 1879), 62 f., samvat 1628, "carelessly written and of no value at all.";-I. MS belonging to Pandit Bhagvanlal Indraji, 86 f., text and cty, archetype of G, high quality. Described on pages 27-28 (Introduction of 1880). "There are not many words in which all the MSS agree in the use of [the letters ca, va and ba, ttha and ccha, tha and dha, bbha and jjha, ha, ddha, tta, ttha, ddha]. In order to ascertain the correct reading I was very often obliged to have recourse to etymology. Where that failed me, I had nothing to guide me but the best MS, which, however, is by no means quite trustworthy" (Pischel, Introduction, p. 28). 35 Sources 1926: "Seven MSS... have been placed at my disposal by the Bhandarkar Oriental Research Institute, Poona-"(1) [857 of 1886-92] is a recent copy and full of mistakes";
Page #55
--------------------------------------------------------------------------
________________ (2) B.,--(3) E. and--(4) original of C., were utilised by Pischel and are described above; (5) X. BORI 856 of 1886-92,45 (ic 45) f., text and cty;--(6) Y. (BORI 397 of 1895-98,21 f., samvat 1636, text alone;--(7) Z. BORI 438 of 1882-83, 60 folios, text and cty, incomplete. (Described on p. 1-2 of P. V. Ramanujaswami's introduction.) "The text of the Desinamamala may be considered to have been settled with considerable purity. I have, therefore, allowed the text to remain as it stood in the first edition" (P. V. Ramanujaswami, p. 2). ANU PK 1223.H43 Reprint. 1989. Poona : Bhandarkar Oriental Research Institute, 1989. The main text is reprinted photographically, other portions however have been re-typeset, in some places this has altered pagination slightly. RW 1954-79 Alpaparicitasaiddhantikasabdakosah/ Acaryasrianandasagarasurisankalitah; sampadakau Kancanavijaya-Ksemankarasagarau ; sangrahakah Gunasagarah. 1. samskarana. Surat : Sresthi-Devacandalalabhai-Jainapustakoddharakosa, Virabdah 2480-2505. Vaikrama 'bdah 2010-38. Sakabdah 1876-99. Khristabdah 1954-79.5 v. ; 26 cm. (Sresthi-Devacandralalabhai-Jainapustakoddhara ; granthankah 101, 115, 116, 125, 126). Contents v. 1: Prakasakiya (1)-2. Sampadakiya vaktavya 3-8. Sanjnapatrakam [List of source books, listing all those edited by Anandasagara = Agamoddharaka] 9-11.--Patranka suca 12-15. = Suddhipatrakam (16). Sriagamoddharaka-stavah. [1]-24.-Alpaparicitasaiddhantikasabdakosah 'arka'-'ohabale' 1-237 p. v. 2: Virabdah 2490. Vaikrama 'bdah 2020. Sakabdah 1886. Khristabdah 1964. Contents: Prakasakiya (1-2).-- 12 plates of buildings of Setha Devacanda-Lalabhai-Jainavidyarthabhuvana in Gopipura, Surat, also of Anandasagara and Manikyasagara).-Svalpam [3]. - Sanjna patrakam [8)-10.-Patrankasuci (11)-14.-Suddhipatrakam (15)-16.-composite of photographs of Anandasagara, with caption "Sriagamoddharakastakam"][21].--Agama vataviksa [1] 4.-'kankatu kadesyah'-jhosetha [241] 455. v. 3: Virabdah 2495. Vikrama 'bdah 2025. Sakabdah 1891. Khristabdah 1969. Contents: Prakasakiya (5-6).-Prathama bhaganu sampadakiya vaktavya [71-8.- [Plate of Anandasagara Suri].-A 'Srialpaparicitasaiddhantikasabdakosa' mate have pachi .a. sai. sa.' evi sannano upayoga karase [9]-12.-Dvitiyabhagagatam svalpam 13-14.-Trtiya bhagasya yatkincit 15.-Patrankasuci (16)-19.- Suddhi-patrakam [1-6.-Sanjna patrakam 6-8.--'tankam-praudhr' 457-751). v. 4: Virabdah 2500. Vaikrama'bdah 2030. Sakabdah 1893. Khristabdah 1974. Contents: 'phandai'-vrihyudaka' 753-1026.Suddhi-patrakam 1027-31.-(series details) 1032. Contents v.5: Prakasakiya 5-6.[Introduction in Sanskrit 7-8.-Plate of Anandasagara).[Introduction in Gujarati] 9-11.-Yat kincit 12-15.-Sannapatrakam 16-26.---'saka'"hlasana' 1033-1213.-Parisista 1. (Supplementary entries) 1214-56.-2. Kalikalasarvajnasabdanusasanadivedacatustayavidhatr-Srihemacandracaryapranita-desyanamasangrahakaradi 1-56. This work lists occurrences of words in Agama texts and the glosses on them found in the commentaries. "Pratayah 500." ANU PK 1223.A62 1954 v.3, 4, 5 only [BORI, v.1 and 2 are photocopies, others original printings]; v. 1 RW 1962 Lexicographical studies in Jaina Sanskrit / by B. J. Sandesara and J. P. Thaker. Baroda : Oriental Institute, 1962. 241 p. ; 25 cm. (The M. S. University Oriental series; no. 5). Contents: Preface [1].-1. Prabandhacintamani of Merutungasuri (1305 AD) 1-40.-2. Prabandhakosa of Rajasekharasuri (1349 AD) [41]-101.-3. Puratanaprabandhasangraha [102]-231.-Addenda (232)-239.--Corrigenda (240)-241. ANU PK965.53 Reprinted from the Journal of the Oriental Institute 8-12. "Copies 250." 1962-69 *A comparative dictionary of the Indo-Aryan languages / R. L. Turner. London: School of Oriental and African studies, 1962-69. 1966 *Lesya-kosa / Mohanalala Banthiya, Sricand Cauradiya. Kalakatta, 1966. [JSK 1, 1] 36
Page #56
--------------------------------------------------------------------------
________________ Complete editions 1969 *Kriya-kosa / Mohanalala Banthiya, Sricand Cauradiya. Kalakatta, 1969. [JSK 1, 1] 1970-72 Prakrit proper names / compiled by Mohanlal Mehta and K. Rishabh Chandra ; edited by Dalsukh Malvania. Ahmedabad : L. D. Institute of Indology, 1970-72.2 v. ; 24 cm. (Agamic Index ; v. 1.) (L.D. series ; 28, 37). Contents v. 1: 12.488 p. Preface / Dalsukh Malvania. [3] 4.-Transliteration (5).--List of abbreviations [6]-12.-'Ali'-'Phenamalini' 1-488. Contents v. 2: Preface [1].--Bausa'-'Hottiya' 491-888.-Index / Ramesh Malvania [889)-1014. 8 000 proper names collected from the original canonical texts of the Svetambara Jains and from their printed Prakrit commentaries, that is the Niryuktis, Bhasyas and Curnis, but not from the Sanskrit commentaries (v. 1 Preface, p. 3). The printing follows the pattern set out in the Dictionary of Pali proper names. Sources outside the canonical works have only been consulted for geographical names. A dictionary of technical terms in Jaina canonical works was announced in the preface to v. 2. "1000 copies." ANU OS 3BL1310.A4 v. 1 and v. 2 1970-73 Jainendra siddhanta kosa / Jinendra Varni.13 Dilli : Bharatiya Jnanapitha Prakasana, Vira Ni. samvat 2496-99. Vikrama samvat 2027-30. San 1970-73. 4 v. ; 27 cm. (Jnanapitha Murtidevi Jaina granthamala : Samsksta granthanka 38, 40, 42, 44, 48). Contents v. 1: [1 plate, Murtidevi). General editorial / H. L. Jain, A. N. Upadhye (1-2). = Pradhana sampadakiya (3-4).- Prastavika /Jinendra Varni (5-6).--Sanketa-suci (78]. - Jainendra siddhanta kosa a-au [1]-503 p.- [Series details 1]-8. Contents v. 2: Vira samvat 2498. Vi. samvat 2028; A.D. 1971 : Sanketa-suci [98 abbreviated titles) (3-4).--Jainendra siddhanta kosa ka-na (1)-634. Contents v. 3 :Vira samvat 2498. V. samvat 2029. A. D. 1972 : (plate Murtidevi). Sanketa-suci [1-2].--Jainendra siddhanta kosa pa-va [1]-637.--[Series details 1)-8. Contents v. 4: Vira samvat 2499. V. samvat 2030. A. D. 1973 : (plate Murtidevi).Sanketa-suci (1-2).-- Jainendra siddhanta kosa sa-ha [1]-544. [Series details 1]-8. Compilation of definitions and technical terms, 6000 words, 21 000 topics are explained here (1,5), the Sanketa-suci list of sources is exclusively Digambara ANU PK965.V35 v. 1, 2, 3, 4 2nd edition of all volumes (1985-95), revised by Jinendra Varni (1921-83) himself, 360 new entries, v. 5 to be an index to all the volumes v.1 (2nd ed.) not held ANU. Contents v. 2 (Vira samvat 2512. Vi. samvat 2043; A.D. 1986): Prakasakiya prastuti : dvitiya bhaga, dvitiya samskarana (1-2).Sanketa-suci (98 abbreviated titles) (3-4). Jainendra siddhanta kosa ka-na [1]-635.- Parisista 637-40.--Bharatiya Jnanpith [publication list] 1-18). Contents v. 3 (Vira samvat 2513. V. samvat 2044. A. D. 1987): (plate Murtidevi. Sanketa-suci (1-2). - Jainendra siddhanta kosa pa-va [1]-629.-Parisista [631)-632-- [Series details 1)-8. v. 3: 3. samskarana 1993? (DK list CIR-1378/94-95, item 199) Contents v. 4 (Vira samvat 2515. V. samvat 2045. A. D. 1988): (plate Murtidevi). Sanketa-suci [1-2]. - Jainendra siddhanta kosa sa-ha [1]-542.-Parisista (543)-544. ANU BL1303.V3 1985 v. 2, 3, 4 only. Contents v. 5 (1995). Sabdanukramanika. DKS-753. DK listing, Recent Sanskrit, Prakrit and Pali publications from India CIR-1625 / 1996-97, item 104] 1972-79 Jaina-laksanavali: Jaina paribhasika sabda-kosa / sampadaka Balacandra Siddhantasastri. Dilli : Vira-Seva-Mandira, Vi. Ni. samvat 2498-99, Vikrama samvat 2028-36. San 1972- 79. 3 v. ; 27 cm. (Vira-Seva-Mandira granthamala ; granthanka 15). v.la-au: 15, 88, 312, 22 p. v. 2 Vi. Ni. samvat 2499. Vikrama samvat 2030. San 1973. 13 Jinendra Varni (1921-83).
Page #57
--------------------------------------------------------------------------
________________ kakva-pausnakala: 8, 313-730, 22 p. v. 3 Vi. Ni. samvat 2505. Vikrama samvat 2036. San 1979. Contents v. 1 a-au: Prakasakiya 2-4.-Granthanukrama (5)-6.-11 leaf of plates, Jugalakisora Mukhtara, Chotelala Saravagil--Foreword /Dayanand Bhargava [vii]-XDo sabda [11]-13.-Sampadakiya /Balacandra Siddhanta-Sastri [14]-15.-Prastavana [1]-85.-Praksta Sabdomki vikrti va una ka Samsksta rupantara / Balacandra SiddhantaSastri (86)-87.-Suddhi-patra [88].- Jaina-laksanavali [1]-312.-Laksanavali mem upayukta granthom ki anukramanika [1]-16.-Granthakaranukramanika [171-20.Satabdikrama ke anusara granthakaranukramanika 20-22.-Vira-Seva-Mandira ke upayogi prakasana (23). Contents v. 2 kakva-pausnakala: Prakasakiya [41-5.-Sampadakiya/Balacandra Sastri 16.-reviewers' opinions 7-8).-Jaina-laksanavali [313]-730.-Laksanavali mem upayukta granthom ki anukramanika [390 titles][11-18.-Granthakanukramanika (19122. Contents v. 3 prakaranasamajati-hrasva: Prakasakiya (includes photos of Jugalakisora Mukhtara, Balacandra Sastri, Chotelala Jain, Santirasada Jaina (4)-6.-Sampadakiya/ Balacandra Sastri [71-8.-Foreword / Jyoti Prasad Jain [ix]-xii.- Prastavana /Balacandra Sastri (1) 44. Prastavanagata visista laksya sabdom ki anukramanika (45).-Suddhipatra [46] 48. -- Jaina-laksanavali [729]-1218.--Isa grantha ke samyojaka (photo of Jugalakisora Mukhtara and short life details) [1219)-1220. "An authentic and descriptive dictionary of Jaina philosophical terms." ANU BL1303.537 1972 v. 1, 2, 3 ANU MENZIES LARGE BOOK PK965.844 v, 1, 2 only 1984 Ekarthaka kosa (samanarthaka kosa) = Ekarthaka kosa, a dictionary of synonyms/vacanapramukha Acarya Tulasi; pradhana-sampadaka Yuvacarya Mahaprajna; sampadaka Samani Kusumaprajna. Ladanum (Rajasthan): Jaina Visva Bharati, 1984.41, 396 p. ; 23 cm. Contents: Svakathya / Ladanum, 15-1-84, Acarya Tulasi, Yuvacarya Mahaprajna [6]. - Purovacana/Ladanum, 28-1-84, Nathamala Tatiya [9]-11.--Prastuti/1-2-84, Ladanum, Samani Kusumaprajna (13)-33.-Prayukta grantha-sanketa suci (35)-41.-Anukrama.Ekarthaka kosa [1]-160.-Parisista 1. Sabda-anukrama [an index of the preceding sections) [161]-271.-2 Visesa sabda-vivarana [273]-381.-3. Dhatu-anukrama [383]394.-Suddasuddhi patra (395)-396. A collection of definitions of Sanskrit and Prakrit words, mainly from canonical texts. ANU PK 1223.K87 1984 Review. Bansidhar Bhatt. *Vishveshvaranand Indological Review Series 1-3 (Hoshiarpur). 1983, 16 (260)-20 (264). [de Jong 1984 Nirukta kosa / vacana-pramukha Acarya Tulasi ; pradhana-sampadaka Yuvacarya Mahaprajna ; sampadaka Sadhavi Siddhiprajna, Sadhavi Nirvanasri. Ladanum (Rajasthan): Jaina Visva Bharati, 1984. 27, 370 p. ; 23 cm. Contents: Svakathya / Ladanum, 21-1-84, Acarya Tulasi, Yuvacarya Mahaprajna [6]. - Prakkathana / Nathamala Tatiya [8]-13.-Prastuti / 1-2-84, Bidasara, Sadhvi Siddhiprajna, Sadhvi Nirvanasri (15)-21.-Prayukta grantha-sanketa suci (23)-27.Anukrama.Nirukta kosa [1754 definitions 1-330.-Parisista 1. Krdantavyutpanna nirukta (208 definitions (333)-358.-2 Tirthankara-abhidhana nirukta (24 definitions] [359]-368.-Suddasuddhi patra (369-70). A collection of traditional definitions of Prakrit terms cited from Jain commentary works. Each entry is accompanied by a Hindi translation of the definition. ANU PK 1223.554 1984 1987 Review. Bansidhar Bhatt. *Vishveshvaranand Indological Review Series 1-3 (Hoshiar pur). 1983, 11 (255)-16 (260). [de Jong Prakrta-Hindi kosa : Sv. Pam. Haragovindadasa Trikamacanda Setha kita Paia-saddamahannavo ki kincit parivartita avrtti/sampadaka Ke. Ara. Candra. Ahmadabada: Praksta Jaina Vidya Vikasa Phanda, 1987. 14, 890 p. ; 24 cm. 38
Page #58
--------------------------------------------------------------------------
________________ Complete editions Omits Sanskrit (tatsama) words and is therefore an abridged version. ANU MENZIES NEW BOOKS COLLECTION +1 799 210 1988 Desi sabdakosa / vacana-pramukha Acarya Tulasi ; pradhana sampadaka Yuvacarya Mahaprajna ; sampadaka Muni Dulaharaja ; sahayogi Sadhvi Asokasri ; Sadhavi Siddhaprajna; Sadhavi Vimalaprajna; Samani Kusumaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2045. 1988. 66, 570 p. ; 23 cm. Contents: Asirvacana / Acarya Tulasi (5).-Purovak / Yuvacarya Mahaprajna [71-9.Bhumika / Nathamala Tatiya (11)-14. Sampadakiya (15)-51.-Prayukta grantha suci [53]-62.-Sanketa suci [63]-66.-Anukrama [67].-Desi sabdakosa [1]-439.-Parisista 1. Avasista desi sabda (443)-504.-2. Desi dhatu-cayanika (505)-570. Three parts: Desi sabdakosa includes 10 000 desi words used in the Agamas and their commentaries including Angavijja, Viy., AvCu., NandiCu., Nis Bha., NisCu., Vava Bha., BhKappBha., Paiyalacchinamamala, Kuvalayamala, Setubandha, etc. and grammar books (Sampadakiya, p. 38, 47). The first appendix gives 3 381 desi words from non-Agama texts and Apabhramsa literature, compiled from glossaries of published works, as well as PSM, words given in Trivikrama's Sabdanusasana and 193 words from the chapter on style in Nemicandra Sastri's Haribhadra ke Praksta katha sahitya ka alocanatmaka parisilana (1965) (for the titles of the works used see Sampadakiya, p. 48, for the list of editions used p. 53-62 (1st group)). The second appendix gives 1745 desi roots from Prakrit grammatical literature, including those from the Agamas and non-Agamic works (Sampadakiya, p. 22). ANU NBC 1 796 083 1992 Ippagumta, S. Camdu kosam : Prakrit:English dictionary. Ist ed. Delhi, India : Parimal Publications, 1992. xii, 217 p. ; 23 cm. A compilation of words in various Prakrits apparently taken from published editions of mostly non-canonical literary and grammatical works. The entries are in Roman script and the definitions are in English, some entries have abbreviated references to their sources, but there is no key to the abbreviations. The bibliography (p. 210-17) lists about 80 works consulted. At best this is a dictionary of very last resort. Named after the compiler's younger brother. ANU PK1225.167 1992 1993-<1998> A Comprehensive and critical dictionary of the Prakrit languages: with special reference to Jain literature. 1993-<1996>. General editor A[mrit). Msadhav]. Ghatage. Poona : Bhandarkar Oriental Research Institute. ; 29 cm. v. 1: 1993-96. vi, *25, xxxvi, 1-360 p. (a-anega-taranga) v. 2, fascicule 1: 1998. 361-512 (anegatalayara-annonnaruvavesa) Review: *Willem B. Bollee OLZ 90.1 (1995) 80-81 [BEI 11-12 (1993-94) 474). ANU LARGE BOOK PK1225.C66 1993 fasc. 1 & 2 only / RW 1994 *Bhayani, Harivallabh Chunilal, (b. 1917). Gujarati bhasano laghu vyutpattikosa/sampadaka Harivallabha Bhayani, sahayaka Urmi Desai. 1. avrtti. Gandhinagara : Gujarata Sahitya Akadami, 1994. 240 p. ; 22 cm. Gujarati, Prakrit, and Sanskrit (Prakrit and Sanskrit in Gujarati script); explanatory matter in Gujarati. Summary: Gujarati-Prakrit-Sanskrit etymological dictionary. A Pada index and reverse pada index to early Jain Canons : Ayaranga, Suyagada, Uttarajjhaya, Dasaveyaliya, and Isibhasiyaim / by Moriichi Yamazaki and Yumi Ousaka. Tokyo : Kosei Publishing Co., 1995. 537 p. 23 cm. RW 1995 39
Page #59
--------------------------------------------------------------------------
Page #60
--------------------------------------------------------------------------
________________ 1937 1941 1 ANGAS GENERAL WORKS Sriacarangadyekadasangyah Amgakaradi: 1 Sutradyakaradi 2 Sutradyankasuca 3 Laghubrhadvisayanukramau. Ratnapuriya (Ratalama): Srirsabhadevajikesarimalaji Svetambarasamstha, Virasamvat 2463. Vikramasamvat 1993. Kraistasan 1937. [141], 48, 161 p.; 12 x 27 cm. Contents: Angakaradyanukramadinam upodghatab/Anandasigara. Sriacarangadyekadasangyah sutratadgathadyakaradi 1-[141]. [Sriacaradyanganam brhati sutradyankasuddhih] 1-48.-[Laghuvisayanukramah] 1-14.- [Brhadvisayanukramah] 15-161. "Prata 500." ANU MENZIES BL1312.29.A6 1937 Sriagamiyasuktavalyadi: Agamiyasuktavali 1, subhasita 2, sangrahasloka 3, lokoktayah 4. Suryapuriya [Surat]: Srijainapustakapracarakasamstha, Vikramasamvat 2005 [1949]. 74 p.; 12 x 27 cm. (Sriagamoddharasangrahe bhagah 8). Contents: Agamiyasuktavali 1-48. -- Subhasita 49-50.- Sangrahasloka 50-51. - Lokoktayah 52-74. "Pratayah 250." Proofs checked by Muni Kancanavijaya and Muni Sriksemankarasagara. References to page and line, mostly for Agamodaya Samiti and Devacanda Lalabhai editions of the Agamas. ('Be bola' on reverse of title-page) ANU LARGE BOOK BL1310.6.S75 1941
Page #61
--------------------------------------------------------------------------
Page #62
--------------------------------------------------------------------------
________________ 1.1 AYARA (Ayar.) Title: Ayaranga; Acaranga (Skt). Content: "In two lengthy sections (sruta-skandha) it treats of the way of life (ayara, Skt. acara) of a monk. The first section, which makes a very archaic impression, is most decidedly earlier than the second, and yet even the first is a mosaic pieced together from heterogeneous elements. ... (a) mixture of prose and verse ..." "These sermons consist mainly of exhortations and warnings." "Section two of the Ayaranga is a much later work, as can be seen by the mere fact of the sub-divisions being described as Culas, ie. 'appendices. The subject-matter of the first two Culas is dry rules for begging and wandering, and the daily life of the monks and nuns. ... The third Cula contains the materials for a biography of Mahavira." (Winternitz 1933:2, 435-36, 437-38). References: JRK 23-24; JSBI 1, 61-123; BORI Cat. 17:1, 1-24; Schubring 1935 $45.1. Exegesis: Bhadrabahu, 6th cent., Niryukti = Ayaranganijjutti. AyarNi., 450 verses, (JSBI 3, 110). Printed. Ayar.1879; 1916 = 1978. 1935 Acaranganiryukti : Silankakrta tika sahita. Gopipura, Surata : Jainananda Pustakalaya, 1935. [JSBI 3, 110; Devendra Muni 1977, 710 item 19) 1989 Niryukti-sangrahah / Bhadrabahusvamiviracitah; sampadakah samsodhakasca Srijinendrasuri. Prathamavrttih. Lakhabavala, santipuri, Saurastra : Sri Harsapuspamsta Jaina granthamala, Vira sam. 2515. Vikrama sam. 2045. San 1989. 20, 600 p.:[1] plate ; 19 cm. (Sri Harsapuspamrta Jaina granthamala ; 189). 6. Sri Acaranganiryuktih p. 420-54. ANU BL1310.4 B432 1989 1995 The Nijjuttis on the seniors of the Svetambara Siddhanta : Ayaranga, Dasaveyaliya, Uttarajjhaya and Suyagada : text and selective glossary/Willem B. Bollee. Stuttgart : Franz Steiner, 1995. ix, 197 p. ; 24 cm. (Beitrage zur Sudasienforschung SudasienInstitut Universitat Heidelberg, Band 169). Ayaranga Nijjutti: p. 1-27. "Appendix : Schubring's selection of words from the notes to his Worte Mahaviras (numbers refer to pages)." (about 150 words.] p. 27-29. Reviews. Herman Tieken, Asiatische Studien = Etudes asiatiques 1996 (681)-683.Paul Dundas, BSOAS 60 (1997) 152-53.-Nalini Balbir BEI 13-14 (1995-96) 547- 48.-K. R. Norman The Jain nijjuttis Acta Orientalia 58 (1997) 52-74. RW Jinadasa Gani, Curni, 8 750 granthas. Begins: mangaladini satthani- (JRK 23-24; JSBI 3, 310-11). 1941 Sriacarangacurnih / bahusrutakimvadanty. Srijinadasaganivaryavihita ; [edited by Sagarananda). Malavadesantargataratnapuriya (Ratalamagata) : Srissabhadevajikesarimalaji Svetambarasamstha, Vikramasya samvat 1998. Srivirasya 2468. Kraistasya 1941. 382 p. ; 12 x 26 cm. [DLJP series list **Pratayah 500." ANU BL1312.3.A936 1941 Silanka, 9th cent., Ayaranga-sutra-vivrtti = Acara-tika, Acaranga-tika. AyarTi., Saka 784 1 "Klatt's erste Angabe uber Silanka's Zeit ZDMG 33(1879) 478 c. samvat 550' ist gegen die Notizen, die sich hier am Schluss finden. In seiner zweiten Angabe, Indian antiquary 11 (1882) 247b, giebt er denn auch das obige Datum (Saka 798, AD 876] an, freilich aber, s. untern, es gleichzeitig in Frage Stellend. Der Tradition zufolge war Silanka mit dem Beinamen: Kotyacarya, Schuler des Jinabhadragani, und hat alle 11 anga commentirt; erhalten ist jedoch nur der Comm. zu anga 1 und 2" (Weber 1888 2:2, p. 361 n.1).
Page #63
--------------------------------------------------------------------------
________________ Angas [862), 12 300 granthas. Begins: jayati samastavastuparyaya (JRK 24).2 Printed. Ayar. 1879; 1916 [ = 1978); 1932 or 1934; 1935bc With AyarNi. and Gujarati translation of the tika Ayar.Trans.Guj. 1935b. 1994 "Acurangabhasyam: mulapatha, Samskrta bhasya, Hindi anuvada tulanatmaka tippana, sutra-bhasyanusari, visaya vivarana, vargiksta visaya-suci tatha vividha parisistom se samalankta / bhasyakara Acarya Mahaprajna ; anuvadaka Muni Dulaharaja : (vacana pramukha Ganadhipati Tulasiji). 1. samskarana. Ladanam: Rajasthana, Jaina Visvabharati Samsthana. 1994.40,543 p. : 30 cm. (DKS-5204. DK Agencies Recent Sanskrit, Prakrit and Pali publications Ref. No. CIR-1585 / 1996-97, item 68] Jinahamsa, successor of Jinasamudra Suri, the successor of Jinacandra Suri of the Kharatara Gaccha, Acaranga-pradipika, Dipika 1582 (1525), 9 225 granthas (JRK 24). Printed Ayar.1879. Ajitadeva, Dipika. (Partial cty or partial edition of complete cty?] 1948 *Acarangadipika : prathama-srutaskandha / Vijayakumudasori. Bhavnagara : Manivijayaji Ganivara granthamala, Vi. sam. 2005 [1948). 5, 240 p. ; 27 cm. (Manivijayaji Ganivara granthamala ; 11). [Josi 1987, 35; Devendra Muni 1977, 710] Laksmikallola Gani, pupil of Harsakallola of the Tapa Gacha, tika called Tatvavagama, samvat 1596 [1539] (JRK 24). Parsvacandra, pupil of Sadhuratna Suri, Balavabodha (JRK 24). Printed Ayar.1879. Avacuri or Tika (JRK 24). Paryaya (JRK 24; BORI Cat. 17:1, 23-24). Editions: 1879 * Acaranga-sutra : Ganadhara-Sudharmma-svami-krta-mula-sutra tadupari Sri-Hamsasurikrta-Dipika-lika Sri-Silangacarya-krta-Acaranga-tika evam Sri-Bhagavan-Payacandaji-krta(Gujarati)-bhasa / Sri-Bhagavan-Vijayasadhuna samsodhitam. Kalakatta: Nutana-Samskrta Press 1936 [1879). [1], 437, 283 p. ; 26 x 31 cm. (Sriyukta Raya Dhanapatisimha Vahadura ka Agama-Sangraha ; 1). (CLIO 1, 21; Schubring 1935, $45.1; Univ. of Chicago Library catalogue] Contains Bhadrabahu's Acaranga-niryukti (p. 428-37, 282-83) and Parsvacandra Suri's Balavabodha. "This edition is of the ordinary stamp of native publications, which generally have about the same value as a corrected MS" (Hermann Jacobi, Ayar. 1882, xv). 1882 The Ayaramga sutta of the Cvetambara Jains / edited by Hermann Jacobi. London: Pali Text Society, 1882. xvi, 139 p. ; 23 cm. Part I, Text. Jacobi's critical edition is based on two "very good and old MSS"-A. palmleaf MS described by Buhler in his second report; later described in the BORI Cat. 17:1 as no.s 2, 7 and 12, dated samvat 1348 [1292); B. paper MS Staatsbibliothek zu Berlin, Ms.or.fol.643. [described in Weber 1888-92] dated samvat 1498 [1442); C indicates various readings taken from Ayar.1879. In addition Jacobi used three MSS in his own collection (now in the British Library, and some more (MSS) of the collection) in Berlin" (Preface, xiv). The second part, to contain a glossary with quotations from the commentaries (Preface, xvi) never appeared, nor has the PTS ever published another Jain text. de Jong Silanka refers twice to a cty by Gandhahastin, Pandit Sukhlal Sanghavi has shown that in all probability this refers to Siddhasena the author of the cty on the Tattvarthabhasya and not to Siddhasena Divakara or any other author (TattvaSu. 1974, Introduction, p. 57). 44
Page #64
--------------------------------------------------------------------------
________________ 1.1 Ayaranga 1902 *[Text and Gujarati translation / Ravajibhai Devaraja tatha Jaina skolarsa.) Ahamadabada : Jaina Printinga Presa, samvat 1958 (1902). 40, 253 p. ; 25 cm. (Jaina dharmana pavitra pustako). [Josi 1987, 25; Devendra Muni 1977, 710] The Gujarati translation was also printed separately. The Introduction (p. 22ff) contained Pariharyamimamsa dealing with the queries raised by H. Jacobi. This was dropped in 2nd ed. Ayar.1906. (BORI Cat.17:1, 3; Josi 1987, 36). 1906 *(2nd. ed. of Ayar. 1902) Rajkota : Rajakota Printinga Presa, 1906. 14, 403 p. ; 25 cm. (BORI Cat.17:1, 3; Josi 1987, 36). 1915 *Acaranga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1915. 638 p. ; 13 x 23 cm. Reprint. Ayar. 1960. 1916 Srimadganadharavarasudharmasvamipranitam Srutakevalibhadrabahusvamidrbdhaniryuktiyuktam, Srimacchilankacaryavihitavivrtiyutam (part 2 degvivaranayutam/Sriacarangasutram. Mahesana : Agamodayasamitih, Virasamvat 2442. Vikramasamvat 1972-73. Kraista 1916. 2 v. ; 12 x 26 cm. (CLIO 1,21] Part 1: [1], 240 [ie.2, 480) p. - Part 2: [3), 241-432 [ie. 6, 482-864) p. "A very poor text" (Folkert 1993, 272 n.33). "Pratayah 500." BORI Reprint. Ayar.1978. 1932 or 1934 *[Acarangasutta with Silarka's cty). Mumbai : Srisiddhacakra Sahitya Pracaraka Samiti, 1932. Vikrama samvat 1991 (1934). 2 v. ; 12 x 27 cm. (Josi 1987, 35; JL 25 (3rd group)]. v.1: 288 p.--v.2: 288-388 p. 1935a *Acarangasutra. Surat : Sheth Devcand Lalbhai Jain Pustakoddhar Fund, 1935. 2 v. [Bollee 1977, 1, 165) 1935b *Acarangasutram : mula ane Silankacaryani Tikana bhasantara sahita / lakhoh Pandita Hiralala Hamsaraja. Jamanagara : [Hiralala Hamsaraja] 1935. Bhaga 1 thi 5' [Utt. 1935": 2, reverse of title-page] 1935c *Sri-Acarangam : Sri-Bhadrabahusvami-krta-niryukti-sri-Silankacarya-krta-vrtti-yutam. Surat : Jainananda Pustakalaya. 340 [ie. 680] p. Tripathi 1981, 302] Indexed in the Jain concordance in Berlin. "The Niryukti verses are numbered 1-356 [!; some misprints and wrong numbers." (Tripathi 1981, 302). 1952-71 Sri-Acarangasutram / Ghastalajimaharajaviracitayacaracintamanivyakhyaya samalan krtam Hindigurjarabhasa 'nuvadasahitam. Rajakota, Saurastra : Sri [Akhila Bharatiya Sve(tambara). Stha[nakavasi] Jainasastroddharasamitih, Vira samvat 2478-2505 [1952-71). 4 v. ; 25 cm. 1. bhagah 1. Srutaskandha adhy. 1. Vira samvat 2478 [1952). 19, 722 p. 2. avrtti. Vira samvat 2484 [1958] 39, 12, 720, 20 p. BORI 2. bhagah adhy. 2-4. Vira samvat 2483 [1957]. 72, 690, 11 p. Reprint 1974. 3. bhagah adhy. 5-9. Vira samvat 2483 [1957]. 84, 619, 24 p. Reprint 1988. ANU PK5003.A52A4 1952 v. 1, 2, 3 4. bhagah. 2. srutaskandha (niyojakah Srikanhaiyalalaji-Maharajah]. Vira samvat 2505. Vikrama-samvat 2034. Isavisan 1971.4, 1186 p. RW 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie ; (sutthuruvena Pupphabhikkhuna sampadio. 1. avitti. Gudagamva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354. 2 v. ; 19 cm. Ayare v.1, [1]-99. ANU BL1310.58 1954 2 v. 3 BORI copy signed "Ch. Krause."
Page #65
--------------------------------------------------------------------------
________________ Angas 1958 Reprint of v. 1 of Ayar.1952-71. 1960 Sri Acaranga sutra / Sri Amolaka Rshiji dvara anuvadita ; sampadakah Sobhacandra Bharilla. 2nd corrected edition. Dhuliya (Pascima Khanadesa): Sri Amola Jnanakata, Vira samvat 2486 [1960). 4,4,300 p. ; 23 cm. (Amolakalshiji Smaraka granthamala; puspa sankhya 66). Contents: Prakasaka ki ora se [1]-[4]. [Donor details] [1]-4.-Prastavana / Anandarsiji [1]-4.-Visayanukramanika (1-2).--Sri Acarangasutra (mula, artha, spastikarana] [1]380. Reprint of Ayar.1915. ANU PK5003.A52 A4 1960 1963 Sri Acararga sutram tatha Sri Dasavaikalika sutram. Thanagarha, Saurastra : Saha Thakarasi Karasanaji, Vira samvat 2489. Vi. sam. 2019. Sane 1963. 8, 200, 68, 87-91 p. ; 18 cm. Contents: Ayar. (1)-197.-Suddhipatraka (198-200.]. -Dasave. [1]-68. Suddhipatraka [87-91). ANU BL1312.3.A93 1963 1963-64 Acaranga-sutram : Samskrtacchaya, padarthanvaya, mulartha, Hindi-vivecana sahita/ vyakhyakara Atmarama, sampadaka Muni Samadarst. Ludhiyana : Acarya Sri Atmarama ji Jaina Prakasana Samiti, 1963-64. Vira sam. 2489-90. 2 v. ; 25 cm. (Jainagama Sastra mala ; 6, 7). Contents v.1 (1. srutaskandha): Visaya-suci (1-2).--Gatha vinaya suci (index)(1)-4.Sutra-suci (index) [51-12.--Prakasakiya (13).--[Donor details 14).--Prastavana /Muni Atmarama [1]-22.-Acaranga : eka anusilana / Muni Samadarsi 1-29.- [Details of Atmarama's life 31-32).-Sri Acaranga sutra [1]-737).-Paribhasika sabda-kosa [1]22. Contents v.2 (2. srutaskandha): Visaya-suci [1].--Prakasakiya [2].-Parisista / Muni Samadarsi Prabhakara. Dvitiya srutaskandha Ganadhara krta hai? [1-8).Sri Acaranga sutra dvitiya srutaskandha [739-1483.-Paribhasika sabda kosa [1]-[4). "Prati 1 100." ANU PK5003.A52A4 1963 1967 Ayaro taha Ayara-cula : mula-patha, pathantara sabda-suci adi = Ayaro taha Ayar-cula : the Acaranga and the Acaranga-cula edited with original text, variant readings, alphabetical index of words, appendices etc. / vacana pramukha Acarya Tulasi; sampadaka Muni Nathamala. Kalakatta : Jaina Svetambara Terapanthi Mahasabha, 1967. (Agama-sutta granthamala ; 2). Bollee 1977:1, 165) Contents: Antastosa [1].-Granthanukrama [3].--Prakasakaya [kal-ga. Sampadakiya / Muni Nathamala (1)-12.-Bhumika / Acarya Tulasi 1-32.--Bhumika mem prayukta granthasuci [ka]-kha.-Ayaro taha Ayara-cula (prefatory matter, outline, abbreviations 111-14.- Ayaro 1-106.-Ayara-cula [111]-358.-Parisista 1. Ayaro: sanksipta-patha, purta-sthala aura adhara-sthala nirdesa (359).-2. Ayara-cula : sanksipta-patha, purtasthala aura adhara-sthala nirdesa [2]-12.-Vacanantara tatha alocya-patha (13]-19. Suddhi-patram [1]-8.-Ayaro sabda-suci [1]-52.--Ayara-cula: sabda-suci [53]-148.Suddhi aura apuraka patra 1 and 2. [1]-7. Seemingly reprinted as Ayar. 1974 or 1975. "Prati-sankhya 1000." Univ. of Poona Q31.21111 / 15165J7 / 132832 1974 Reprint of Ayar. 1952-71: v. 2. Vira samvat 2500. Vikrama samvat 2031. Isvisan 1974. 22,5, 598 p. "Prati 500." RW 1974 or 1975 Angasuttani : Niggantham pavayanam / sampadaka Muni Nathamala [Yuvacarya Mahaprajna). Ladanum, Rajasthana : Jaina Visva Bharati (Samsthana), Vikrama samvat 2031 [1974 or 1975). 3 v. ; 25 cm. Ayaro v.1, [1]-250. [v.1. Dvitiya samskarana. Vikrama samvat 2049. 1992.) "Original text critically edited on the basis of eight MSS (all dates are samvat)-'A.' (undated) from the Jaina-bhavana, Kalakara Street, Calcutta; "Ka.' (1679), 'Kha.' (1732), 'Ga.' (undated), "Cha.' (1899) and Ba.' (1752) from the Gadhaiya library, Saradarasahara; 'Gha.' (1573) and 'Ca.' (undated) from the L. D. Institute--and two printed editions AyarCu.1941 and Ayar.1935a. Described on p. 18-19. 46
Page #66
--------------------------------------------------------------------------
________________ 1.1 Ayararga Parts 1-3 of a complete edition of the canon. Page numbers in margins may refer to Ayar. 1935a. Seemingly reprinted from Ayar. 1967. ANU PK5003.A52 1974 3 v. and BL1312.2 1975 3 v. 1977 Avarangasuttam = Acarangasutram sampadaka Muni Jambuvijayah ; sahayako Muni Dharmacandravijayah. Bambai: Sri Mahavira Jaina Vidyalaya, Vira samvat 2503 [1977). 89, 422 p. ; 25 cm. (Jaina-agama-granthamala ; granthanka 2, (1)). Contents: Prakasakiya nivedana [9]-12.-Rnasvikara [13].-- Jina agama jayakara : prastavana [Gujarati]/Jambuvijaya (15)-55.-Amukham (Sanskrit]/Jambuvijaya (56)61.-Foreword / Jambuvijaya (63)-68.--Sampadanopayuktagranthasucih (69)-71.Sanketavivaranam 1731-74.- Acarangasutrasya visayanukramah [75]-89.Ayarangasuttam [1]-298.-1. parisistam. Visistasabdasucih [299]-389.-2. Java'syavat]padagrahyapathah (390)-95.-3. Sutranam parasparam tulana (396)-398.4. Acarangasutrantargataslokanam akaradikramah (399)-400.-5. Katipayani visistani tippanani (401-412.Suddhi-vrddhipatrakam [413] 415.-Avisistasuddhipatrakam 415 16.-Visistah sandi-pratipathah 416-22.-Prastavanamam mahattvano sudharo 422. Sources: "In the preparation of the critical edition of the Acarangasutra we have utilised six palm-leaf MSS and eight paper MSS" (described on p. 50-52 = 59-60 = 66-67). Six on palm-leaf: (1) Sam. and (2) Kham.: Sri Santinatha Jaina Jnana-bhandara, Cambay, no. 1 & 3. (3) Je. Jinabhadrasuri Jaina Jana-bhandara, Jesalmere, no. 1. (4) Khe. Khetaravasi Jnanabhandara, Patan. (5) Sam. Sanghavipada Jnanabhandara, Patan, second half of 13th cent. Vikram. (6) Sandi. Long (dirgha) MS from the same bhandara, Patan, written 1467 VS. Eight on paper: (1) I. Idar Jaina Svetambara Sangha, Pedhi. (2) Jai. Jaina Sahitya Vikas Mandal, Bombay. (35) He.1, 2, 3 Sri Hemacandracarya Jaina Jnanamandir, Patan. (6-7) La., La.1 L. D. Institute, Ahmedabad. (8) Ji. L. D. Institute, with Dipika by Jinahamsasuri. Review. *J. W. de Jong IIJ 29 (1977) 217-18. Review article K. R. Chandra 1987 (see studies below). ANU PK5003.A52A89 1977 1978 Acarangasutram Sutrakrtangasutram ca / Srimatsudharmasvamiviracitam; Bhadrabahusvamiviracitaniryukti-Srisilankacaryaviracitatikasamanvitam ; sampadakah samsodhakasca Acaryamaharajasrisagaranandasurisvarah, Munirajasripunyavijayajimaharajasanglhitapracinasamagryanusarena suddhi-vrddhipatrakadivividhaparisistadibhih pariskarta Munih Jambuvijayah, sahayako Munih Dharmacandravijayah. Dilli : Motilala Banarasidasa Indolajika Trasta, 1978. 42, 288, 400 [72] p.;[1] leaf of plates; port. ; 29 cm. (Lala Sundaralala Jaina Agamagranthamala , bhaga 1). Contents: Prakasaka-vijnaptih.-plate of Lala Sundarlal Jain (15 Feb. 1900-23 Jan. 1978) Lala Sundaralala Jainah (Sanskrit) [7]-8.-Lala Sundarlal Jain [English] [9110.-Samarpanam-Prastavana-parisistopayuktagranthasucih sanketavivaranam ca (1415).-Prastavana /Muni Jambuvijaya, Vikramasamvat 2033, 10 Nov. 1977, Vava (Jila Banasakamtha, Uttara Gujarata) [17] 42.... Acarangasutrasya visayanukramah [1]16.-Sriacarangasutram [1]-288.- Sutrakstangasya visayanukramah (1)-14.Srisutrakrtangam [1]-285.-Silankacaryaviracitavivaranasamanvitasya Sriacarangasutrasya parisistani : Vrddhipatrakam = Addenda & corrigenda (289)-305.Suddhipatrakam 305-20.--Acarangasutrasya Silacaryaviracitavsttavuddhitah pathah [321]-326.- Acarangasutranam gadyarupanam akara dikramah [327]-332.Acarangasutrantargatanam gathanam akaradikramah (333)-335.-Acarangasutrasya Niryuktinam akaradikramah (336)-341.-Silangacaryaviracitavivaranasamanvitasya Srisutrakstangasutrasya parisistani: Srimacchilankacaryaviracitayah Sutrakstangatikaya vrddhipatrakam (345)-357.-Srimacchilankacaryavihitavivaramayutasya SutrakstangaSutrasya suddha visista va pahah (358)-378.-Sutrakstangasya Silacaryaviracitavstav uddhita" pathah (379]-385.--Sutrakstangasya gadyarupanam sutranam akaradikramah [386)-387.-Sutrakrtangasutrasya gathanam akaradikramah (388)-400. Reprint in bound format of Ayar.1916. de Jong
Page #67
--------------------------------------------------------------------------
________________ Angas 1980 Acaranga sutra (prathama Anga : mula patha, Hindi anuvada-vivecana-tippana-parisista yukta / Sudharmasvami-pranita ; sampadaka-vivecaka Sricanda Surana 'Sarasa'. Byavara, Rajasthana : Sri Agama Prakasana Samiti, Vira Nirvana samvat 2507 [1980]. 2 v. ; 25 cm. (Jinagama granthamala ; granthanka 1, 2). Granthanka 1: 47, 376 p.- Granthanka 2: 24, 480 p. Contents v.1 (1. srutaskandha): Prakasakiya [71-8.- Amukha/Misrimala 'Madhukara'[9]11.-Sampadakiya / Sricanda Surana [12]-16. [Donor details 17)-19.-Prastavana / Devendra Muni (21) 42.-Anukramanika [43] 47.-Ayarangasuttam [1]-338.-Parisista 1. Java' sabda sanketita sutra sucana [341]-342.-2. Visista sabda-suci (343)-370.-3. Acarangasutrantargata gathaom ki akaradi suci (371)-372.-4. Sampadana-vivecana mem prayukta granthasuci. (373)-376. Content v.2 (2. srutaskandha): Abhimata / Anandarsi [6].--Prakasakiya (71-8.-Amukha / Misrimala 'Madhukara'19)-11.-Sampadakiya / Sricanda Surana 'Sarasa' [12]-17.... Visaya-suci(18)-24.-Ayarangasuttam (11 430.-Parisista 1. Visista sabda-suci (433)469.-2. Acarangasutrantargata gathaom ki akaradi suci [470].-3. Java' sabda sanketita sutra sucana (471)-476.4. Acaranga dvi. sru. sampadana-vivecana mem prayukta granthasuci. [477] 480.--[Donor details 481)-483. Prakrit text taken from Jambuvijaya's edition (Ayar.1977) as are the appendices. ANU PK5003. A52.A4 1980 no.s 1,2 1988 Reprint of Ayar. 1952-71: v. 3. Vira samvat 2514. Vikrama samvat 2044. Isvi san 1988. 54, 616 p. "Prati 250". RW 1992 Reprint of Ayar.1974 or 1975 v. 1 Partial editions: 1894 *Acaranga (Gujarati-tat-parya-sameta) pra. [?] Bombay: Bombay City Press, [1894). [1], 208, [2] p. ; 12 x 26 cm. [CLIO 1, 21) 1. suyakkhandha published Bombay, samvat 1951 [1895) (Schubring 1935 $45). 1910 Acaranga-sutra, erster Srutaskandha : Text, Analyse und Glossar/ von Walther Schubring. Leipzig : F. A. Brockhaus, 1910. ix, 109 p. ; 21 cm. (Abhandlungen fur die Kunde des Morgenlandes 12,4). Contents: Vorwort. viil-ix.-Ayar'anga-suttam 1-44.-Analyse [45]-63.--Glossar [64]109.-Berichtigungen [109]. Reviews. (1) H. Jacobi Archiv fur Religionswissenschaft. 18 (1915), 283 ff.--(2) E. Leumann ZII 7 (1929), 157-62 (important metrical contributions (Alsdorf 1958, 250)). This edition used as the base for Ayar.Index.1994; 1995. CASS Q31:21111/EO/ 11066 Reprint. 1923 or 1924. Acaranga-sutram : mulapatha-visista pathabheda-sabdakosasamanvitam (prathamah srutaskandhah) ... Punyapattana : Jaina Sahitya Samsodhaka Samiti, Mahavira Nirvanabda 2450 [1924). Vikrama samvara 1980 [1923).58 p. ; 24 cm. (Jaina sahityasamsodhaka granthamala). Contents: Ayaranga-suttam [1-37.-Akaradi-sabdanukramanika (38)-54.-Katipaya visistapathabhedah (55)-58. BORI 3. [Roman script) Nendeln, Liechtenstein: Kraus Reprint, 1966. ANU PJ5.D5 Bd. 12, Nr.4 1950 or 1951 Sri Acaranga-sutram, prathama srutaskandha : samsuddha mulapatha-Samskrtacchaya sabdartha-bhavartha-vivecana-tippana-parisistanvitam / anuvadaka Saubhagyamalaji Maharaja. Prathamavstti. Ujjaina : Sri Jaina Sahitya Samiti, Vira sam. 2477 [1951). Vi. sam. 2007 (1950). ka-ma, 621, ka-gha p. ; 24 cm. Contents: Sampadakiya vaktavya [kal-kha.- Prakkathana/Saubhagya Muni (ga-ja). 48
Page #68
--------------------------------------------------------------------------
________________ 1.1 Ayaranga Bhumika / Sobhacandra Bharilla (jha)-na.-Prakasaka ki ora se (tha)-naVisayanukramanika (pal-ma.-Acaranga-sutram [1]-621.-Parisista (a) Visista pathabheda [ka)-kha-baParibhasika sabda kosa (gal-dha. Text established on MSS in the library of the Sri Dharmadasa Jaina Mitra Mandala, Ratlam and old editions, including Ayar.1916., giving precedence to the cty readings from that edition. The translation likewise is based on the cty. An appendix gives a list of variant readings. (Prakkathana 'cha'). "1000 (copies)." Univ. of Poona Q31:2111/151610.1/92191 1951 *Ayarangasutra (prathama frutaskandha) / Hindi anuvada Ghevaracandra Banthiya "Viraputra'. 1. avrtti. Bikanera : Agracandra Bhairodana Sethiya Jaina Parabharthika Samstha, 1951. dha [?], 305 p. ; 11 x 25 cm. (Josi 1987, 38) 1978 * Ayarangasutra (prathama srutaskandha] / sampadaka (Gujarati) anuvadaka Naginadasa Kevaladasa Saha. Amadavada : Naginadasa Kevaladasa Saha, sam. 2035 [1978). 32, 146 p. ; 22 cm. [Josi 1987,40] Selections: 1958 or 1961-62 Acarangah-cintana: Tattva-bodhini-Hindi-tika sahita/sangrahaka evamanuvadaka Udaya Muni; sampadaka Ratanalala Sanghavi. 1. samskarana. Byavara, Rajasthana : Sri Jaina Divakara Divya Jyoti Karyalaya, Vira. 2487[-188 [1961-62), Vikra. 2015 [1958). 31, 218 p; 12 cm. "1 000 (copies)." Selections with popular translations in Hindi. Text numeration from "Bikanera ke Sethiya granthalaya" dvara prakasita Sri Acaranga sutra lie. Ayar.partial edition.1951] (p. 30 (2nd group)). ANU PAMPHLET PK5003.A52A4 1961 1987 Acaranga-cayanika / sampadakah Kamalacanda Sogani. 2. samskarana. Jayapura : Praksta Bharati Akademi, 1987. xxiii, 167 p. ; 19 cm. (Prakta Bharati , puspa 23). Contents: Prakasakiya [1].-Prakkathana/Vinayasagara (2-4).--Prastavana i-xxiii.Acaranga-cayanika [1]-75.-Sanketa-suci 76-77.-Vyakaranika vislesana evam sabdartha 78-152.-Tippana 153-56.-Acaranga-cayanika ke visayom ki ruparekha 15762.-Acaranga-cayanika evam Acaranga sutra-krama 163-65.-Sahayaka pustakem evam kosa 166-67. ANU BL1312.3.A93685 1987 Translations: English: 1884 *Gaina Sutras/translated from Prakrit by Hermann Jacobi. Part I: The Akaranga Sutra. The Kalpa Sutra. Oxford: Clarendon Press, 1884. liii, 324 p. (Sacred Books of the East ; 22). Contents: Introduction (ix-liii.-Akaranga Sutra [1]-213.--The Kalpa Sutra of Bhadrabahu (215)-311.--Index (313)-320. Reprints. 2. Delhi : Motilal Banarsidass, 1964. 22 cm.-3. New York: Dover, 1968. ANU BL 1010.53 v.22 1964 1968 Reprint of Ayar. English translation. 1884. Reprint of Ayar.English translation.1884. 1981 Ayaro = Acaranga sutra : the first Anga Agama (canonical text) of the Jainas : the text in Devanagari and Roman scripts with English translation, annotations, notes, glossary and index/translated into English by Muni Mahendra Kumar. Ladnun, Rajasthan : Jaina Vishva Bharati, 1981. xxiv, 433 p. ; 22 cm. (Jaina canonical text series ; v. 1). Contents: Preface i-v.-Introduction / Nathmal Tatia vii-xxiv.- [Text with translation 4 *Ayarangasutra/anuvadaka Tilakavijayaji. Puna: Bharata Jaina Vidyalaya, Samvat 1980[1923). 58 p. (Josi 1987, 37). Language of translation not given.
Page #69
--------------------------------------------------------------------------
________________ Angas and annotations 1] 415.-Word-index (Glossary) [417] 429.-Subject index (430) 433. ANU PK 5003.A52A4 1981 and BL1312.3.A934.E4 1981 Gujarati:5 1879 (Ayar.1879) 1902 Ravijibhai Devaraja (Ayar.1902) 1922 Ayaranga sutra : mula niryukti ane tikane adhare bhasantara / lekhaka Maneka Muni. Surata : "Jaina Vijaya" Printinga Presamam, 2448 [1922). 5 v.; 16 cm. ANU BL1312.3.A934G8 1922 v.2-5 1935 * Mahavirasvamino acaradharma : Jaina Agama "Acaranga "no chayanuvada / sampadaka Gopaladasa Jivabhai Patela. 1. avstti. Amadavada : Jainasahitya Prakasana Mandala. Praptisthana, Navajivana Karyalaya 1992 [1935). xxii, 208 p. ; 19 cm. (Sri Punjabhai Jaina granthamala ; 11). (CRL catalogue Reprint. 1947. SAMP MONOGRAPHS MF-10194 reel 036 1947 Mahavirasvamino acaradharma : Jaina Agama "Acaranga "no chayanuvada / sampadaka Gopaladasa Jivabhai Patela. 2. avstti. Amadavada : Jainasahitya Prakasana Mandala. Praptisthana, Navajivana Karyalaya, samvat 2004 (1947). xxii, 208 p. ; 19 cm. (Sri Punjabhai Jaina granthamala ; 11). Contents: Nivedana 31-5.-Upodghata 16-13.Anukramanika (157-16.Mahavirasvamino acaradharma Khanda 1 [1]-66.-Khanda 2 [67]-164.-Subhasito (165)-172.-Suci [1731-179. First edition samvat 1992 [1935) ANU BL1356.M3 1947 1952-57 Ghasilala (Ayar.1952-57) 1974-75[?] *Ayarangasutra / Gujarati anuvada Lilamabai, Hasumatiji; sampadaka Sobhacandra Bharilla. 1. avrtti. Mumbai : Premajinagama Samiti, [1974-75?). 25 cm. (Prema Jinagama prakasana ; 1). [Josi 1987,40] Hindi: 1915 Amolaka Rsi (Ayar. 1915) 1937 *[Ayaranga-sutta : Hindi chayanuvada)/Gopaladasa Jivabhai Patela. Bambai: Svetambara Sthanakavasi Jaina Kamphrensa, Vikrama samvat 1994 [1937). [Devendra Muni 1977.710; JSBI 1,62] 1952-71 Ghasilala (Ayar.1952-57) 1960 Amolaka Rsi (Ayar. 1960) 1963-64 Atmarama (?) (Ayar.1963-64) 1980 (Ayar. 1980) PARTIAL TRANSLATIONS (1. SRUTASKANDHA ONLY): Bengalr: 1952 *[Bengali translation]/Hirakumarr. Kalakatta : Jaina Svetambara Terapanthi Mahasabha, Vikrama samvat 2009 (1952). [Devendra Muni 1977, 710, n.13; JSBI 1, 62] English: 1981 (Chapter 9 only) Tatia 1981: 11. The victor's penance [Ayar. chapter 9] [96]-107. German: 1926 Worte Mahaviras: kritische Ubersetzungen aus dem Kanon der Jaina/Walther Schubring. Gottingen : Vandenhoeck & Ruprecht, 1926. ix, 152 p. (Quellen der Religionsgeschichte. 5 Incomplete citations not yet fully identified: (1) "Mula va Gujarati anuvada." Ghatakopara: Sramani Vidyapitha. Devendra Muni 1977, 710 item 14. (2) Ayarangasutra. Bhavanagara : Jaina Dharma Prasaraka Sabha tatha Layabreri Samaja. Text, tika and [Gujarati?) meaning. (Josc 1987, 41). 50
Page #70
--------------------------------------------------------------------------
________________ Gujarati: 1894 1935 1958 1964 Band 14, Gruppe 7) p. 66-121 Reines Leben (Bambhaceraim). 1958 (Ayar.Partial edition.1894) *Ayarangasutranum [prathama srutaskandha] Gujarati anuvadana / anuvadaka Saubhagyacandra 'Santabala'. 1. avrtti. Amadavada: Mahavira Sahitya Mandira, samvat 1992 [1935]. 52, 431, 110 p.; 19 cm. (Mahavira Sahitya Prakasana Mandira; 4). [Josi 1987, 37] Appendix: Ayaranga ane Bhagavadgita eka tulanatmaka vicara.-Saddarsanani sanksipta mimamsa Paribhasika sabdakosa.-Acarangasutranum suktamrta. 2. edition 1958. Sri Ayarangasutra num Gujarati anuvadana/anuvadaka Saubhagyacandraji. 2. avrtti. Amadabada: Mahavira Sahitya Prakasana Mandira, samvat 2015 [1958]. 48, 4, 431, 108 p.; 19 cm. Contents: Nivedana [4]-5.-Nivedana [6]-7.-Be bola [8].-Sahayaka [9]-10.-- Acarangamam atmanam udbodhaka kranitmaya kavana ane tejachaya [11]-39.-- Nidarsana [40]-48.-Anukramanika [1]-4.-[Translation] [1]-431.-Parisista. Sri Acaranga ane Bhagavadgita vise eka tulanatmaka vicara: [1.] Sri Acarangano upasamhara [3]-21.-2. Sadhanatmaka-samanvayano sanksipta paricaya [22]-53.-3. Samanarthaka sabdika samanvaya [54]-86.-Paribhasika sabdakosa [87]-97.Sriacarangasutranum suktamrta [98]-102.-[Details of other publications from the same publisher.] "Prata 1000." 1. ed. 1936 Devendra Muni (1977, 710). ANU BL1312.3.A934G8 1958 1978 Hindi: 1950 or 1951 Saubhagyamala (Ayar.partial edition.1950 or 1951) 1951 1.1 Ayaranga Ayaranga sutram: prathama [sruta-]skandha / Muni Kumara. 2. avrtti. Rajakota: Jayantilala Devacanda, Vira samvat 2490 [1964]. 319 p.; portraits; 23 cm. Contents: Nivedana [7]-8.-Sri Vinodamuninum sanksipta jivana caritra [9]-19.-- Acaranga sutram [1]-319. ANU BL1312.3.A934G8 1964 Naginadasa Kevaladasa Saha (Ayar.partial edition. 1978) Ghevaracandra Banthiya 'Viraputra' (Ayar.partial edition.1951) *Ayarangasutra / sampadaka Pupphabhikkhu; Hindi anuvadaka Saubhagyacandra 'Santabala.' 1. avrtti. Gudagamva: Sutragama Prakasaka Samiti, 1958. 2 v.; 18 cm. [Josi 1987, 38] v. 1: Srutaskandha 1, adhyayana 1-5, 42, 252 p.-v.2: Srutaskandha 1, adhyayana 6-9, 8, 478 p. Hindi translation of Ayar. 1953-54, text not included here. Studies: Bhatt, Bansidhar. 1993. Acara-culas and -niryukti: Studies I, Indologica Taurinensia 14 (1987-88) 95116. Acara-culas and -niryukti: Studies II: (Mahavira-biography), Jain studies in honour of Jozef Deleu/edited by Rudy Smet and Kenji Watanabe. Tokyo: Hon-no-Tomosha, 1993. p. 85-122. Bollee, W. B. 1990. *Ayaranga 2,16 and Suyagada 1,16. Journal of Indian philosophy 18 (1990) 29-52. [Bollee 1995, 183] Caillat, Colette. 1977. Fasting unto death according to Ayaranga-sutta and to some Painnayas. In, Mahavira and his teachings/ editorial board A. N. Upadhye, Nathmal Tatia [et al]. Bombay : Bhagavan Mahavira 2500th Nirvana Mahotsava Samiti, 1977. iv, 462 p. ; 25 cm. ; p. 113-117. ANU BL1371.M3 Caillat, Colette. 1993. The rules concerning speech (bhasa) in the Ayaranga- and Dasaveyaliya-suttas. In, Pam. Dalasukhabhai Malavaniya abhinandana grantha (1) = Pt. Dalsukh Bhai Malvania 51
Page #71
--------------------------------------------------------------------------
________________ Angas felicitation volume 1/ sampadaka Madhusudana Dhaki ; Sagaramala Jaina. Varanasi: Parsvanatha Vidyasrama Sodha Samsthana, 1991. 32, 284, 206 p. ; 25 cm. (Jaina Vidya ke Ayama, granthanka 3 = Aspects of Jainology: 3). p. 111-15. ANU NEW BOOKS COLLECTION 1 861 971 Caillat, Colette. 1996. Transmission textuelle et variations dans le canon jaina svetambara : l'exemple de l'Ayarangasutta, p. 497-521. In, Langue, style et structure dans le monde indien:centenaire de Louis Renou. Actes du Colloque international (Paris, 25-27 janvier 1996) / edites par Nalini Balbir et Georges-Jean Pinault avec la collaboration de Jean Fezas. Paris : Librairie Honore Champion, 1996. 559 p. ISBN 2-85203-732-7. Chandra, K. R. 1970. Notes on some words from Acaranga (paya, daviya, acca, anakkha, oya). Journal of the Oriental Institute (Baroda) 20 (1970) 238-46. [Bollee 1995, 184) Chandra, K. R. 1987. Pu. Jambuvijayaji dvara sampadita Acaranga (Ayar. 1977] ke prathama srutaskandha mem svikrta kucha pathom ki samiksa. In Pam. Becaradasa Dosi smrti grantha/ sampadaka Madhusudana Dhaki, Sagaramala Jaina. Varanasi: Parsvanatha Vidyasrama Sodha Samsthana, 1987. Hindi section p. 1-7. (This is v. 2 of Jaina vidya ke ayama = Aspects of Jainology / sampadaka Sagaramala Jaina, Asoka Kumara Simha. Varanasi : Pujya Sohanalala Smaraka Parsvanatha Sodhapitha, 1987-94. 5 v.) Devendra, Muni. 1992. *Sabdom ki gagara mem agama ka sagara : Acaranga, Sthananga evam Samavayanga sutra para sodha pradhana cintana. Udayapura : Sri Taraka Guru Jaina Granthalaya, 1992. xi, 218 p. ; 22 cm. Dixit, K. K. 1978. Some noteworthy features of the Jaina speculation as occuring in Acaranga I and Sutrakstanga I. In, Early Jainism. Ahmedabad: L. D. Institute of Indology, 1978. 8,99 p. ; 25 cm. (LD series ; 64). p. 9-21. ANU BL1351.2.D53 Dixit, K. K. 1978. Acaranga II. In, Early Jainism. Ahmedabad : L. D. Institute of Indology, 1978. 8, 99 p. ; 25 cm. (LD series ; 64), p. (54)-61. ANU BL1351.2.D53 Ghatage, A. M. 1938-39. Parallel passages in the Dasavaikalika and the Acaranga. New Indian anti quary 1 (1938-39) 130-37. Jaina, Parameshthidasa. 1987. Acarangasutra: eka adhyayana. Varanasi : Parsvanatha Vidyasrama Sodha Samsthana, 1987. (35), 177 p. ; 23 cm. (Parsvanatha Vidyasrama granthamala ; 37). Contents: Prakasakiya (gal-gha. (ie. 3-4).--Lekhakiya [na]-na (ie. 5-10].--Bhumika / Sagaramala Jaina (tal-va sie. 11-29].-Visaya-suci (sa)-tra (ie. 30-35].-1. Jaina Agama sahitya mem Acaranga sutra [1]-39.-2. Acaranga ki visayavastu (40)-71.-3. Acaranga ki bhasa-saili [72]-98.-4. Acaranga mem samaja aura samsksti [99]-111.-5. Acaranga mem sasana-vyavastha (112)-121.-6. Acaranga ka darsanika paksa [122]-132.-7. Acaranga mem pratipadita dharma-sadhana [133]-156.-8. Bhagavan Mahavira ka jivana (157)-177. Thesis, Saugar University, 1960. (Jain, Sagarmal and Arun Pratap Singh 1983, item 40] ANU BL1312.3.A936J35 1987 Parikh, Joharimal. 1991. Philosophy of the Acaranga sutra. In, Pam. Dalasukhabhai Malavaniya abhinandana grantha (1) = Pt. Dalsukh Bhai Malvania felicitation volume 1/ sampadaka Madhusudana Dhaki ; Sagaramala Jaina. Varanasi : Parsvanatha Vidyasrama Sodha Samsthana, 1991. 32, 284, 206 p. ; 25 cm. (Jaina Vidya ke Ayama ; granthanka 3 = Aspects of Jainology ; 3). p. [174]-86. ANU NEW BOOKS COLLECTION 1 861 971 Priyadarsanasri. 1995. *Acaranga ka nitisastriya adhyayana. Varanasi: Parsvanatha Vidyasrama, 1995. 12, 300 p. (Parsvanatha Vidyasrama granthamala ; 80). Sharma, J. N. 1974. *A critical study of [the] Acaranga based on its Niryukti, Curni and Tika. 52
Page #72
--------------------------------------------------------------------------
________________ 1.1 Ayaranga Thesis. Bihar University, Muzaffarpur, 1974. [Jain, Sagarmal and Arun Pratap Singh 1983, item 44] Tatiya, Nathamala 1978-79. Acaranga-sutra mem varnita dhyana marga. Tulasiprajna 4 (1978-79) 282-86. Watanabe, Kenji. 1993. Notes on the 'bhavana' : 3rd Cula of the Ayaranga-sutta II. Jain studies in honour of Jozef Deleu/edited by Rudy Smet and Kenji Watanabe. Tokyo: Hon-no-Tomosha, 1993. p. 475 484. Indexes: 1967 (Ayar.1967): Ayaro sabda-suci p. [1]-52.-Ayara-cula : sabda-suci [53]-148. 1974 or 1975 (Ayar. 1974 or 1975) indexed in Agama sabdakosa : angasuttani sabdasuci= Word-indexes of Angasuttani/ sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2037. <1980->.<1v.>; 25 cm. 1977 (Ayar.1977): 1. parisistam. Visistasabdasucih p. [299]-389-- 4. Acarangasutrantargataslokanam akaradikramah (399)-400. 1980a (Ayar.1980): v.1 (1. Srutaskandha) : Parisista 2. Visista sabda-suci p. 13431-370.-3. Acarangasutrantargata gathaom ki akaradi suci (371)-372.--v.2 (2. srutaskandha) Parisista 1. Visista sabda-suci [4331-469.-2. Acarangasutrantargata gathaom ki akaradi suci (470). These indexes are reprinted from the 1977 edition. 1980b The Padas of the Suttanipata : with parallels from the Ayaranga, Suyagada, Uttarajjhaya, Dasaveyaliya and Isibhasiyaim / edited by Willem B. Bollee. Reinbeck: Dr. Inge Wezler, Verlag fur Orientalistische Fachpublikationen, 1980. vi, 116 p. (Studien zur Indologie und Iranistik. Monographie ; 7). ANU BQ1419.B65 1980 1983 Reverse index of the Dhammapada, Suttanipata, Thera- and Therigatha padas, with parallels from the Ayaranga, Suyagada, Uttarajjhaya, Dasaveyaliya and Isibhasiyaim / edited by Willem B. Bollee. Reinbeck: Dr. Inge Wezler Verlag fur Orientalistische Fachpublikationen, 1983. iv, 262 p. (Studien zur Indologie und Iranistik. Monographien ; Band 8). ANU BQ1359.R3 1994 Ayaranga : pada index and reverse pada index / Moriichi Yamazaki and Yumi Ousaka. Tokyo : The Chuo Academic Research Institute, 1994. iii, 23 p. ; 30 cm. (Philologica Asiatica : Monograph Series ; 3). Pada indexes for sections 1.8 and 1.9 only, based on Schubring's edition (1910). Index integrated into Ayar.Index.1995 below. Review: BEI 11-12 (1993-94), 467-68. RW 1995 A Pada index and reverse pada index to early Jain Canons : Ayaranga, Suyagada, Uttarajjhaya, Dasaveyaliya, and Isibhasiyaim / by Moriichi Yamazaki and Yumi Ousaka. Tokyo : Kosei Publishing Co., 1995. 537 p. 23 cm. Includes Ayar.Index.1994 above. Review: "[L]es editions de la Jaina-Agama-Series ne sont toujours pas prises en compte et aucune explication n'est fournie a ce fait ... On continue aussi a regretter qu'aucune indication abregee ne figure pour caracteriser le metre des pada. Toutefois, tel qu'il est, ce volume fait un instrument de travail extremement utile." Nalini Balbir BEI 13-14 (1995-96), 543. RW
Page #73
--------------------------------------------------------------------------
________________ Angas 1996 Ayaranga : word index and reverse word index / Moriichi Yamazaki and Yumi Ousaka. Tokyo: The Chuo Academic Research Institute, 1996. ii, 105 p.; 30 cm. (Philologica Asiatica : Monograph Series ; 8). "The indexes present every word and word group as they appear in the text of Schubring's edition, Ayar.partial edition. 1910)." (Introduction, p. i). Review: Nalini Balbir BEI 13-14 (1995-96) 544 45. RW 1999 A word index and reverse word index to early Jain canonical texts : Ayaranga, Suyagada, Uttarajjhaya, Dasaveyaliya, and Isibhasiyaim/Moriichi Yamazaki and Yumi Ousaka. Tokyo: The Chuo Academic Research Institute, 1999. iii, 410 p. ; 30 cm. (Philologica Asiatica : Monograph series ; 15). The 1996 index integrated with those for other texts. 54
Page #74
--------------------------------------------------------------------------
________________ 1.2 SOYAGADA (Say.) Title: Suyagadanga; Sutrakstanga (Skt). Content: "Suy.) treats of the pious life of the monks, and is mainly devoted to the confutation of heretical opinions. This Anga ... consists of two books, the second of which is probably only an appendix, added later, to the old Anga which we have in the first book. This is composed in verses, slokas and also more artificial metres; the similes, too, show that the author was desirous of proving himself to be a poet. ... The explicit purpose of the book is to keep young monks away from the heretical doctrines of other teachers, to warn them of all dangers and temptations, to confirm them in their faith and thus lead them to the highest goal" (Winternitz 1933:2, 438-39). References: JRK 449-51; BORI Cat. 17:1, 25-33; JSBI 1, 127-68; Schubring 1935 $45.2. Exegesis: Bhadrabahu, Niryukti (205 gathas) (Tripathi 1975, 92; JRK 450; JSBI 3, 119). 1989 Niryukti-sangrahah / Bhadrabahusvamiviracitah , sampadakah samsodhakasca Srijinendrasuri. Prathamavrttih. Lakhabavala, Santipuri, Saurastra : Sri Harsapuspamsta Jaina granthamala, Vira sam. 2515. Vikrama sam. 2045. San 1989. 20, 600 p. ; [1] plate ; 19 cm. (Sri Harsapuspamsta Jaina granthamala ; 189). 7. Sri Sutrakstanganiryuktih p. (455) 475. ANU BL1310.4 B432 1989 1995 The Nijjuttis on the seniors of the Svetambara Siddhanta : Ayaranga, Dasaveyaliya, Uttarajjhaya and Suyagada : text and selective glossary/Willem B. Bollee. Stuttgart : Franz Steiner, 1995. ix, 197 p. ; 24 cm. (Beitrage zur Sudasienforschung Sudasien-Institut Universitat Heidelberg : Band 169). Suyagada Nijjutti: p. 119-36. Basis for text not explicitly stated, seems to be Suy.1917; 1950-53; 1928; Niryukti-sangraha 1989, with variants added from Suy.Cu.1941 and Suy.Partial edition. 1975. Reviews: Herman Tieken, Asiatische Studien = Etudes asiatiques 1996 (681)-683.Nalini Balbir BEI 13-14 (1995-96), 547.--Paul Dundas, BSOAS 60 (1997) 152-53.-K. R. Norman, The Jain nijjuttis Acta Orientalia 58 (1997) 52-74. RW Also printed: Suy.1917 [=1978b); 1923; 1928; 1950-53; 1977-88; 1978b. Suy.Partial edition. 1975. Suy.Cu. 1950. RW 2 Jinadasa Gani, Cunni about 10 000 granthas (JRK 450; JSBI 3, 312). 1941 * Sri-Sutrakrtangacurni with Nijjutti and Jinadasa's Cunni / edited by Mohanlal M. Badami. Ratlam: Sri Rsabhadevaji Kesarimalaji Svetambara Samstha, 1941. 466 p. ; 12 x 27 cm. [JSBI 3, 312; Bollee 1995, 192; Schubring 1955, 297, Josi 1987, 46) "Very corrupt" (Suy.1978, 65). "[Here we find several clear attempts at normalizing, simplifying, or restoring the metre, so that to variants of Suy. 1950-53] the principle of the lectio difficilor must be applied with some rigour" (Alsdorf 1958, 251). The text published here is very corrupt, "compared with this, the one corrected by ... Punyavijaya is flawless lie. Suy.Partial edition. 1975]" (Jambuvijaya, Suy. 1978, 65 (1st group)). The DLJP series list says Sagarananda Suri was responsible for this edition. Also printed: Suy.Partial edition. 1975. Silanka 2 Sutrakrtangatika, composed Saka 784, ie. samvat 918 (861) other sources give Saka 798, samvat 932 [875], 12 850 granthas (JRK 450; Suy.1978, 66 (1st group)). Alternatively referred to as Silacarya (Suy.1978, 66 (1st group). Printed. Suy.1880; 1917; 1936-40; 1950-53. Translated into Hindi Suy.1922-32. 1 Bollee (1977-88:1, 3) gives 1950 as the date of publication, this seems not to be correct. 2 In the tenth cent. Vikram Silanka did not have before him a single manuscript representing the tradition for earlier Curnis: iha ca prayah sutradarsesu nanavidhani sutrani drsyante, na ca tikasamvadi eko'py adarsah samupalabdhah, ata ekam adarsam angikstya asmabhir vivaranam kriyata iti, etad avagamya sutravisamvadadarsanac cittavyamoho na vidheya iti (Sutrakstangatika, folio 336-1, cited in Nandi.1968, Editors' note, p. 97 (4th group) fn.2).
Page #75
--------------------------------------------------------------------------
________________ Angas Parsvacandra, pupil of Sadhuratna, founder of Parsvacandra Gaccha in samvat 1572 [1515), Balavabodha (JRK 451). Two MSS listed CGRM 10-11. Printed. Suy.1880. Sadhuranga Upadhyaya, pupil of Bhuvanasoma and guru of Dharmasundara of the Kharatara Gaccha, Dipika, composed samvat 1599 [1542] (JRK 450-51; Schubring 1944, 6). Printed. Suy.1880; 1959-62 Harsakula, pupil of Hemavimala suri of the Tapa Gaccha, Dipika, composed samvat 1583 [1526), 6 600 granthas. Begins: pranamya Srijinam viram (JRK 450). Printed. Suy. 1880; 1959-62, Paryaya (BORI Cat.17:1, 51-53). 7 Editions: 1880 *Srisuyagadanga-sutra : dvitiyangam, tika tatha Balavabodha sahitam / Bhimasimha Manekakhya sravakem pritipurvaka prasiddha kodhum. Mumbapuri : Nirnayasagara Mudrayantra, samvat 1936. 1880.28 1020 p. ; 28 cm. (Raya Dhanapatisimha Bahadura ka Jainagamasangraha ; 2. = Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha; 2). [Winternitz 1933: 2, 438 nl; Schubring 1935, $45.2; Univ. of Chicago Library catalogue] 1880 (Emeneau 3919a; Josi 1987, 46). Preface and index by Bhimasimha Maneka (Guerinot 1906 $215). "In the Bombay edition (Suy.1880) the name of Pasacandra is mentioned only at the end of the second Srutaskandha ... The text of the commentary is modernized under the title of artha. Otherwise as a rule, it corresponds fairly closely with the wording of the MS [S. 3356, dated samvat 1606, probably the date of the copy from which this MS made" "The Bombay printed text of the Balavabodhal is more diffuse than this MS of the Balavabodha) but otherwise repeats it in a modern form," (CGRM 10-11). 1915 *Suyagadanga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1915. 587 p. ; 13 x 23 cm. Reprint Suy.1963. 1917 Srimacchilankacaryavihitavivarana yutam Srimatsudharmasvamiganabhrddrbdham Srimatsutrakrtangam. Mehesana : Agamodayasamiti, Virasamvat 2443. Vikramasamvat 1973. Kraistasya san 1917.427 [ie. 854) p. ; 12 x 27 cm. (Agamodaya Samiti series; no. 18). [CLIO 4, 2666; Tripathi 1975,91] Edited by Sagaracandra (Alsdorf 1958, 251). "[F]raught with corrupt readings and wrongly split up words at some places" (Jambuvijaya, Suy.1978, 67 (1st group)). "Pratayah 1 000." BORI Reprint. Suy.1950-53; 1978b. 1922-32 *[Suya-gadanga-sutra : satikanubhasantara) / lekhaka Muni Maneka. Ahmedabad : Union Printing Press, 1922. [Schubring 1935, $45.2; CLIO 4, 2666] Sanskrit chaya, meaning of text and Silanka's cty, Hindi translation of cty. 1. bhaga. 1,1 and 2. 1922. 38, 264 p. 2. 1,3-7. 1923. 12, 260 p. 3. sam. 1987 [1930]. 380 p. 4. sam. 1988 [1931] 308, 62 p. 5. Amadavada : Trikamalala Ugaracand, sam. 1989 (1932). 324 p. (Bollee 1977-88:1, 3; Josi 1987, 47). 1928 Suyagadam (Sutrakrtangam) : Vaidyovamsodbhavena Parasuramasarmana Niryukti pahantara-tippanyadibhih parisktam, tasyayam mulam Bhadrabahuviracita Niryuktis cetyetavan (prathamah khandah): the second book of the sacred canon of the Jains, for the first time critically edited, with the text of Niryukti, various readings, notes and appendices/ by P. L. Vaidya. Part 1 (Text and Niryukti) [all published). Poona : Motilala Ladhaji, 1928. [5], 152 p. ; 22 cm. (Arhatamataprabhakara ; 5). [Emeneau 3919; CLIO 4, 2666] 56
Page #76
--------------------------------------------------------------------------
________________ 1.2 Suyagada "The professedly critical edition of Suyagada by P. L. Vaidya ... is made at least as far as 1,4 is concerned without the slightest regard to (perhaps even without knowledge of) the metre" (Alsdorf, 1958, 250 n.5). The second part, with critical apparatus, appears not to have been published. Used as the base for Suy.Index.1995ab; 1996. [BORI] 1936-40 *[Sutrakrtangam: text with chaya, niryukti, vyakarana, anvaya, bhava and Silanka's Tika [Hindi translation by Ambikadatta Ojha]. 1. avrtti. Rajkota: Mahavira Jaina Jnanodaya Sosayani. Vikrama samvat 1993-97 [1936-40]. 4 v. ; 25 cm. [JSBI 1, 127n; Bollee 197788:1, 3] 1956 1. srutaskandha. Rajakota : Vikrama samvat 1993-95. v. 1 adhyayana 1-2, 1937. 38, 300 p. v. 2 adhy. 3-9, 1938. 411 p. v. 3 adhy. 10-15, 1938. 280 p. v. 4 2. srutaskandha, Bangalora: Karma Sambulala Gangarama Mutha, Vikrama samvat 1997 [1940] (or 1941 (Josi 1987, 46)) (JSBI 1, 127n). 1950-53 Srimatsutrakrtangam : Srisudharmasvamisandrbdham; Sribhadrabahusvaminirmitaniryuktiyutam, tadvrttikarasrimacchilankacaryavihitavivaranasusobhitam, vividhapratyantaratippanadyalankrtam ca / samsodhakah sampadakasca Srimadacaryacandrasagarasurivarah. Mumbai: Srigodiparsvanathajainaderasarapedhi, Virasamvat [2476?]-2479 [1950-53]. 2 v.; 13 x 28 cm. (Srigodiparsvajainagranthamala; saptamampuspam). [Description from 2. vibhagah.] Dvitiyo vibhagah: 12, 189 [ie. 24, 378] p. Virasamvat 2479. Vikrama samvat 2009. Kraistabda 1953. Dvitiya srutaskandha. Contents v. 2: Sriprakasikanum nivedana 2a-2b.-Anukramanika 3a.-Srisutrakrtangasya dvitiyo vibhage suddhipatrakam 3a-4a.-Srisutrakrtangasutre dvitiyasrutaskandhe-dvitiyavibhage sastraprastavana / Candrasagara 4b-12a.-Srimatsutrakrtangam 2. Paundarikadhyayanam-... [1a]-189b. Second impression [Auflage] of Suy. 1917, "... footnotes contain readings from palmleaf manuscripts in the Santinath Bhandar, Cambay (A and A2) (in Vijayakumud-suriji's Sucipattra dabdo 45 and 62 respectively) written in samvat 1327 and 1349 respectivelyand a paper manuscript in the same Bhandar (I) (Sucipattra page 44 dabdo 2)" (Bollee 1977-88:1, 3). ANU BL1312.3.S886 1953 [sic, 2. vibhaga only held] 1953-54 Suttagame /carimatitthayara-pancamaganahara-Suhammayariyaviraie ; [sutthuruvena] Pupphabhikkhuna sampadio. 1. avrtti. Gudagamva-chavani, Purvapanjaba: Sirisuttaamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 1953-54. 2 v.; 19 cm. Suyagadam v.1, 101-182. "I also compared the new Sthanakvasi edition [ie. Suttagame] ... but found that the text of 1,4 is identical with that of [Suy. 1928] [apart from two small differences]. [Suy. 195053; 1928 and 1920] may be said to represent a vulgate; their real differences ie. genuine variants, are comparatively few" (Alsdorf 1958, 251). ANU BL1310.S8 1954 2 v. *Sri Suyagaranga sutra / sampadaka Umesacandraji Maharaja 'Anu.' Sailana, MadhyaPradesa : Sri Akhila Bharatiya Sadhumargi Jaina Samskrti Raksaka Sangha, 2013 [1956]. 12, 426 p.; 19 cm. [LC catalogue] 1959-62 Srisuyagadangasutram: Sadhurangaganisankalitaya Dipikaya samalankrtam/sampadakah Buddhisagaro Ganih. Surat: Sresthi-Devacandra-Lalabhai-Jaina-pustakoddharasamsthayah, 2485-89 Vikramabdah 2015-19. Khristabdah 1959-62. 2 v. ; 13 x 28 cm. (Sresthi-Devacandra-Lalabhai-Jainapustakoddhare; granthankah 109, 110). Added title page: "Shree Suyagadang Suttra." Contents v.1: Prakasakiya nivedana 3a-5a-Abhimata Kavindrasagara 5b-6b.Kincitprastavikam [7a]-7b. - Parisista 1. Mulasutranam akaradyanukramah 8a-16b.-- Parisista 2. Dipikagata subhasita gadya-padyasangrahah 16b-19b.-Samanya suddhipatrakam 19b-Suyagadangasutram [1. srutaskandha] 1a-165b. 57
Page #77
--------------------------------------------------------------------------
________________ Angas 1963 Contents v.2: (2. srutaskandha) Details of other publications) 1-8.--Prakasakiya nivedana 3a-b.-Nivedana / Muni Mangalasagara la-3a.-Parisista 1. Mulasutranam akaradyanukramah 3b-9b.-Parisista 2. Dipikagata-subhasita-gadya-padya-sangrahasyakaradyanukramanika 100-125.-Suyagadangasutram la-166a.-Sutrakstanga-sutra-dipika / Harsakulagani racita la-28a.-Prasasti (13 verses, samvat 1583 [1526] 8a-b. Includes Dipika (written 1599) and Harsakula's Dipika on Suy. 1,1,1-4 "Pratayah 500." ANU BL1312.3.588 1959 [2 v. bound as 41 *1 Sutrakrtanga Sutra / edited by Muni Sri Kalvanarsiji and Sobhacandra Bharilla. Dhuliya, 1963. (Amolakarsiji Maharaja Smaraka granthamala ; puspa sankhya 68). [Bollee 197788:1, 3] Reprint of Suy.1915. *Sri Sutrakrtranga sutra / Vinodakumara. Rajakota : Jayabharata Presa, Vira samvat 2491 [1965]. 19, 396 p. ; 25 cm. Contents: Anukramanika [2]. [Donor details).-Nivedana [5]. - Prastavana (6-7).Vinodamuninum sanksipta jivana caritra [9]-17.-Sutrakstanga sutram [1]-396. "Prata 1 000." ANU BL1312.3.5884G8 1965 1965 1969-71 Sri-Sutrakstangasutram/Ghastlala-vrativiracitaya Samayarthabodhinyakhyaya vyakhyaya samalankstam Hindi-Gurjara-bhasa'nuvadasahitam. Prathama-avsttih. Rajakota, Saurastra : Sri A[khila). Bha[ratiya). Sveltambara). Sthanakavasi Jaina Sastroddhara Samiti, Vira samvat 2495<< >. Vikrama 2025<< >. [1969-71). 4 v. ; 25 cm. (Josi 1987,48] 1. bhagah, 1. Srutask. adhy. 1-2, Vira samvat 2495 [1969). 12, 689 p. 2. bhagah, adhy. 3-8, Vira samvat 2496 [1969). 714 p. 3. bhagah, adhy. 9-16, 1970. 584 p. 4. bhagah, 2. srutask. 1971. 784 p. "Prati 1200." ANU PK 5003.A52 S8 1969, v.1, v.2 only 1974 *Srimatsutrakrtanga-sutram : mulam / sampadakah samsodhakasca Jinendravijaya Gani. Lakhabavala-Santipuri, Saurastra, 1974. 142, 254 p. (Agama-sudha-sindhu) (Sri Harsapuspamrta Jaina granthamala ; 54). University of Tubingen: Signature 28 B945-1,2 1974 or 1975 Angasuttani : Niggantham pavayanam / sampadaka Muni Nathamala [Yuvacarya Mahaprajna). Ladanum, Rajasthana : Jaina Visva Bharati [Samsthana), Vikrama samvat 2031 [1974 or 1975). 3 v. ; 25 cm. Suyagado v.1, [251]-486. [v. 2. Dvitiya samskarana. Vikrama samvat 2049. 1992.) "Original text critically edited" on the basis of six MSS--two from the Ghevara library Sujanagarha, 'Ka.' samvat 1581 and Kva.' samvat 1663; three from the Gadhaiya library Saradasahara, Kha' undated but from the 17th cent. samvat, *Kva.' samvat 1512, and Vr.' samvat 1525--Suy.1950-53 and Suy.Cu.1950. Described on p. 23-25 (1st group). Page numbers in the margins refer to Suy.1950-53. Parts 1-3 of a complete edition of the canon. ANU PK5003.A52 1974 3 v. and BL1312.2 1975 3 v. 1975 1978a *[Text with Hindi meaning and explanation (vivecana) / by Acarya Atmarama ji Maharaja.) Ludhiyana : Acarya Sri Atmarama Jaina Prakasana Samiti, Vikrama samvat 2032 [1975). [Devendra Muni 710 no. 9] Reprint.(details of original edition not traced). Suyagadangasuttam= Sutrakstangasutram : Pancamaganaharabhayavamsirisuhammasamiviraiyam biiyam Angam/sampadakah Muni Jambuvijayah, sahayaka Muni Dharmacandravijayah. Bambai : Sri Mahavira Jaina Vidyalaya, Vira samvat 2504 (1978). 11, 82,376 p.; 25 cm. (Jaina-Agama-granthamala, granthanka 2 (2)). Contents: Prakasakiya nivedana [9]-11.-Abhara [12].-Rnasvikara [13].--Jinaagama jayakara : prastavana [Gujarati] / Muni Jambuvijaya [1]-44. = Amukham (Sanskrit] / Muni Jambuvijaya 45-54. = Foreword/Muni Jambuvijaya (55)-69.-Samanyasanketavivaranam [71].Sampadanopayuktagrantha sucih 73-76.-Sutrakstangasutrasya visayanukramah [77]-82.-Suyagadangasuttam [1]-258.-1. parisistam. Visistasabda 58
Page #78
--------------------------------------------------------------------------
________________ 1978b 1.2 Suyagada sucih. [1] Sutrakrtangasutra[suyagadangasutta]-prathamsrutaskandhantantargatavisistasabdasucih [259]-302.-[2.] Sutrakrtangasutra [suyagadangasutta]dvitiyaSrutaskandhantantargatavisistasabdasucih 303-44.-2. Sutrakrtangasutrantargataslokanam akaradikramah [345]-354.-3. Katipayani visistani tippanani [355]-373.Suddhi-vrddhipatrakam [374]-376.-Prastavananum suddhivrddhipatraka 376. Based on seven MSS, three on palm-leaf-Kha. 1' and 'Kha. 2' from the Sri Santinatha Talapatra Jaina Jnana Bhandara, Cambay, Cambay catalogue no. 6 and no. 7 (samvat 1349); 'Pa.' Sangahavipada Jaina Jnana Bhandara, Patan, now in the Sri Hemacandracarya Jaina Jnanamandira, Patan, serial no. 31 (3), Patan catalogue no. 397 (1-2) (samvat 1468)-four on paper in the L. D. Institute 'Pu. 1' no. 8402 (samvat 1718), 'Pu. 2' no. 8363, (16th cent. samvat) and 'La. 14 528' (samvat 16th cent.); 'Sam.' Samvegi Upasraya, Hajapatel Pole, Ahmedabad, no. 3 678 on the list (16th-17th cent. samvat) and Suy.1917, although that "edition is fraught with corrupt readings and wrongly split up words in some places." MSS described in Introduction, 66-68 (1st group)). Some of these MSS have also been used for Suy.partial edition. 1975. ANU PK5003.A52S88 1978 Acarangasutram Sutrakrtangasutram ca / Srimatsudharmasvamiviracitam ; Bhadrabahusvamiviracitaniryukti-Srisilankacaryaviracitatikasamanvitam; sampadakah samsodhakas ca Acaryamaharajasrisagaranandasurisvarab. Munirajasripunyavijayajimaharaja sangrhitapracinasamagryanusarena suddhi-vrddhipatrakadivividhaparisistadibhih pariskarta Munih Jambuvijayah, sahayako Munih Dharmacandravijayah. Dilli : Motilala Banarasidasa Indolajika Trasta, 1978. 42, 288, 400 [72] p. ; [1] leaf of plates; port. ; 29 cm. (Lala Sundaralala Jaina Agamagranthamala; bhaga 1). Contents: Prakasaka-vijnaptih.-[plate of Lala Sundarlal Jain (15 Feb. 1900-23 Jan. 1978)]-Lala Sundaralala Jainah [Sanskrit] [7]-8.-Lala Sundarlal Jain [English] [9]10. Samarpanam.-Prastavana-parisistopayuktagranthasucih sanketavivaranam ca [14 15]. Prastavana / Muni Jambuvijaya, Vikramasamvat 2033, 10 Nov. 1977, Vava (Jila Banasakamtha, Uttara Gujarata) [17]-42.-... Acarangasutrasya visayanukramah [1]-16.-- Sriacarangasutram [1]-288.-Sutrakrangasya visayanukramah [1]-14.-Srisutrakrtangam [1]-285. Silankacaryaviracitavivaranasamanvitasya Sriacarangasutrasya parisistani : Vrddhipatrakam = Addenda & corrigenda [289]-305.-Suddhipatrakam 305-20.Acarangasutrasya Silacaryaviracitavrttavuddhrtah pathab [321]-326-Acarangasutranam gadyarupanam akaradikramah [3271-332.-Acarangasutrantargatanam gathanam akaradikramah [333]-335.-Acarangasutrasya Niryuktinam akaradikramah [336]-341.Silangacaryaviracitavivaranasamanvitasya Srisutraktangasutrasya parisistani: Srimacchilankacaryaviracitayah Sutrakrtangatikaya vrddhipatrakam [345]-357.Srimacchilankacaryavihitavivaranayutasya Sutrakrtangasutrasya suddha visista va pathah [358]-378. Sutrakrtangasya Silacaryaviracitavrttav uddhrtah pathah [379]-385.Sutrakrtangasya gadyarupanam sutranam akaradikramah [386]-387.-Sutrakrtangasutrasya gathanam akaradikramah [388]-400. Reprint in bound format of Ayar. 1916. de Jong 1979-81 Sri Sutrakrtangasutra : Ganadhara Sri Sudharma-pranita dvitiya Anga : mula-chayaanvayartha-bhavartha evam Amarasukhabodhini vyakhya samanvita / anuvada aura vyakhya Hemacandra Ji Ma[haraja]; sampadaka Amara Muniji (pradhana sampadaka); Munisri Nemicandra Ji (saha-sampadaka). 22 cm. Manasa Mandi, Panjaba : Atma-Jnanapitha-JainaDharmasala, Vira samvat 2500- [sic] [1979-81]. 2 v. ; 22 cm. v.1 Prathama srutaskandha. 44, 996 p. v. 2 Dvitiya srutaskandha. 1-16, i-iii, 17-31, 454 p. Contents v.1: Prakasakiya [7]-8.-[Donor details 9]-10.-Abhara-darsana/Amara Muni [11]-12. Sutrakrtanga sutra: eka anucintana/Vijaya Muni [13]-22.-Sahayoga ke do Sabda [23]-25.-Mangala bhavana [26]-27.-Subhasamsa [28]-29.-Visayanukramanika [32]-44. Sutrakrtanga sutra [1. srutaskandha]: mula-anvayartha-bhavartha Amarasukha bodhini vyakhya sahita [1]-996. Contents v.2: Mahana Tapoyogi Svami Sri Jayaramadasaji Ma. jivana paricaya [7]10. [plates of Jayaramadasa, another of Amara Muni]-Prakasakiya [11]-12.-- 59
Page #79
--------------------------------------------------------------------------
________________ Angas Sammatiyam [14]-16.-Foreword / B. Bhatt [i]-iii.-Sampadakiya [17]-18. - Sutrakrtanga sutra : eka adhyayana / Vijayamuni (19)_28.-Visaya-suci [29]-31.Sutrakstanga sutra : [2. srutaskandha) [1]-454. The text is apparently identical with that of Suy. 1950-53 and Suy. 1928 (Bollee 197788:2, 2). ANU BL1312.3 S882 H5 1979 2 v. 1982 Sutrakstangasutra : Panicama Ganadhara Bhagavat Sudharmasvami-pranita dvitiya Anga : mula patha, Hindi anuvada-vivecana-tippana-parisista yukta / samyojaka tatha pradhana sampadaka Sri Misrimala ji Maharaja 'Madhukara'; sampadaka-anuvadaka-vivecaka Sricandra Surana "Surasa'. 2 v. ; 26 cm. Byavara, Rajasthana; Sri Agama Prakasana Samiti, Vira Nirvana samvat 2508 [1982]. (Jinagama granthamala, granthanka 9, 10). v. 1:45, 515 p.--v. 2: 16, 264 p. Contents v. 1: Prakasakiya [7].--Sahayogi-satkara [8].-Adi vacana / Misrimala *Madhukara'19-12. Sampadakiya (131-16.--Prastavana /Vijaya Muni[1]-35. [Donor list 36-39.-Visaya-suci [40] 45.-Suyagadanga suttam [1. suyakkhandho) (1) 458.Parisista 1. Gathaom ki anukramanika 461-70.-2. Visista sabda suci 471-506.-3. Smaraniya subhasita 507-09.-4. Sutrakstangasutra ke sampadana-vivecana mem prayukta grantha-suci (mentions Suy. 1936-40; 1969-71; 1978a; 1979] 510-15. Contents v. 2: Prakasakiya [7]. [Donor details 8).-Sampadakiya / Sricanda Surana [9]-13.-Visayanukramanika [14]-16.-Suyagadangasuttam [2. suyakkhandho] [1]217.-Parisista 1. Sutrakstangasutra dvitiya srutaskandhantargata gathanam akaradikrama 221-22.-2. Sutrakstangasutra dvitiya srutaskandhantargata visista sabdasuci 223-56.Anadhyayakala [[Nandi.1966c, 7-9 se uddhrta 257-59).- [Donor details 261|-264. ANU PK5003.A52 587 1982 v.1, v.2 1984-86 Suyagado: mulapatha, Samskrta chaya, Hindi anuvada, tippana tatha parisista / sampadaka vivecaka Yuvacarya Mahaprajna, anuvadaka Muni Dulaharaja. Ladanum (Rajasthana): Jaina Visva Bharati, 1984-86. 2 v. ; 29 cm. v. 1:35, 661 p.--v. 2: 19, 418 p. Contents v.1: Antastosa / Acarya Tulasi [9].- Prakasakiya (11).-Sampadakiya / Yuvacarya Mahaprajna [13]-15.-Bhumika / Acarya Tulasi [17]-30.-Visaya suci (31)35.-Suyagado : mulapatha, Samsksta chaya, Hindi anuvada, tippana : 1. srutaskandha 111-625.-Parisista 1. Tipppana-anukrama 630-45.-2. Padanukrama 646-51.-3. Sukta aura subhasita 652-56.-4. Upama 657-58.-5. Vyakarana vimarsa 659-61. Contents v.2: Antastosa / Acarya Tulasi [9].- Prakasakiya [11].Sampadakiya / Yuvacarya Mahaprajna [13]-15.-Visaya suci [17]-19.-Suyagado : mulapatha, Samskrta chaya, Hindi anuvada, tippana: 2. srutaskandha [1]-390.-Parisista 1. Tipppanaanukrama (393)-98.-2. Padanukrama [399)-400.-3. Sukta, subhasita, upama adi 14011-4. Visesanama-varganukrama: 1. tatha 2. srutaskandha ka samyukta (402)-13.Varga-anukrama (415)-18. ANU (BL1312.3.588 1984 v. 1, v. 2 Partial editions: 1898 *Jaina jnana prakasa = Jaina-jnanaprakasa (Part I) Amadavada, 1898. 155 p. [A Supplementary catalogue of Marathi and Gujarati Books in the British Museum / by J. F. Blumhardt. London: British Museum, 1915. (... Gujarati printed books, column 93)] "Comprising the Sanskrit (sic) text of the Sutraksidanga, I. vi., and II. vi.; Uttaradhyayana L.i.; Gujarati translations and notes to the preceding, and Gujarati catechism, appendices on Jain doctrine, etc." (reference as above). 1958 Alsdorf, Ludwig. Itthiparinna: a chapter of Jain monastic poetry, edited as a contribution to Indian prosody. IIJ (1958) 2:249-70. [Reprinted. Kleine Schriften 1974, 193-270) Contents: Text 253-56-Critical apparatus 256-58-Translation 258-61.--Notes 262-70. Text with new translation and notes of Suyagadanga 1.4 using the following editions for the critical constitution of the text: Suy.1950-53 [containing readings of the first edition 60
Page #80
--------------------------------------------------------------------------
________________ 1.2 Suyagada by Sagarananda = Suy.1917); 1928; 1920 and Suy.Cu.1950. He has compared the text of the 1953-54 edition and found it to be almost identical but for two minor differences. See also Bruhn 1996, 38. Translated into Gujarati: Itthiparinna : Bharatiya chandahsastrana pradhana tarike sampadita karelum Jaina sadhujivanane lagata kavyanum eka prakarana / Arunodaya Na. Jaini. Sri Mahavira Jaina Vidyalaya Suvarnamahotsava grantha. Bombay : Sri Mahavira Jaina Vidyalaya Prakasana, 1968. p. 237-50. ANU BL1305.57 1968 v. 1 1975 Suyagadangasuttam: pancamaganaharasirisuhammasamivayananugayam biiyamangam : Siribhaddabahusamiviraiyae Nijjuttie painatherabhadantaviriyae Cunnie ya samjuyam Prathamo bhagah / samsodhakah sampadakas ca Munipunyavijayah. Ahamadabada : Praksta grantha parisad, Virasamvat 2501 [1975] 248 p. ; 28 cm. (Prakstagrantha parisad granthanka; 19). Contents v.1: Granthanukramah (5).--Pratiparicaya / Amrtlala Mohanalala Bhojaka [6]8.-Sanketasucih [9]-10.-Suyagadangasuttam (1)-248 p. Edition based on four MSS and one printed edition of the sutra--(sources 1 and 2) in *Kham.l' palm-leaf from Sri Santinathaji Jaina Jnanabhandara, Khambhata, no. 6 in the Cambay catalogue (1961-66), samvat 1327 [1270]; (3 and 4) in Kham 2 (no. 7 in the Cambay catalogue (1961-66), samvat 1349 [1292); (5) Pu. 1'L. D. Institute, paper, (no. 8402), samvat 1714[1657); (6 and 7) *Pu. 2'L. D. Institute, (no. 8363) three of the niryukti; (8) Suy.1917--and three MSS and one printed edition of the Curni--(9) "Va.' Sri Hemacandracarya Jaina Jnanamandira, Patana, paper, listed as no. 6548, samvat 1414 113571: (10) 'Mo' paper, same place as (9), list no. 9991, 16th cent. samvat; (11) 'Sam.' in the same place as the previous two, list no. 843, about 15th cent. samvat; (12) Suy Cu.1941 and (12) 'Pu.' a MS about which the details could not be determined [Bhojak seems to have worked up Punyavijaya's earlier work into this edition). Described on p. 6-8. The Suy Cu.1941 text is very corrupt, compared with this edition, the one corrected by ... Punyavijaya [ie. Suy.Partial edition. 1975) is flawless" (Jambuvijaya, Suy.1978, 65 (1st group)). Unfortunately the second srutaskandha is still in manuscript form" (Suy. 1978, Intro. 65n). "As Pt. Dalsukh Malvania wrote to me, the state of the MS (of Punyavijaya's work on the second srutaskandha) does not allow for a critical edition to be made" (Bollee 1995, 119). ANU LARGE BOOK PK5003.A52588 1975 1977-88 Studien zum Suyagada : die Jainas und die anderen Weltanschauungen vor der Zeitenwende: Textteile, Nijjutti, Ubersetzung und Anmerkungen/Willem B. Bollee. Wiesbaden : Franz Steiner, 1977-88. 2 v. ; 24 cm. (Schriftenreihe des Sudasien-Instituts der Universitat Heidelberg : Band 24, 31). Teil 1. x, 218 p.--Teil 2. viii, 301 p. Contents v.1: Vorwort (viil-viii.-Verzeichnis der Abkurzungen [ix-x.-Einleitung [1]10.-Suyagadanga-nijjutti [text v.1-35) (11)-13. - Suyagadanga [text of 1,1,1; 1,1,2; 1,1,3; 1,1,4; 2,1] [14]-28.--Suyagadanga-nijjutti [analysis and discussion v. 1-32] 29-52.-Suyagadanga 1,1,1 etc. (translation into German and notes) (53)-164. - Literaturverzeichnis [165]-178.-Wortregister [179]-197.- Pada-Index [198]-201. - Rucklaufiger Pada-Index 201-204.--Sachindex [205]-14.-Zitate [215]-18.-Nachtrage [219]. Contents v.2: Inhaltsverzeichnis [vii].-Vorwort (vil-vii.-Verzeichnis der Abkurzungen [ix].-Einleitung (1)-2. - Suyagadanga-nijjutti [text v. 36-61] [3)-5. - Suyagadanga 1,2,1; 1,2,2; 1,2,3; 1,3,1; 1,3,2; 1,3,3; 1,3,4; 1,4,1; 1,4,2 [6]-24. -Suyagadanga-nijjutti (analysis and discussion) v.36-41 (25)-27. - Suyagadanga 1,2,1; 1,2,2; 1,2,3 [28]-82. 61
Page #81
--------------------------------------------------------------------------
________________ Angas -Suyagadanganijjutti (analysis and discussion) v.45-50 [83]-85. - Suyagadanga 1,3,1; 1,3,2; 1,3,3; 1,3,4 [86]-139. - Suyagadanganijjutti (analysis and discussion) v.54 61 (140)-43. -Suyagadanga 1,4,1, 1,4,2 (144)-86. - Literaturverzeichnis [1871-197.-Wortregister des Suyagada [198]-224. Pada-Index 12251-233.-Rucklaufiger Pada-Index [234]-242.-Nijjutti-Glossar (243)-250.Sachindex (251)-258.--Stellenverzeichnis BSS. II [259]-266.--Zitate [267]-273.Nachtrage BSS. I [274]-286.--Stellenverzeichnis BSS. I [287]-293.-Sachindex zu W. Bollee >> Traditionell-Indische Vorstellungen<< (BAVA 5 (1983) 227-81) [294]-297.Corrigenda [298]-299.--Nachtrage BSS. II [300]-301.- Nachtrage zum Stellenverzeichnis BSS. II [302]. Reviews. (1)J. W. de Jong. (Teil 1) II/22 (1980) 75-77.--(2) K. R. Norman. Suyagadamga studies IJ WZKS 25 (1981) 195-203.-Suyagadamga studies II, WZKS 36 (1992) 23- 33.--(3) Colette Caillat. Studien zum Suyagada 1977. Numen 26 (1979) 106-110--(4) Adelheid Mette. See also Herman Tieken's criticisms of too much influence from the traditional commentaries and a retranslation of Suy. 1.1.1.1-11a in "Textual problems in an early canonical Jaina text" WZKS 30 (1986) 5-25. ANU BL1312.3.5886 B64 v.1, v.2 Translations: English: 1895 Gaina Sutras : Part 2: The Uttaradhyayana Sutra. The Sutrakritanga Sutra / translated from Prakrit by Hermann Jacobi. Oxford, Clarendon Press, 1895. xli, 456 p. ; 22 cm. (Sacred Books of the East; 45). Contents: Introduction (xiii)-xli.--Uttaradhyayana [1]-232.-Sutrakritanga (235)-435.Index of names and subjects (437) 442.-Index of Sanskrit and Prakrit words occuring in the text and the notes (443) 451. Correction [to p. 102] 451. "Jacobi's translation, an admirable pioneer work, was--unavoidably in his time--entirely based on Silanka's Tika and two younger commentaries. That these commentaries are even now indispensible, but on the whole anything but reliable guides; that in many clear cases their explanations betray complete ignorance of the real meaning of a word or passage while in many difficult places they fail us altogether will hardly be disputed today" (Alsdorf, Itthiparinna 1958, 250). Reprint. 2. ed. Delhi : Motilal Banarsidass, 1964.-3. ed. New York : Dover, 1968. ANU BL1010.53 v.45 Gujarati:3 1880 (Suy. 1880) 1936 *Mahavira svamino samyamadharma / sampadaka Gujarati anuvadaka Gopaladasa Jivabai Patela. 1. avitti. Ahmadavada : Jaina Sahitya Prakasana Mandala, samvat 1992 [1935). 15, 252 p. ; 18 cm. (Punjabhai Jaina granthamala ; 10). [Josi 1987, 52). Reprint 1950. "1950" *Mahavirasvamino samyamadharma : Srisutrakstangasutrano chayanuvada / Gopaladasa Jivabhai Patela (?). Navi avstti. Ahmadabada. (Punjabhai Jaina granthamala; 10). (JSBI 1, 217 item r; Naya. Guj.trans. 1950 series list on end-paper) First published 1936. 1965 Vinodakumara (Suy. 1965) 1969-71 Ghasilala (Suy.1969-71) 3 Translation of "Suyagada sutra Dipika, Dasavaikalika (in two parts) / by Sriman Mohanlalaji Jaina Svetambara Jnana Bhandar." (Dasave. 1921-30, 160, advertisement). No further details traced. 62
Page #82
--------------------------------------------------------------------------
________________ 1.2 Suyagada 1975 *Sutrakrtanga sutra : Gujarati anuvada / Pranakurhvarabar, Usabat ; sampadaka Sobhacandra Bharilla. 1. avrtti. Mumbai : Prema Jinagama Samiti, 1975. 253 p. ; 25 cm. (Prema Jinagama Prakasana; 2). [Josi 1987, 50] Hindi: 1915 Amolaka Rsi (Suy.1915) 1936-40 Ambikadatta Ojha (Suy.1936-40) 1938a *[Sutrakrtanga / Hindi chayanuvada Gopaladasa Jivabhai Patela (?)] Bambai : Svetambara Sthanakavasi Jaina Kanphrensa, 1938. [JSBI 1, 127n item; Josi 1987,52] Perhaps based on the same author's 1936 Gujarati translation. 1938b *[Sutrakrtanga / Hindi anuvadaka Pyaracandaji. Ratlama : Jainodaya Pustaka Prakasaka Samiti, 1938. samvat 1995 [1938]. 196 p. [Josi 1987, 49) 1961 Ganadhara Sudharmacarya viracita Sutrakrtanga-Hindi/anuvadaka Srirahula Sarkstyayana. 1. samskarana. Dehali : Samrat Presa, Virabda 2487. Vikramavatsara 2018. Kraistasan 1961. 160 p. ; 19 cm. Contents: Kitajnata prakasa (3).- Abhara pradarsana (41.-'Suttagame' ke bare mem kucha avasyaka nivedana (general remarks on Jain canonical literature] 5-8.Prakasakiya 8-16. Bhumika / Rahula Saikrtyayana 1-9. Visaya-suci [10]-12.Sutraktanga [translation only![1]-147.-Parisista. Bauddha granthom mem Bhagavan Mahavira (148)-150.-Namanukramani [151]-153. Sabdanukramani [154]-160. Univ. of Poona Q31:21112 / 15231 / 94818 1969-71 Ghasilala (Suy.1969-71) 1975 Atmarama (Suy.1975) 1979 Hemacandra (Suy.1979) 1982 Sricandra Surana 'Surasa' (Suy.1982) 1984-86 Muni Dulaharaja (Suy.1984-86) Partial translations: English: 1999 Adda or the oldest extant dispute between Jains and heretics (Suyagada 2,6) : part two /W. B. Bollee. Journal of Indian philosophy 1999 (27) 411-437. Translation of Suy. 2.6 v.26-55. Part one of this article is forthcoming in the Felicitation volume for Muni Jambuvijaya (Ahmedabad, 1998 ) which has not yet appeared (Dec. 1999). German: 1926 Partly translated in: Worte Mahaviras : kritische Ubersetzungen aus dem Kanon der Jaina / Walther Schubring. Gottingen : Vandenhoeck & Ruprecht, 1926. ix, 152 p. (Quellen der Religionsgeschichte. Bd. 14, Gruppe 7). Suy. I, 1 Verstandigung p. 122-29 Suy. I, 2 Neue Weise p. 130-37 Suy. I, 3 Absage an die Versuchungen p. 138-44 Suy. I, 4 Absage an die Frauen p. 14549 Suy. I, 12 Die Plattform p. 150-52 Suy. II, 1 Der Lotus p. 27-41 Suy. II, 2 Die Arten des Tuns p. 42-65. ANU BL1310.59 1958 Chapter 4 / Alsdorf. (Suy.partial edition.1958). Translated into Gujarati 1968. 1977-88 W. B. Bollee (Suy.1977-88). Includes text and translation of first 61 stanzas of the Nijjutti. 1986 (Herman Tieken, Suy.Study.1986) Re-translation of Suy.1.1.1.1-11a. Gujarati: 1898 (Suy.partial edition.1898)
Page #83
--------------------------------------------------------------------------
________________ Angas 1899 1947 *[Suyagadangasutra bhasantara : prathama srutaskandha / Gujarati anuvadaka Sa. Tribhovanadasa Radhanathadasa. 1. avitti. Ahmadavada : Sa. Tribhovanadasa Rudhanathadasa, 1899. 204 p. ; 18 cm. (Josi 1987, 48] *Suyagadanga sutra : Pundarikadhyayana : Gujarati vyakhya / Anandasagara Suri. 1. avrtti. Ratalama : Rsabhadeva Kesarimalaji Pedhi, 1947.58, 345 p. ; 25 cm. [Josi 1987,52] Translation of Suy.partial edition.1958 into Gujarati: Itthiparinna : Bharatiya chandahsastrana pradhana tarike sampadita karelum Jaina sadhujivanane lagata kavyanum eka prakarana/ Arunodaya Na. Jaini. Sri Mahavira Jaina Vidyalaya Suvarnamahotsava grantha. Bombay: Sri Mahavira Jaina Vidyalaya Prakasana, 1968. p. 237-50. ANU BL1305.57 1968 v. 1 1968 Studies: Bollee, W.B. 1990. *Ayaranga 2,16 and Suyagada 1,16. Journal of Indian philosophy 18 (1990) 29-52. [Bollee 1995, 183] Bollee, W. B. (forthcoming). *[Suyagada 2,16). pt. 1 (Festschrift Jambuvijaya), pt. 2 Journal of Indian philosophy (personal communication 5 August 1999) Dixit, K. K. 1978a. Some noteworthy features of the Jaina speculation as occuring in Acaranga I and Sutrakstanga I. In, Early Jainism. Ahmedabad : L. D. Institute of Indology, 1978. 8,99 p. ; 25 cm. (LD series ; 64), p. 9-21. ANU BL1351.2 .053 Dixit, K. K. 1978b. Sutrakrtanga II : a historical evaluation. In, Early Jainism. Ahmedabad : L. D. Institute of Indology, 1978. 8, 99 p. ; 25 cm. (LD series ; 64), p.[34] 41. ANU BL1351.2.D53 Ghatage, Amrit Madhav. 1936. The Sutrakstanga Niryukti. Indian historical quarterly 12 (1936) 270 81. Herman Tieken. 1986. Textual problems in an early canonical Jaina text WZKS 30 (1986) 5-25. Criticism of aspects of 1. Teil of Bollee (Suy.Partial edition. 1977-88), includes a retranslation of Suy. 1.1.1.1-11a. Indexes: 1959-62 (Suy.1959-62) v.1 (1. srutaskandha): Parisista 1. Mulasutranam akaradyanukramah p. 8a 16b.v.2 (2. srutaskandha): Parisista nam. 1. Mulasutranam akaradyanukramah 3b-9b. 1974 or 1975 (Suy.1974 or 1975) indexed in Agama sabdakosa : angasuttani sabdasuci = Word-indexes of Argasuttani/ sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2037. <1980-> ; 25 cm. 1978 (Suy.1978a) 1. parisistam. Visistasabdasucih. [1] Sutrakstangasutra[suyagadangasuttal prathamsrutaskandhantantargatavisistasabdasucin p. [259]-302.-[2.] Sutrakstangasutra[suyagadangasutta]dvitiyasrutaskandhantantargatavisistasabdasucih 303-44.-2. Sutra kstangasutrantargataslokanam akaradikramah (345)-354. 1982 (Suy.1982) v.1 (1. srutaskandha): Parisista 1. Gathaom ki anukramanika p. 461-70.-2. Visista Sabda suci 471-506.--v. 2: Parisista 1. Sutrakstangasutra dvitiya srutaskandhantargata gathanam akaradikrama 221-22.-2. Sutrakstangasutra dvitiya srutaskandhantargata visista sabdasuci 223-56. 1984-86 (Suy.1984-86) v.1 (1. srutaskandha): Parisista 2. Padanukrama p. 646-51.-v.2 (2. srutaskandha): Parisista 2. Padanukrama (399)-400. 1995a Suya gada : pada index and reverse pada index / Moriichi Yamazaki and Yumi Ousaka. Tokyo: The Chuo Academic Research Institute, 1995. iii, 119 p. ; 30 cm. (Philologica Asiatica : Monograph series ; 4). 64
Page #84
--------------------------------------------------------------------------
________________ 1.2 Suyagada Based on Vaidya's edition (1928). Index integrated into 1995b below. Review: BEI 11-12 (1993-94), 467-68. RW 1995b A Pada index and reverse pada index to early Jain Canons : Ayaranga, Suyagada, Uttara jijhaya, Dasaveyaliya, and Isibhasiyaim/ by Moriichi Yamazaki and Yumi Ousaka. Tokyo : Kosei Publishing Co., 1995. 537 p. 23 cm. Integrates separate index published as 1995a above. Review: "[L]es editions de la Jaina-Agama-Series ne sont toujours pas prises en compte et aucune explication n'est fournie a ce fait ... On continue aussi a regretter qu'aucune indication abregee ne figure pour caracteriser le metre des pada. Toutefois, tel qu'il est, ce volume fait un instrument de travail extremement utile." Nalini Balbir BEI 13-14 (1995-96), 543. RW 1996 Suya gada : word index and reverse word index / Moriichi Yamazaki and Yumi Ousaka. Tokyo: The Chuo Academic Research Institute, 1996. ii, 121 p. ; 30 cm. (Philologica Asiatica : Monograph Series ; 9). "The indexes present every word and word group as they appear in the text (of Vaidya's partial edition, Suy.partial.1928.)." (Introduction, p. i). Review: Nalini Balbir BEI 13-14 (1995-96) 544 45. RW 1999 A word index and reverse word index to early Jain canonical texts : Ayaranga, Suyagada, Uttarajjhaya, Dasaveyaliya, and Isibhasiyaim/Moriichi Yamazaki and Yumi Ousaka. Tokyo: The Chuo Academic Research Institute, 1999. iii, 410 p. ; 30 cm. (Philologica Asiatica : Monograph series ; 15). The 1996 index integrated with those for other texts with additional material from Suy.partial edition.1958 (Alsdorf) and Suy.partial edition.1977-88 (Bollee) (see p. iii). RW
Page #85
--------------------------------------------------------------------------
________________ 66
Page #86
--------------------------------------------------------------------------
________________ Title: Sthananga (Skt). Content: "In the third Anga, the Thananga, as in the Anguttara-nikaya of the Buddhists, various themes of the religion are dealt with in numerical order from one to ten. These enumerations sometimes contain parables in a nutshell... Occasionally, too, enumerations occur which are not directly connected with religion, eg., the ten themes of mathematics (in sutra 747). This Anga contains important literary data regarding the Siddhanta [ie. the "canon"], especially a table of contents of the Ditthivaya which has gone astray" (Winternitz 1933:2, 441). References: JRK 454-55; JSBI 1, 172-83; BORI Cat. 17:1, 54-70; Schubring 1935 SS45.3. Exegesis: 1 2 3 4 5 6 7 Editions: 1880 1.3 THANA (Thana.) 1916 Abhayadeva Suri, Tika / Vivarana, composed samvat 1120 [1063], 14 250 granthas. Begins: Sriviram Jinanatham. (BORI Cat. 17:1, 62-63; JRK 454-55). Printed Thana. 1880, 1918-20 [=1985b]; 1937. Gujarati translation in Thana.1942-51 or 1943-52. 1.1 Sumatikallola and Harsanandana, pupils of Samayasundara of the Kharatara Gaccha, Vivarana on the gathas in Abhayadeva's tika (JRK 455). Nagarsi Gani, pupil of Kusalavardhana of the Tapa Gaccha, Dipika, Sanskrit commentary composed samvat 1657 [1600]. Begins: pranatasurasuranatham. (BORI Cat. 17:1, 57; JRK 455), 1 Megharaja, of the Parsvacandra Gaccha, Dipika (in Gujarati?) (JRK 455). Printed. Thana. 1880. Dhanapati (?), Balavabodha (Gujarati) (BORI Cat. 17:1, 59) (or does this = 3 above?). Sthanangasutraparyaya (BORI Cat. 17:1, 67-70; JRK 455). Parsvacandra, Vrtti. Begins: Vardhamano Jino (JRK 455). Vrtti. Begins: Sriviram Jina (JRK 455). Sthananga sutra: trtiyanga: Ganadhara Sudharma Svami sankalita sutra tadupari Srimadabhayadeva Suri krta Samskrta tika aura Megharaja krta bhasa tika yuta / Brhannagari Launkagacchiya Vacanacarya Sriramacandragani sisya Rsi Nanakacanda se samsodhita hoke mudrita huva. Banarasa : Jaina Prabhakara Jatau, samvat 1937. Isavi san 1880. 8, [4], 596 p. 11 x 30 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 3). "Pahili daphe 1000 pustakaim. 500 Jainapustaka susaiti se, 500 Raya Dhanapatisimha Bahadura." BORI 38 249 *Thananga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1916. 900 p.; 13 x 23 cm. 1918-20 Srimatsudharmasvamiganabhrtprarupitam Srimaccandragacchalamkarasrimadabhayadevasurisutritavivaranayutam Srimatsthanangasutram. Mehesana : Sriagamodayasamitih, Virasamvat 2445-. Vikramasamvat 1975- Kraista 1918-20. 2 v.; 12 x 27 cm. (Agamodaya series; no. 21, 22). [CLIO 4, 2604; BORI Cat. 17:1, 55] Part 1: 289 [ie. 578] p.-Part 2: [1], 290-528 [ie. 580-1056] p. "Pratayah 1000." "Many extremely corrupt readings are found in this edition; they are recorded in footnotes [here] in order to illustrate the extent to which the readings get corrupted ..." (Muni Jambuvijaya, Thana. 1985, 60 (1st group). [BORI pt.1 only,2 pt. 2 not seen] Reprint with list of corrections Thana. 1985b. 1 Muni Jambuvijaya has prepared an edition of this work (personal communication Mayurbhai Shah (Patan) 23 October 1998). 2 Title-page signed "C. Krause."
Page #87
--------------------------------------------------------------------------
________________ Angas 1930 [1931] *Thanangasutra. Ahmadavada : Sthanakavasi Jaina Layabreri, samvat 1987 (1930). 154 p. [Josi 1987,56 [Thuhanam sutra.] Ahmadabada : Jivaraja Ghelabhat Dost, [1931). 120 p. ; 26 cm. (JSBI 1, 171 item i; Josi 1987, 57] Library copy has no title-page and contains text and Gujarati translation only up to p. 164 (3.1). Title taken from first page which begins: "// Ththanam sutra // // [Eattanam.)." Publisher details from advertising on back cover. Ghelabhai Dosi has published other volumes, mostly reprints of European editions, eg. Utt.1911; Dasave.1900z; Brhkapp.1911; 1915; Vava. 1925. ANU BL1312.3.T534 G8 1900z 1937 *[Text with Abhayadeva's cty / edited by Muni Vallabhavijaya). 2. avytti. Ahmedabada : Manekalala Cunilala va Kantilala Cunnilala, 1937. 4,500 p. ; 12 x 27 cm. [JSBI 1, 217, item a; Alsdorf 1966, Abbreviations; Josi 1987, 55) Edited by Naginadasa Nemacandra, 1938 (Nagraj 1986, 744 n.75). 1942-51 or 1943-52 Sristhanangasutram : Srimatsudharmasvamiganabhrtprarupitam: mula tatha Sri Candragacchalankara Srimad Abhayadevasuritikana anuvada yukta / samsodhaka tatha bhasantarakara Devacandraji Maharaja. Mundra, Kaccha: Astakoti Brhadpaksiya Sangha, Vira samvat 2469-78. Vikrama samvat 1999-2008. [1942-51 or 1943-52). 4 v.; 12 x 27 cm. Bhaga 1. Vira sam. 2478. Vi.sa. 2008.740 p.-2. Vira sam. 2469. Vi. sam. 1999.456 p.3. and 4 [no title-page] 482 p. and 436 p. Contents v. 1: Sristhanangasutra sambandhamam patrina Pandita Sri Gangaji Virajinum vaktavya [la-1b).- monochrome plate of Devacandra (samvat 1940-2000 (18831943] [Donor details 2a).-Prastavana / Kalyanacandraji la-8a.-Sva. Upadhyaya Sri Devacandraji Maharajanum sanksipta jivanacaritra 86-12b. Visayanukramanika la25b.-Sristhanangasutram : prathamo vibhagah : Visayanukrama 1b. Sampadakanum vaktavya 2a-2b.-Abhara 3a-b).Sristhanangasutram (Sthana 1-3] la-328b.Suddhipatrakam 329-330b. Contents v. 2: Visayanukrama [1b).-Sampadakano sanksipta parica ya 2a-3a.Sristhanangasutram (Sthana 4] 331a-555b. Contents v. 3: Sristhanangasutram (Sthana 5-7] 1a-241b. Contents v. 4: Sristhanangasutram (Sthana 8-10] 1a-218b. v.1 and 2, Prata 500." ANU LARGE BOOK PK5003.A52 S73 1943 4 v. 1948 *Sthanangasutra / desanakara Anandasa gara. 1. avrtti. Surata : Jaina Pustaka Prakasaka Samstha, 1948. 24, 321 p. ; 18 cm. (Agamoddhara sangraha , bhaga 4). [Josi 1987, 58] "Bhaga 1. Sthana 5, Uddesaka 1." Contains explanatory cty in Gujarati. 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie ; (sutthuruvena) Pupphabhikkhuna sampadio. 1. avstti. Gudagamva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 1953- 54.2 v. ; 19 cm. Thane v.1, p. 183-315. ANU BL1310.58 1954 2 v. 1964-65 Sri-Sthanangasutram = Sthanang sutram / Ghasilalaji-Maharaja-viracitaya Sudhakhyaya vyakhyaya samalankrtam Hindi-Gurjara-bhasa'nuvadasahitam. Prathama-avsttih. Rajakota (Saurastra): Sri Akhila). Bha rata. Svetambara). Sthanakavasi Jaina Sastroddhara Samiti, Vira samvat 2490-92 [1964-66). 5 v. ; 25 cm. 1. bhagah 1.1-3.1 11,689 p. Vira samvat 2490 [1964] 2. bhagah 3.2-4.2 10, 801 p. Vira samvat 2491 [1964] 3. bhagah 4.3-5.1 10,618 p. Vira samvat 2491 [1964] 4. bhagah 5.2-7 16, 751 p. Vira samvat 2492 [1965] 5 bhagah 8-10 10, 708 p. Vira samvat 2492 (1966) "Prati 1200." BORI and ANU PK5003.A52 573 68
Page #88
--------------------------------------------------------------------------
________________ 1.3 Thana 1972 Sthananga sutra : sanuvada saparisista/ sampadaka Muni Kanhaiyalala 'Kamala.' Sanderava, Rajasthana : Agama Anuyoga Prakasana, Vira samvat 2499 (1972). 22, 1166 p. ; 17 cm. Contents: Prakasakiya (51-6. Sampadakiya [71-8.-Prakkathana [9]-22.-Visaya suci 111-64. Sthananga sutra (mula patha) [1]-1122.-Parisista 1. Anuyoga vargikarana [1125)-1139.-Bhagavan Mahavira ke jivana prasanga (1140)-1141.-[2.] Mula sutrantargata suci[1143)-1159.-- [3.] Sthananga-Samavayanga sama visayaka sutra suci 1163-1166. "Pratiyain eka hazara." ANU PK5003.A52873 1972 1975 Sri Sthananga sutra : mula, Samskrta-chaya, padartha, mulartha evam Hindi vivecanika sahita / vyakhyakara Atmarima ji Maharaja ; sampadaka Muni Phulacandra 'Sramana'. Ludhiyana : Acarya Sri Atma Rama Jaina Prakasana Samiti, Jaina Sthanaka, Vira Nirvana samvat 2501. Vikrama samvat 2032. [1975]. 2 v. ; 24 cm. Contents v. 1: Prakasakiya [3].-Abhimatam/Tilakadhara Sastri [4-35]. [Donor details, plates 36-39).-Anukrama (40-48). Sampadakiya kathya (49-52). - Colour plate of Atmarama (Atmarama) vyaktitva-darsana (53-54). - Sthananga sutra 1-4][11-1170. Contents v. 2: Prakasakiya [4].-Colour plate of Atmarama).-Anukrama [1-13).Sthanangasutra (5-10] [1]-873. ANU PK5003.A52 S73 1976 2 v. 1974 or 1975 Angasultani : Niggantham pavayanam/ sampadaka Muni Nathamala [Yuvacarya Mahaprajna). Ladanum, Rajasthana : Jaina Visva Bharati (Samsthana), Vikrama samvat 2031 [1974 or 1975). 3 v.; 25 cm. Thanam v. 1, [487]-823. [v. 1: 2. samskarana. Vikrama samvat 2049. 1992.] "Original text critically edited on the basis of three MSS-Ka.' from the Gadhaiya library, Sardarsahar, samvat 1565 (1508); Kha.' from the Ghevara library Sujanagara, samvat 1685 [1628]; and 'Gha.' from the L. D. Institute, samvat 1517 (1460). Described p. 25-26 (1st group). Parts 1-3 of a complete edition of the canon. ANU PK5003.A52 1974 3 v. and BL1312.2 1975 3 v. 1976 *Thanam : mula patha, Samskrta chaya, Hindi anuvada tatha tippana/ vacana pramukha Acarya Tulasi : sampadaka-Vivecaka Muni Nathamala. 1. samskarana. Ladanum, Rajasthana : Jaina Visva Bharati, samvat 2033 [1976). 39, 1049 p. ; 28 cm. [DK 5202. DK listing 1988-96, item 1288] 1981 Sthanangasutra : Pancama Ganadhara Bhagavatsudharma-Svami-pranita trtiya Anga : mulapatha, Hindi anuvada, vivecana, parisista yukta / samyojaka tatha pradhana sampadaka Yuvacarya Srimisrimalaji Maharaja 'Madhukara'; anuvadaka-vivecaka Hiralala Sastri. Byavara, Rajasthana: Sri Agamaprakasana-Samiti, Viranirvanasamvat 2508. Vi. sam. 2038. I. san 1981. 66, 754 p. ; 25 cm. (Jinagama granthamala; granthanka 7). Contents: (Donor details 7.- Prakasakiya [9].-Amukha / Yuvacarya Madhukaramuni 10-12.-Prastavana. Sthananga sutra : eka samiknatmaka adhyayana /Devendra Muni 13-53.-Visayanukrama 54-66.--Thanam [1]-744.-Parisista 1. Gathanukrama [745)47.-2. Vyaktinama-anukrama (748)-50.-[Donor details 751)-54.-Anadhyayakala || Nandi.1966c, 7-9) se uddhita). ANU PK5003.A52 573 1981 1985a Thanangasuttam Samavayamgasuttam ca = Sthanargasutram Samavayangasutram ca : Pancamaganaharabhayavamsirisuhammasamiviraiyam taiyam cauttham ca Angam/ sampadakah Muni Jambuvijayah ; sahayakah Muni Dharmacandravijayah. Bambai: Sri Mahavira Jaina Vidyalaya, Vira samsvat) 2511. Vikrama sam 2041. I. sa. 1985. 86, 713 p.; 25 cm. (Jaina-Agama-granthamala; granthanka 3). Contents: Granthanukramah [7].-Prakasakiya nivedana 9-12.-Rnasvikara 12.Jinagama jayakara (prastavana) /Muni Jambuvijaya 15-42.-Amukham [Sanskrit]/Muni Jambuvijaya (431-51.-Foreword [53]-65.-Sampadanopayuktagranthasucih 67-70.Sanksiptam sanketavivaranam [71]-72. Sthanangasutrasya visayanukramah (73)-81.Samavayangasutrasya visayanukramah [82]-86.-Thanangasuttam [1]-322.-Sama 69
Page #89
--------------------------------------------------------------------------
________________ Angas vayangasuttam [323)-480.-1. parisistam Sthanangasutrantargatavisistasabdasucih [481]-581.-2. Sthanangasutrantargatanam gathardhanam akaradikramah (582)-586.3. Sthananga-Samavayangasutranam parasparam tula (587)-589.-4. Bauddhapalitripitakatula [extracts from Anguttaranikaya and Puggalapannatti, Nalanda edition) (590)645.-5. Sri Samavayangasutrantargatavisistasabdasucih (646)-705.-6. Samavayangasutrantargatanam gathardhanam akara dikramah (706)-710.-7. SthanangaSamavayangasutranam parasparam Agamadikatipayasastrantarais ca tula (711)-749.8. Katipayani visistani tippanani (750)-775.-Pathantaranam vrddhipatrakam (corrections, improved readings, readings collected afterwards from MSS like 'je.'] [776)783.-Suddhipatrakam 784-93. Sources: The edition of the sutra is based on four palm-leaf manuscripts-Je.' indicates two manuscripts from Jaisalmer (1982 catalogue no. 7, p. 2), samvat 1486 [1429), and a second one containing the Sthanangasutravrtti (1982 cat. no. 6, p. 2); 'Kha.' from the Tapa Gaccha Sangha Bhandara preserved in the Sri Hemacandracarya Jnana Mandira Patan, box 73, packet no. 86; Pa.' from the Sanghavi Pada Bhandara also preserved in the Sri Hemacandracarya Jnana Mandira Patan, according to the Sanghavi Pada Bhandara Sucipatra, it is no 31/2--and five paper MSS "La.1 to 5' from the L. D. Institute, Ahmedabad (LD no.s only given for: 2 = 7020, 3 = 28 010, 4 = 12 907) and the printed edition of Thana. 1918-20. (described in Gujarati on p. 38-39 = in English p. 61-63 (1st group)). In addition three palm leaf manuscripts of Abhayadeva's tika--two from the Jinabhadrasuri Jnana Bhandara, Jaisalmer 'Je.l' and 'Je.2' (cat. no.s 6 and 7); one from the Sri Hemacandracarya Jnana Mandira Patan (cat. no. 38) and three paper MSS two from the Sri Hemacandracarya Jnana Mandira Patan 'A.' (Box 244, no. 10 461, samvat 1613 [1556) and 'H' (Box 213, no. 9 995); and 'B.' details unknown to the editors (described in Gujarati on p. 37 = in English p. 60). "[We have mostly accepted in the body of the text those [readings that have been accepted by Abhayadevasuri" (p. 56 (1st group)). ANU BL1312.3.753 1985 1985b Sthanangasutram Samavayangasutram ca : dvadasangyam trtiyam caturtham ca / Pancamaganadhara-Bhagavatsudharmasvamiviracitam; Acaryapravarasriabhayadevasuriviracitavsttisamalankstam ; sampadakah samsodhakasca Acaryamaharajasrisagaranandasurisvarah ; Munirajasripunyavijayajimaharajasangrhitapracinasamagryadyanusaram vihitena suddhipatrakena tatha aparair api nanavidhaih parisistadibhih pariskarta ; Munih Jambuvijayah. 1. samskarana. Dilli : Motilala Banarasidasa Indolajikala Trasta, 1985. 38. 411, 5, 150 p. ; 29 cm. (Lala Sundaralala Jaina Agamagranthamala , bhaga 2). Contents: Prakasaka-vijnaptih [5]. [Donor details 7-10).-(Dedication 11]. - Granthanukramah[13].--Prastavana-parisistopayukta granthasucih sanketavivaranam ca [14-15).-Prastavana (Sanskrit) / Muni Jambuvijaya 17-20.-Navangivsttikstam Acaryapravarasriabhayadevasurinam jivanavrttam : Abhayadevaprabandhah [from Prabhacandra's Abhayadevaprabandha) (21)-25.--Sriabhayadevasuriprabandhah ["iti puratanaprabandhasangrahe"] [26].--Sristhanangasutrasya visayanukramah [27]-38.Sristhanangasutra [1]-352.- [Parisistani. 1. Suddhipatrakam (page numbers 352-360 missing from copy used)] <353-365.-2. Sthanangasutrantargatanam gathardhanam akaradikramah (366)-370.-3. Sri Abhayadeva suriviracitayam Sthanangavrttav uddhrtanam pathanam yathopalabdhi mulasthananirdesena saha akaradikramah (371)411.- ... Samavayangasutrasya visayanukramah [1]-5.-Srimatsamavayangasutram [1]-107.--Samavayangasutrasya pari istani. 1. Suddhipatrakam [111]-134.-2. Samavayangatikantargata visista ullekhah (135)-141.-3. "C" kosthakaspastikaranam [142].-4. Srisamavayangasutrantargatagathanam akaradikramah (143)-145.Srisamavayangatikayam uddhrtanam pathanam yathopalabdhi mulasthananirdesena saha akaradikramah (146)-150. Reprintings of Agamodaya Samiti editions (Samav. 1918 and Thana. 1918-20) with lists of corrections. ANU LARGE BOOK BL1312.3.753 1985 70
Page #90
--------------------------------------------------------------------------
________________ 1.3 Thana 1992 Reprint of v. 1 of Thana. 1974 or 1975. [v. 1: 2. samskarana. Vikrama samvat 2049. 1992.] Translations: Gujarats: [1931] Jivaraja Ghelabhai Dosi (Thana.[1931]) 1942-51 or 1943-52 Devacandra (Thana. 1942-51 or 1943-52) 1948 (Thana. 1948) Sthananga-Samavayanga : trija ane cotha Angagranthanum Gujarati rupantara / sampadaka Dalasukha Malavaniya. 1. avstti. Amadavada : Gujarata Vidyapitha, 1955.985 p. ; 19 cm. (Sri Punjabhai Jaina granthamala ; 23). Contents: Prakasakanum nivedana 3-4.-Anukramanika 5-14.-Upodghata 15-32.Sthananga-Samavayanga [1]-898.- Sabdasuci 899-985. "Prata 1 500." ANU BL 1312.3. S354 G8 1955 1964-65 Ghasilala (Thana. 1964-65) 1955 Hindi: 1916 Amolaka Rsi (Thana. 1916) 1964-65 Ghasilala (Thana. 1964-65) 1972 Kanhaiyalala Kamala' (Thana.1972) 1975 Atmarama (Thana.1975a) 1976 Muni Nathamala (Thana.1976) 1981 Hiralala Sastri (Thana. 1981) Studies: Brown, W. Norman. 1938-39. A manuscript of the Sthananga sutra illustrated in the early western Indian style. New Indian antiquary 1 (1938-39) 127-29. Description of a MS belonging to Robert Garrett of Baltimore, 90 folios, 12.5 x 4.8 inches. Devendra, Muni. 1992. *Sabdom ki gagara mem agama ka sagara : Acaranga, Sthananga evam Samavayanga sutra para sodha pradhana cintana. Udayapura : Sri Taraka Guru Jaina Granthalaya, 1992. xi, 218 p. ; 22 cm. Indexes: 1974 or 1975 (Thana. 1974 or 1975) indexed in Agama sabdakosa : angasuttani sabdasuci = Word indexes of Argasuttani/ sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2037. <1980- >.< 1 v.>; 25 cm. 1981 (Thana.1981) Parisista 1. Gathanukrama (745)-47.2. Vyaktinama-anukrama p. [7481-50. 1985a (Thana. 1985a) 1. parisistam Sthanangasutrantargatavisistasabdasucih p. [481]-581.2. (Thana Sthanangasutrantargatanam gathardhanam akaradikramah (582)-586. 1985b (Thana. 1985b) Parisistam 2. Sthanangasutrantargatanam gathardhanam akaradikramah p. [366]-370.
Page #91
--------------------------------------------------------------------------
Page #92
--------------------------------------------------------------------------
________________ 1.4 SAMAVAYA (Samav.) Title: Samavayanga (Skt). Content: "[In a way a continuation of the third [Anga], the subject matter of the first two-thirds of the work being arranged in numerical groups, just like the Thananga, except that in this case the numbers do not stop at ten, but go a long way beyond a hundred, as far as a million. "The work begins with an enumeration of the twelve Angas and a table of contents of the fourteen Puvvas. At the conclusion, however, we find very exact data regarding not only the contents but also the extent of all the twelve Angas, including the Samavaya itself. There is evidence of the fact that the Anga in its present form is either a late work or that it contains portions of later date ... The data in regard to the extent of the Angas do not tally with their present extent, and some of the figures given are very fantastic" (Winternitz 1933:2, 441-42). References: JRK 420; BORI Cat. 17:1, 171-79; JSBI 1, 171-83; Schubring 1935 $45.4. Exegesis: Abhayadeva, pupil of Jinesvara Suri of the Kharatara Gaccha, cty variously termed Vrtti, Vivrti Tika, composed in samvat 1120 [1063]. Begins: srivardhamanam anamya (JRK 420). Printed. Samav.1880; 1917; 1918; 1938a; 1985b; 1989. Translated into Gujarati Samav.1938b. Megharaja Vacaka, Vrtti (JRK 420). Printed. Samav.1880. Vijayasuri, Niryukti (JRK 420). Paryaya (JRK 420; BORI Cat. 17:1, 77-79). Editions: 1880 *Atha tikavarttikasamvalitam Samavayanga : caturthangasutram prarambhyate. Banarasa : Jaina Prabhakara, samvat 1937. 1880. 254 [ie 508) p. ; 12 x 30 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha : 4). Emeneau 83920; BORI Cat. 17:1, 71; Univ. of Chicago Library catalogue; Josi 1987, 61; An Illustrated AMg. dictionary 1923- 38:1, xxxii, item 46] Includes Gujarati explanation by Megharaja. 1916 *Samavayanga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandara bada (Daksina): Jaina Sastroddhara Mudralaya, 1916. 332 p. ; 13 x 23 cm. 1917 *[Samavayanga sutra with tika of Abhayadeval / sampadaka Naginadasa Nemacanda. Amadavada : Setha Maneklala Cunilala, samvat 1974 [1917). 148 p. [Josi 1987, 60) 1918 Srimatsudharmasvamiganabhrdviracitam Candrakulinanavangivrttikarakasrimadabhayadevasuriviracitatikopetam Srisamavayangasutram. Mehesana : Sriagamodayasamitih, Virasamvat 2444. Vikramasamvat 1974. Kraista san 1918. 2, 160 sie 4, 320) p. ; 12 x 26 cm. [CLIO 4, 2267] "Pratayah 1000." Contents: (Donor details] f. 1-2.-Srimatsamavayanga sutram 1-160. BORI Reprint. Samav. 1985. *Text with Abhayadeva's Vrtti.) Ahamadabada : Maphatalala Jhaveracandra (The. * Text with Bhattinivari), 1938. Devendra Muni 1977, 711; JL:1, 15 (4th group] 1938a 1938b *[Text with Gujarati translation of Abhayadeva's Vrtti. Bhavanagara : Jethalala, Haribhai. Jainadharma Prasaraka Sabha, Vi. sam. 1995 [1938]. [Devendra Muni 1977,711] 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie ; (sutthuruvena] 1 "Hence the title samavaya ie., group, aggregate." (Winternitz).
Page #93
--------------------------------------------------------------------------
________________ Angas 1962 1966 1973 1982 Pupphabhikkhuna sampadio. 1. avrtti. Gudagamva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354. 2 v.; 19 cm. Samavae v.1, 316-83. 1984 ANU BL1310.S8 1954 2 v. Sri-Samavayangasutram = Samavayangasutram / Ghasilalaji-Maharaja-viracitaya Bhavabodhinyakhyaya vyakhyaya samalankrtam Hindi-Gurjara-bhasa 'nuvadasahitam. Prathama-avrttih. Rajakota (Saurastra): Sri A[khila]. Bha[ratiya]. Sve[tambara]. Stha[nakavasi]. Jainasastroddharasamiti, Vira samvat 2488. 1962. 15, 40, 1152 p. ; 25 cm. "Prati 1200 [BORI copy, unconfirmed], RW copy "Prati 1000". Reprint 1973. BORI/RW Caturtha anga: Samavayanga: sanuvada saparisista / sampadaka Muni Kanhaiyalala 'Kamala.' Dilli: Agama Anuyoga Prakasana, Vira samvat 2492. Vikrama samvat 2023. Isvi san 1966. jha [ie 10], 69, 158, 109, 79 p. ; 17 cm. Contents: Prakasakiya [1]-[Donor details 2-3].-Sankalana-sanketa [4].-Prastavika ['a'-'jha. Samavayanga visaya-suci [1]-69.-Nandisutra mem varnita Samavayangaparicaya [70-71]. Samavaanga-mahappam [72].-Cauttham Samavayangam [text][1]158. Samavayanga-anuvada [1]-109.-Parisista 1. Samavayanga ka anuyogavargikarana [1]-[77].-Samavayanga ke sutrom ki anya Agamom mem sodha [1]-72.-- 3. Samavayanga-varnaka [73]-79. ANU PK5003.A52S3 1966 Reprint of Samav. 1962. Vira samvat 2500. Vikrama samvat 2030. Isvisan 1973. 12, 1154 p.; 25 cm. "Prati 500." 1974 or 1975 Angasuttani : Niggantham pavayanam / sampadaka Muni Nathamala [Yuvacarya Mahaprajna]. Ladanum, Rajasthana: Jaina Visva Bharati [Samsthana], Vikrama samvat 2031 [1974 or 1975]. 3 v. ; 25 cm. RW Samavao v.1, [825]-954. [v.1: 2. samskarana. Vikrama samvat 2049. 1992.] "Original text critically edited" on the basis of three MSS.-Ka.' from Jaisalmere, written samvat 1401 [1344]; 'Kha.' and 'Ga.' from the Gadhaiya library Saradarasahara, samvat 15th-16th cent. and samvat 1345 [1288]-Samav.1917 also mentioned. Described on p. 27-28 (1st group). Parts 1-3 of a complete edition of the canon. ANU PK5003.A52 1974 3 v. and BL1312.2 1975 3 v. Samavayangasutra : Pancama Ganadhara Bhagavatsudharma-Svami-pranita caturtha Anga : mulapatha, Hindi anuvada, vivecana, parisista yukta / samyojaka tatha pradhana sampadaka Srimisrimalji Maharaja 'Madhukara'; anuvadaka, vivecaka, sampadaka Hiralalaji Sastri. Byavara, Rajasthana: Sri Agamaprakasanasamiti, Viranirvanasamvat 2508 [1982]. 14, 104, 259 p. ; 25 cm. (Jinagama granthamala ; granthanka 8). Contents: [Donor details] [7]-8.-Prakasakiya [9].--Adi vacana / Misrimalji 'Madhukara' [11]-14. Prastavana. Samavayanga sutra : eka samiksatmaka adhyayana / Devendra Muni [1]-94.-Visayanukramanika [95]-104.-Samavayangasuttam [1]-243.'Anadhyayakala' [[Nandi. 1966c, 7-9] se uddhrta] [244]-246.-[Donor details 247]250.-Parisista 1. Granthagatagathanukramanika [251]-253.-2. Vyaktinamanukrama [254]-259. ANU PK5003.A52.S35 1982 Samavao: Niggantham pavayanam : mula patha, Samskrta chaya, Hindi anuvada, tippana, parisista adi / sampadaka-vivecaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, 1984. 32, 435 p. ; 28 cm. Contents: Antastosa / Acarya Tulasi [11].-Prakasakiya [13]. Sampadakiya [13]-15.Bhumika [17]-18.-Vargikrta visayanukrama [19]-32.-[Samavao: mula, Samskrta chaya, Hindi anuvada, tippana] 1-401.-Parisista 1. Tulana (Samavao-ThanamPravacanasaroddhara-Avasyakaniryukti adi) [405]-412.-2. Visesanamanukrama [413] 74
Page #94
--------------------------------------------------------------------------
________________ 1985a 1985b 1.4 Samavaya 429.-3. Visesanama-varganukrama [430]-435. ANU LARGE BOOK BL1312.3.S354 H4 1984 Review. *Bansidhar Bhatt. 1983. Vishveshvaranand Indological Review Series 1-3 (Hoshiarpur, 1983) p. 1 (245)-10 (254). Thanangasuttam Samavayamgasuttam ca = Sthanangasutram Samavayangasutram ca : Pancamaganaharabhayavamsirisuhammasamiviraiyam taiyam cauttham ca Angam sampadakah Muni Jambuvijayah; sahayakah Muni Dharmacandravijayah. Bambai : Sri Mahavira Jaina Vidyalaya, Vira sam[vat] 2511. Vikrama sam 2041. I. sa. 1985. 86, 713 p.; 25 cm. (Jaina-Agama-granthamala; granthanka 3). Contents: Granthanukramah [7].-Prakasakiya nivedana 9-12.-Rnasvikara 12.-- Jinagama jayakara (prastavana)/Muni Jambuvijaya 15-42.-Amukham [Sanskrit]/Muni Jambuvijaya [43]-51.-Foreword [53]-65.-Sampadanopayuktagranthasucih 67-70.Sanksiptam sanketavivaranam [71]-72. Sthanangasutrasya visayanukramah [73]-81.Samavayangasutrasya visayanukramah [82]-86.-Thanangasuttam [1]-322.Samavayangasuttam [323]-480.-1.parisistam Sthanangasutrantargatavisistasabdas@cib [481]-581.-2. Sthanangasutrantargatanam gathardhanam akaradikramah [582]-586.3. Sthananga-Samavayangasutranam parasparam tula [587]-589.-4. Bauddhapalitripitakatula [extracts from Anguttaranikaya and Puggalapannatti, Nalanda edition] [590]-645.-5. Sri Samavayangasutrantargatavisistasabdasucih [646]-705.-6. Samavayangasutrantargatanam gathardhanam akaradikramah [706]-710.-7. SthanangaSamavayangasutranam parasparam Agamadikatipayasastrantaraisca tula [711]-749.-- 8. Katipayani visistani tippanani [750]-775.-Pathantaranam vrddhipatrakam [corrections, improved readings, readings collected afterwards from MSS. like 'Je.'][776]783. Suddhipatrakam 784-93. Sources: Three palm-leaf MSS.-Je.1' and 'Je.2' [='Je.'] designate two Jaisalmer manuscripts (catalogue numbers 8 and 9), samvat 1487 [1430], about the second MSS. no information is given here, both were obtained after the text had been printed, readings from them are given in appendix 8 and some footnotes; 'Kham.' from the Sri Santinatha Talapatra Grantha Bhandara, Cambay, no.37, samvat 1349 [1292]-and five paper MSS. He.1' 'He.2' from the Sri Hemacandracarya Jaina Jnana Mandira, Patan (Dabda 213, no. 9996 and Dabda 7, no. 105); 'La. 1' and 'La.2' from the L. D. Institute, Ahmedabad (no.s 17044 and 17045)-also 'T.' paper MS. from Baroda (?) and Samav.1918 (Described in Gujarati on p. 38-39 = in English p. 61-63 (1st group)). ANU BL1312.3.T53 1985 Sthanangasutram Samavayangasutram ca: dvadasangyam trtiyam caturtham ca / Pancamaganadhara-Bhagavatsudharmasvamiviracitam; Acaryapravarasriabhayadevasuriviracitavrttisamalankrtam; sampadakah samsodhakas ca Acaryamaharajasrisagaranandasurtsvarah; Muniraja sripunyavijayajimaharajasangrhitapracinasamagryadyanusaram vihitena suddhipatrakena tatha aparair api nanavidhaih parisistadibhih pariskarta ; Munih Jambuvijayah. 1. samskarana. Dilli : Motilala Banarasidasa Indolajikala Trasta, 1985. 38, 411, 5, 150 p. ; 29 cm. (Lala Sundaralala Jaina Agamagranthamala; bhaga 2). Contents: Prakasaka-vijnaptih [5].[Donor details 7-10]-[Dedication 11].-- Granthanukramah [13].-Prastavana-parisistopayukta granthasucih sanketavivaranam ca [14-15]. Prastavana [Sanskrit] / Muni Jambuvijaya 17-20.-Navangivrttikrtam Acaryapravarasriabhayadevasurinam jivanavrttam : Abhayadevaprabandhah [from Prabhacandra's Abhayadevaprabandha] [21]-25.-Sriabhayadevasuriprabandhah ["iti puratanaprabandhasangrahe"] [26]-Sristhanangasutrasya visayanukramah [27]-38Sristhanangasutra [1]-352. [Parisistani. 1. Suddhipatrakam (page numbers 352-360 missing from copy used)] <353365.-2. Sthanangasutrantargatanam gathardhanam akaradikramah [366]-370.-3. Sri Abhayadevasuriviracitayam Sthanamgavrttav uddhrtanam pathanam yathopalabdhi mulasthananirdesena saha akaradikramah [371]411.-... Samavayangasutrasya visayanukramah [1]-5.-Srimatsamavayangasutram [1]107. Samavayangasutrasya parisistani. 1. Suddhipatrakam [111]-134.-2. Samavayangatikantargata visista ullekhah [135]-141.-3. "[]" kosthakaspastikaranam 75
Page #95
--------------------------------------------------------------------------
________________ Angas [142].-4. Srisamavayangasutrantargatagathanam akaradikramah [143]-145.Srisamavayangatikayam uddhstanam pathanam yathopalabdhi mulasthananirdesena saha akaradikramah (146-150. Reprintings of Agamodaya Samiti editions (Samav.1918 and Thana. 1918-20) with lists of corrections. ANU LARGE BOOK BL1312.3.753 1985 1989 Sri Samavayanga sutram : Srimadganadharadevavinirmitam Suripurandarasrimad abhayadevasurisvara-Vrttiyutam caturthanga / sampadakah samsodhakas ca Vijayajinendra surisvarah. Prathamavrtti. Lakhabavala Santipuri, Saurastrah: Sri Harsapuspamarta Jaina Granthamala, Vira sam. 2515. Vi. sam. 2045. San 1989. 8, 330 p. ; 13 x 26 cm. (Sri Harsapuspamasta Jaina granthamala ; 191). Contents: Abhara darsana 2.- Prastavika 3.-Suddhipatrakam 4-8.-Srisamavayangasutram 1-330. *750 pratayah." ANU NBC 2 036 740 1992 Reprint of v. 1 of Samav.1974 or 1975. Translations: Gujarati: 1955 Sthananga-Samavayanga : trija ane cotha Angagranthanum Gujarati rupantara/sampadaka Dalasukha Malavaniya. 1. avytti. Amadavada, Gujarata Vidyapitha, 1955.985 p. ; 19 cm. (Sri Punjabhai Jaina granthamala ; 23). Contents: Prakasakanum nivedana 3-4.-Anukramanika 5-14.-Upodghata 15-32.Sthananga-Samavayanga [1]-898.--Sabdasuci 899-985. "Prata 1 500." ANU BL1312.3. S354 G8 1955 1962 Ghasilala (Samav.<1962->) Hindi: 1916 1962 1966 1982 1984 Amolaka Rsi (Samav.1916) Ghasilala (Samav.<1962->) Muni Kanhaiyalala 'Kamala' (Samav.1966) Hiralala Sastri (Samav.1982) Yuvacarya Mahaprajna (Samav.1984) Studies: Devendra, Muni. *1992. Sabdom ki gagara mem agama ka sagara : Acaranga, Sthananga evam Samavayanga sutra para sodha pradhana cintana. Udayapura : Sri Taraka Guru Jaina Granthalaya, 1992. xi, 218 p. ; 22 cm. Indexes: 1955 (Samav.Gujarati translation. 1955) Sabdasuci p. 899-985. 1974 or 1975 (Samav.1974 or 1975) indexed in Agama sabdakosa : angasuttani sabdasuci = Word indexes of Angasuttani/ sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2037. <1980- >.; 25 cm. 1982 (Samav.1982) Parisista 1. Granthagata gathanukramanika p. [251)-253.-2. Vyakti namanukrama [254]-259. 1984 (Samav.1984) Parisista 2. [Samavaya] Visesanamanukrama p. [413]-429.-3. Visesanamavarganukrama (430)-435. 1985a (Samav.1985a) Parisista 5. Sri Samavayangasutrantargatavisistasabdasucih p. [646)-705.6. Samavayangasutrantargatanam gathardhanam akaradikramah (706)-710. 76
Page #96
--------------------------------------------------------------------------
________________ Title: Vyakhyaprajnapti (Skt); or Bhagavai; Bhagavati (Skt). Contents: "[T]he holy teachings of explanations,' usually entitled briefly 'Bhagavati' contains a bulky, circumstantial presentation of the dogmatics of Jinism, partly in the form of questions and answers, Mahavira replying to the questions of his principal disciple Goyama Indabhuti, and partly in the form of dialogue-legends (itihasa-samvada). The contents are a motley mixture of ancient doctrines and traditions with numerous later additions containing frequent allusions to other works, more especially the Panhav., Jivabhi., Uvav., RayPa., Nandi and Ayar. This work gives a more vivid picture than any other ... of the life and work of Mahavira, his relationship to his disciples and contemporaries, and his whole personality" (Winternitz 1933:2, 442-43). References: Weber 1935, SS45.5; Winternitz 1933:2, 442-45; JRK 289-91; BORI Cat. 17:1, 80-112; JSBI 1, 187-214; Schubring 1935 SS45.5. Exegesis: 1 2 3 4 5 6 7 8 9 10 11 1.5 VIYAHAPANNATTI (Viy.) 12 13 2 3 Jinadasa Mahattara, Curni (JRK 290). Printed. Viy. 1994. Abhayadeva Suri, 11th cent., Bhagavati vrtti, Vrtti, Vivarana, Vivrti, Tika composed 1128 [1071] with the help of Yasascandra Gani, revised by Dronasuri. (Schubring 1944, 9; JRK 290; BORI Cat. 17:1, 86). Extent 15 616 slokas, mentions a mula-tika and the Curnikara a number of times, (Viy.1994< >, Bhumika 1, 38-39). Printed. Viy.1881, 1917-31, 1918-21, 1994-<>. Is it in Viy. 1976-77? Viy.Partial edition. 1876; 1937-40; 1954. Gujarati translation 1917-31. Bhavasagara, Tika, before samvat 1571 [1514] (JRK 290). Danasekhara Gani / Suri Laghu Vrtti, before samvat 1597 (JRK 290). 1935 *[Laghu vrtti on Bhagavati without mula]. Ratalama : Rsabhadevaji Kesarimalaji Jaina Svetambara Samstha, 1935. 298 p. ; 12 x 27 cm. [Josi 1987, 66] Avacurni or Tika (JRK 291) is this the same as the Bhagavati-vyakhyana? 1974 * Sri Bhagavatisutravacuri. Surat, (DLJP; 114). p. 1-202. [Bruhn 1996, 46] Megharaja, Tabba. Printed. Viy.1881. Alapaka (JRK 291). Tripatha (JRK 291). Padmasundara Gani, Stabaka (JRK 291). Paryaya (BORI Cat. 17:1, 110-12). Bijaka samvat 1763 [1706] (JRK 291). Somasundara Suri, Laghu Vrtti (JRK 290). Harsakula, Bijaka (JRK 291). Partial commentaries: 1 Abhayadeva, Pancanirgrantha (BORI Cat. 17:1, 103-10). Malayagiri, Vrtti (on Sataka 2 only) (JRK 290). Yasovijaya, pupil of Nayavijaya, Balavabodha (BORI Cat. 17:3, 1849). Printed. Viy.1917-18.
Page #97
--------------------------------------------------------------------------
________________ Angas Editions: 1881 *Atha Bhagavati-sutra-pancamanga-prarambha : Laurkagacchiya-Sri-Rama-candra-Ganiketa-Samskstanuvada-yuta / Ganadhara-Sudharma-Svami-sankalita sutra tadupari SrimadAbhayadeva-Suri-krta Samskrta-tika aura Megharaja-Gani-krta (Gujarati)-bhasa-tika-yuta. Benares : [s.n.), samvat 1938 [1881). 4 v. ; 16 x 31 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 5). CLIO 1, 379; Univ. of Chicago Library catalogue; ed. Rsi Nanakcand, '1882' Cort 1989, 515) Contents: [2], 6, 1936 f. Includes Skt translation by Launka Gacchiya Ramacandra Gani (Cort 1989, 515). *[M.R. Metha / Mehata. Bombay, 1914. [JRK 289; Devendra Muni 1977, 712 item 9) 1914 1917 * Vivahapra inapti (Bhagavati) sutra/ Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1917. 3090 p. ; 13 x 23 cm. 1917-31 Srimadbhagavatisutra (Vyakhyaprajnaptih) / Bhagavatsudharmasvamipranitam; Srimad abhayadevasuriviracitavivaranasahitam; Panditabecaradasena anuvaditam-samsodhitam ca. Mumbai : Srijinagamaprakasasabha, Vi. sam. 1974-88. [1917-31]. 4 v. ; 24 x 33 cm. (SriRayacandra-Jinagamasangraha). CLIO 1, 380] Text of Abhayadeva's commentary and Gujarati translation (of Vrtti). v. 1-2: Stabaka 1-6 / Becaradasa Dosc. Bambai : Jinagama Prakasaka Sabha, Vi. sam. 1974-79 (1917-22). v. 3: Stabaka 7-15 / Bhagavanadasa Dosi. Ahamadabada : Gujarata Vidyapitha, Vi. sam. 1985 (1928). v. 4: Stabaka 16 41 /Bhagavanadasa Harakhacanda Dosr. Ahamadabada : Jaina Sahitya Prakasana Trasta, Vi. sam. 1988 [1931). (JSBI 1, 187). Contents v. 1: "45-Jinagama prakata karava mateni eka yojana / Madasukhalala Ravajibhai Mehata [1]-3.-[Introduction] [4).- (Contents. Satas 1-2] 12-17.Suddhipatrakam (19-20.- ... Bhagavatisutra [text and translation] 1-314.Sribhagavatisutramula-vikagatasabdanam akaradyanukramena suca (315)-352. Contents v. 2: Vi. sam. 1979. [Contents) [1]-7.-Bhagavatisutra [Satas 3-6][11-347. Contents v. 3: Vi. sam. 1985. Sampadakiya nivedana / Bhagavanadasa Dosi [3]. - Visayanukrama (5)-15.--... Bhagavatisutra Satas 7-15) [1]-402. Contents v. 4: Sampadakiya nivedana [1].- Donor details 12).--Adhyatmika sodha (1)24.-Upasamhara / Becaradasa Dosi. [25)-26.-[Appendices. Books referred to, particular words commented on, yantras 27-35).-Bhagavatisutra (Satas 16-41] [1]370. "Prata sankhya 1000" [the numeral 1000 has been altered by hand to read '500'). BORI 1918-21 Srimadbhagavatisutram / Srimatsudharmasvamigaaibhrtprarupitam Srimadgautama ganadharivacananugatam; Srimaccandrakulalankarasrimadabhayadevasurisutritavivaranayutam. Mehesana : Agamodayasamiti, Virasamvat 2444 47. Vikramasamvat 1974-77. Kraista 1918-21. 2 v. in 3 ; 12 x 27 cm. [CLIO 1, 380] v.1 (1-7): Virasamvat 2444. Vikramasamvat 1974. Kraista 1918. f. 327. v.2 (8-14): Virasamvat 2445. Vikramasamvat 1975. Kraista 1919. f. 328-657 +[1]. v.3 (15-41): Virasamvat 2447. Vikramasamvat 1977. Kraista 1921. f. 659-980, [1]. Edited by Sagarananda Suri (Viy.1974-82:3, 24 (1st group)). "Pratayah 1000." Viy.1974 or 1975 gives page references of this edition in the margins. BORI 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie ; [sutthuruvena Pupphabhikkhuna sampadio. 1. avytti. Gudagamva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354. 2 v. ; 19 cm. Bhagavai-Vivahapannatti v.1, 384_939. ANU BL1310.58 1954 2 v.
Page #98
--------------------------------------------------------------------------
________________ 1961-72 Bhagavati-sutram = Bhagavati sutram / Ghasilalaji-Maharaja-viracitaya Prameyacandrikakhyaya vyakhyaya samalankrtam Hindi-Gurjara-bhasa'nuvadasahitam. Prathamaavrttih. Rajakota, Saurastra: Sri [Akhila Bharatiya] Sve[tambara]. Stha[nakavasi]. Jainasastroddharasamitih, Vira samvat 2489-98 [1961-72]. 17 v. ; 25 cm. Reprint. 2514. 2044. 1988. Prati 250. Reprint. 2514. 2044. 1988. Prati 250. Reprint. 2514. 2044. 1988. Prati 250. Reprint. 2515. 2045. 1989. Prati 250. 1. bhagah: Vira samvat 2489 [1961]. 44, 856 p. 2. bhagah: 2488 [1962]. 40, 1099 p. 3. bhagah: 2489 [1963]. 6, 51, 919 p. 4. bhagah: 2489 [1963].15, 1126 p. 5. bhagah: 2490 [1964]. 20, 848 p. 6. bhagah: 2490 [1964]. 18, 811 p. 7. bhagah: 2490 [1964]. 12, 764 p. 8. bhagah: 2492 [1965]. 12, 672 p. 9. bhagah: 2493 [1967]. 14, 746 p. 10. bhagah: 2494 [1967]. 14, 720 p. 11. bhagah: 2494 [1968]. 14, 892 p. 12. bhagah: 2494 [1968]. 15, 696 p. 13. bhagah: 2495 [1969]. 15, 956 p. *14. bhagah: [not held BORI, 1969 (Josi 1987, 71)] *15. bhagah: [not held BORI, 1969 (Josi 1987, 71)] 16. bhagah: 2498 [1972]. 15, 956 p. 17. bhagah: 2498 [1972]. 23, 78 p. [end]. "Prati 1000." Reprint. <1988->; v. <1-4, >. 1.5 Viyahapannatti ANU PK5003.A52B5 v.2-v.13 only [BORI v.1-13, 16-17] 1964-72 Bhagavati sutra: Vyakhyaprajnapti sutra : Ganadhara Bhagavan Sudharmasvami pranita / sampadaka Ghevaracandaji Bamthiya 'Viraputra' (varttamana Viraputraji Maharaja). Prathamavrtti. Sailana, Ma[dhya] Pra[desa]: Akhila Bharatiya Sadhumargi Jaina Samskrti Raksaka Sangha, [1964-72]. <2, 3, 5, 6> v. ; 25 cm. (Sadhumargi Jaina Samskrti Raksaka Sangha sahitya ratnamala; 13, 21, 24, 40, 44, 46). [Josi 1987, 70] Contents *v. 1: 1964. [Sataka 1-2]. 24, 532 p. Contents v. 2: Vira samvat 2492. Vikrama 2022. Isvi san 1966. Nivedana [5].-Suddhipatra [6-7].-Visayanukramanika [8-11].-Asvadhyaya [12].--Sri Bhagavati sutra [Sataka 3-6] [533]-1076 p. Contents v. 3: Vira samvat 2496. Vikrama 2025. Isvi san 1967. Nivedana [2-3].-Suddhipatra [5-7].-Visayanukramanika [8-10]. Asvadhyaya [11].-Bhagavati sutra [Sataka 7-8] [1077]-1569 p. Contents *v. 4: 1968. [Sataka 9-12] p. 1570-2134 p. Contents v. 5: Vira 2496. Vikrama 2027. Isvi san 1970. Nivedana [3].-Suddhi patra [5]-8.-Visayanukramanika [9]-[13].--Asvadhyaya [14].-Bhagavati sutra [Sataka 1317] 2135-647 p. Contents v. 6: Vira 2498. Vikrama 2028. Isvi san 1972. Nivedana [3].-Asvadhyaya [4]. Suddhi-patra [5]-7.-Visayanukramanika [8]-12.--Bhagavati sutra [Sataka 1824] [2647]-3190 p. Contents v. 7: 1972. Sataka 25-41. 37, 3191-808 p. "800 [copies]." 79 ANU PK5003.A52 B5 1966 v.2, 3, 5, 6 only 1974 or 1975 Angasuttani: Niggantham pavayanam / sampadaka Muni Nathamala [Yuvacarya Mahaprajna]. Ladanum, Rajasthana: Jaina Visva Bharati [Samsthana], Vikrama samvat 2031 [1974 or 1975]. 3 v. ; 25 cm. v. 2 Bhagavai : Viahapannatti. 56, 1048, [45] p. 2. samskarana. Vikrama samvat 2049. 1992. Contents v. 2: Granthanukrama [8].-Prakasakiya / Acarya Tulasi [9]-12.-- Sampadakiya/Muni Nathamala [13]-21.-Bhumika / Acarya Tulasi [23]-27.-Preface [ = English version of Prakasakiya] [29]-34.-Editorial [ = English version of Bhumika] [35]-44. Bhagavai Visayanukkama [45]-55.-Sanketa nirdesika 56.-Bhagavai
Page #99
--------------------------------------------------------------------------
________________ Angas Viahapannatti 1-1048.-Parisista 1. Sanksipta-patha, purta-sthala aura purti adhara-sthala [1] 44.--Parisista 2. Purakapatha (45). Sources: "Original text critically edited" on the basis of seven MSS.--'A.' Gadhaiya library, Sardarasahara, samvat 15-16th cent.; 'Ka.' from Punamacanda Budhamala Dudhoriya, Chapara, library, samvat 16th cent.; two photo-prints of Jesalmere MSS, "Kha., 422 leaves (also used for Viy.1974-82), and "Ta.' 348 leaves, samvat 1235 (1178); "Ba.' Terapanthi Sabha, Sardarasahara, samvat 16th cent.; "Ma.' Gadhaiya library, Sardarasahara, samvat 16th cent., 'Sa.' Terapanthi Sabha Ladnum, samvat 1848 [1791] and Viy. 1918-21 (described on p. 15-20 = 41-43 (1st group)). Parts 1-3 of a complete edition of the canon. The page numbers of Viy.1918-21 are indicated in the margins. ANU PK5003.A52 1974 3 v. and BL1312.2 1975 3 v. 1974-82 Viyahapannattisuttam: Pancamaganaharaajjasuhammatherabhagavamparamparasamkalia vayananugayam 'Bhagavatisuttam' ti pasiddhanamagam pancamam Angam/sampadakah Becaradasa Jivaraja Dost (sahayakah (v.2) parisistadinirmata (v.3) Amstalala Mohanalala Bhojaka. Bambai : Sri Mahavira Jaina Vidyalaya, Vira samvat 2500-08. Vikrama sam. 2030-38. I. sa. 1974-82. 3 v. ; 25 cm. (Jaina-Agama-granthamala ; granthanka 4). Contents v. 1: Granthanukrama (5). Simadharassa vande 171-8.-Prakasakiya nivedana [9]-12.- Jnanabhaktini anumodana [13].--Rnasvikara [14].--Sampadakiya/B.J. Dosc [15)-17.-Suddhipatrakavisesa (18].--Editor's note /B.J. Dosi (translated by Nagin J. Shah] [19]-22.-Sanketasucih (23)-25.-Visayanukkamo [27]-56.-Viyahapannattisuttam [Satakas 1-9][1]-484.- Suddhipattayam [1]-3. [v.1 was edited without MS. Je.' (12th cent. samvat) variants from it for Satakas 1-9 are printed as an appendix to v.3] Contents v. 2: Granthanukrama [7]. Prakasakiya nivedana [9]-11.-nanabhaktini anumodana [12]. Donor details 13-14).-Rnasvikara [15). Sampadakiya/B.J. Dosi 116]. Prastavana /A. M. Bhojaka 17-24.- Editor's note /B.J. Dosi (translated by Nagin J. Shah) 25.-- Introduction / A. M. Bhojaka 26-35.-Visayanukkamo [37]-87.-[Sataka 10-15] [485)-1070.-Suddhipattayam (1-2). Contents v. 3: Granthanukrama [7].-Prakasakiya nivedana [9]-13.-Jnanabhaktini anumodana (14).- Donor details 15-16).-Rnasvikara (15).-Prastavana / A. M. Bhojaka 18-22. Introduction / A. M. Bhojaka (translated by Nagin J. Shah] 23-28.Visayanukkamo [29] 46.- [Sataka 26-41][1071]-1187.-1. Parisittham Viyahapannattisuttantaggayanam gahanam anukkamo (1191)-92.-2. Viyahapannattisuttantaggayanam saddanam anukkamo [1193]--1546.-3. Viyahapannattisuttantaggayanam visesanamanam anukkamo [1547]-1557.-4. [Variant readings from MS. 'Je.' for v.1] [1558)1571.-5. [Variant readings from MS. 'Je.' for v.l which support those noted in v.1] (1572)-1573.-6. ["Suddhipattayaviseso' for v.1]. (1574)-1575. Suddhipattayam [for v. 3] [1576-1577. Sources: Four old paper MSS.--La. l' samvat 1552 [1495); "La. 2', 17th cent. samvat; "La. 3' samvat 1580 [1523); La. 4' samvat 1576 [1519]--and Viy.1918-21 (described in v.1. p. 19-21 (1st group)). In addition three further palm-leaf MSS.-two from Jaisalmer, Je.', 422 leaves, 12th cent. samvat; 'Jam.' Lonkagaccha Jaina Jnanabhandara Jaisalmer, (which, although it ends after the third uddesaka of Sataka 15, predates Abhayadeva) and "Su.' from the Sri Yasobhadra-Subhankara-Jnanasala, Godhra (also used for Viy. 1974 or 1975). (Described v. 2, p. 26-29 (1st group)). ANU PK5003. A52B5 1974. v.1-3 1976-77 Srimadbhagavatisutra paranamnah Srimadvyakhyaprajnaptisutrasya purvadhatmakah 2-3. vibhagah. 1976-77.2 v. (Sri Harsapuspamsta Jaina granthamala ; 64, 70). v. 1 16,444 p. ; v. 2: 16, 446, 842 p. (Completed?] 1982-86 Vyakhyaprajnaptisutra : Pancamaganadhara Bhagavat Sudharmasvami-pranita : pancama Arga : Bhagavatisutra : mulapatha, Hindi anuvada, vivecana, tippanayukta / samyojaka tatha pradhana sampadaka Yuvacarya Srimisrimalaji Maharaja 'Madhukara'; sampadakavivecaka-anuvadaka Amara Muni, Sricanda Surana 'Sarasa'. Byavara, Rajasthana : Sri Agamaprakasanasamiti, Viranirvanasamvat 2509-12 [1982-86). (Jinagama-granthamala ; 80
Page #100
--------------------------------------------------------------------------
________________ 1.5 Viyahapannatti granthanka 14, 18, 22, 25). 4 v. ; 25 cm. Contents v. 1: Prakasakiya [7].-Sampadana-sahayogi satkara [8]. [Donor details). 19-10).-Adi vacana/Misrimala 'Madhukara' 11-14. Sampadakiya 15-23--Visayasuci 25-38.-Viyahapannattisuttam Sataka 1-5) [1]-522.- Anadhyayakala' [[Nandi.1966c, 7-9] se uddhrta) (523]-25.- Donor details 526-29]. Contents v.2: Prakasakiya [7).-Sampadana-sahayogi satkara [8]. [Donor details 9).Adi vacana / Misrimala 'Madhukara' 11-14.-Visaya-suci 17-30.-Vivahapannattisuttam Sataka 6-10][1] 626.-'Anadhyayakala' [[Nandi. 1966, 7-9 se uddhrta] [62729.- [Donor details 630-33). Contents v. 3: Prakasakiya 7.-Sampadana-sahayogi satkara 8.-[Donor details 9-10.Visayanukrama 11-28.-Viyahapannattisuttam [Sataka 11-19)(1)-801.-Anadhyayakala' [[Nandi.1966c, 7-9 se uddhrta(802)-804.-[Donor details 805)-808. Contents v.4: Prakasakiya [7]. [Donor details/8)-11.-Prastavana : Bhagavatisutra : eka samiknatmaka adhyayana / Devendra Muni 12-105.-Visaya-suci [106]-122. - Vivahapannattisuttam Sataka 20-40] [1]-768.-Parisista 1. Vyaktinamanukramanika 1769-772.-2. Visistasthana-namanukramanika (773)-776.-3. Bhagavatinirdista sastranamanukramanika (7771-778.-4. Katipaya visista sabdasuci [779).-'Anadhyayakala' [[Nandi.1966, 7-9] se uddhfta] [780]-782.- [Donor details 783)-786. ANU PK5003. A52B5 1982 v.1-4 1994 > Bhagavai Viahapannatti : mulapatha, Samskrta chaya, Hindi anuvada, bhasya tatha parisista - Sabdanukrama adi : Jinadasa Mahattara krta Curni evam Abhayadevasuriksta Vrtti sahita / sampadaka : bhasyakara Acarya Mahaprajna [; Samskrta chaya, anuvadaka Sadhvi Pramukha Kanakaprabha). Ladanum, Rajasthana : Jaina Visvabharati Samsthana, 1994<< >v.<1> ; 29 cm. Khanda 1. Sataka 1, 2. 1994. xlii, 414 p. Contents v. 1: Prakasakiya [10].--Sampadakiya [11]-12.--Sanketa-nirdesika [13]-14.Bhumika 151-39.-Visayanukrama (40)-41.- Padhamam satam= Prathama sataka [1] - 193.-Biam satam = Dvitiya sataka (195)-299.-Parisista. 1. Namanukramah vyakti aura sthana. [303]-304.-2. Bhasyavisa yanukrama (305)-310.-3. Paribhasika sabdanukrama 311)-329.4. Adharabhuta grantha-suci. [330]-337.-5. Jinadasa Mahattara-ksta Bhagavati-curnih (Source: 'hastalikhitaprati', Bibliography, p. 335 item 123. See also Bhumika p. 37] [339]-340.-6. Abhayadevasuri-krta Bhagavati-vitti [for Satakas 1-2, source of text not stated but Viy.1917a is cited in the Bibliography (p. 335 items 125-26] [341] 413. RW Partial editions: 1866-67 Uber ein Fragment der Bhagavati : ein Beitrag zur Kenntniss der heiligen Sprache und Literatur der Jaina / Albrecht Weber. 2 Theile. [367]-444 (=77], [155]-352 [=197] p. ; 2 plates. Berlin : F. Dummlers Verlags-Buchhandlung, Harrwitz und Gossmann, 1866-67. (Abhandlungen der konigl. Akademie der Wissenschaften zu Berlin, 1865-66. 2 parts : 27 cm. (Guerinot 1906 $218. Hanayama 1961, $14366.; Hara 1985, 121) Contents 1. Theil: Einleitung 367-92.-Erster Abschnitt: Von der Sprache der Bhagavati 392-443. Nachtrag (den 22. November 1866). 443.--Inhaltsubersicht. 444. Contents 2. Theil: Zweiter Abschnitt : Inhalt der vorliegenden Bucher der Bhagavati. 155-242.- Erstes Buch 155-192.- Zweites Buch 192-210.-Drittes Buch 210-26.Vierunddreissigstes Buch (im Anfang unvollstandig). 227-29.-Funfunddreissigstes Buch 229-33. Sechsunddreissigstes bis vierzigstes Buch. 233-34.-Einundvierzigstes Buch 234-35.- Resume des Inhalts der vorstehenden Bucher und Darstellung der Hauptzuge des darin dem Mahavira zugeschriebenen Systems 236-42.-Dritter Abschnitt, die Legende von Khamdaka (Skandaka) in 2, 1, 18-80, 242-306.-Appendix I. Die Beschreibung der Person des Mahavira. 306-15. Appendix II. Die Beschriebung der Person des Indabhuti 315-20.-Berichtungen und Zusatze 320-21.-Wortindex 322-48. Inhaltsubersicht. 349-52. "Aus den Abhandlungen der konigl. Akademie der Wissenschaften zu Berlin 1865."
Page #101
--------------------------------------------------------------------------
________________ Angas 1876 1930 Review: LZ, Jg 1867, p. 294-96; Jg. 1868, p. 918 f. [The copy seen was in the large personal library of J. W. de Jong, Canberra, Australia (seen June 1996) and has signature 'S. J. Warren' on first title page and a number of pencil annotations throughout, parts of which have been lost in trimming during rebinding.] *[Bhagavati sutra aura Vivahapannattisutra [sic] with Abhayadeva's cty]. Mumbai : Sa. Ukedabhai Sivaji, samvat 1933 [1876]. 32 p. ; 24 cm. (Jain sutra sangraha aura Jaina holi Barbalsa; v. 1, n. 1). [Josi 1987, 66] 1. uddesaka only. 1937-38 *[Bhagavati sutra] Jamanagara: Hiralala Hamsaraja, 1937-38. 3 v. 12 x 27 cm. v.1: Satakas 1-5.-v. 2: Satakas 6-7.-v. 3: 1938. Satakas 8-9. Based on Viy.1881; 1917; 1917-31; 1918-21 (Josi 1987, 69). 1954 *The Uvasagadasao, the seventh anga of the Jain canon / edited... by P. L. Vaidya ... xiii, 248 p. Poona P. L. Vaidya, 1930. [In an appendix the 15th chapter of the Bhagavati Viyahapannatti] [Emeneau 3926] The appendix reprinted 1954 (see below) with the commentary of Abhayadeva. 1937-40 *[Text with Abhayadeva's Vrtti.] Ratlama: Rsabhadevaji Kesarimalaji, Jaina Sve. Samstha, 1937-40. (Up to Stabaka 14) [JSBI 1,187] "Bhagavativisesa pada vyakhya." Ratlama : Dana Sekhara Prakasaka, 1935 (Devendra Muni 1977, 712 item 10). v.1: 600 p.; 12 x 27 cm. [Josi 1987, 67]. Hindi: 1917 Srimadbhagavatisutram: pancadasam Gosalakakhyam satakam : Srimadabhayadevasurivaryavihitavivaranayutam / edited by N. V. Vaidya. Bombay: The Managing Trustees of The Godiji Jain Temple and Charities, 1954. 79 p. ; 19 cm. (Shri Vijayadevsur Sangh series; no. 9) Contents: Preface [1].-Publisher's note [2].--Srimadbhagavatisutram [Sataka 15][1]- 46. [Abhayadeva's cty] 42-47.-1. parisistam [Suy. 2.6] 71-73.-2. Dighanikayasthasamannaphalasutrat [with cty] 74-79.-Errata [81]. Text of the Viy. Sataka 15 reprinted from an appendix to P. L. Vaidya's 1930 edition of the Uvasagadasao, the commentary of Abhayadeva has been added by N. V. Vaidya. ANU PAMPHLET BL1312.3.B5332G5 1954 1973-85 Sudharma Svami's Bhagavati sutra : Prakrit text with English translation and notes based on the commentary of Abhayadeva Suri / by K. C. Lalwani. Calcutta : Jain Bhawan, 1973-85. 4 v. ; 23 cm. Contents v. 1: Publisher's note [vii-viii].--Translator's Foreword [ix]-xii.-Contents [xiii]-xv. [Satakas 1-2, text and translation] 1-219.-Notes 221-85.-Word index 287324. Subject index 325-34.-Sutra index [335]. Contents v. 2: Translator's Foreword [vii]-x.-Contents [xi]-xv.-[Satakas 3-6, text and translation] 1-317.-Notes 319-52.-Word index 358-88.-Subject index 389-403. Contents v. 3: Translator's Foreword [vii-viii].-Contents [ix]- xi.-[Satakas 7-8, text and translation] 1-299.-Word index 301-12. Contents v. 4: Publisher's note [v].-Contents vi-viii.-[Photo of translator (d. 10 Dec. 1983) facing p. viii].-[Satakas 9-11, text and translation] 1-250. ANU PK5003.A52 B5 1973 Translations: Gujarati: 1881 Megharaja Gani (Viy. 1881) 1917-31 Becaradasa Dosi and Bhagavanadasa Dosi (Viy.1917-31) 1961-72 Ghasilala (Viy.1961-72) Amolaka Rsi (Viy.1917) 82
Page #102
--------------------------------------------------------------------------
________________ 1.5 Viyahapannatti 1955-62 *[Bhagavatisutra Hindi translation / by Ghevaracandaji Barthiya Viraputra'] Bikanera : Agaracanda Bhairodana Sethiya, samvat 2112-19 [1955-62). 9 v. ; 18 cm. (Sethiya Jaina granthamala ; puspa 130-38). [Josi 1987, 69-70). Bhaga 1 (Sataka 1-2). samvat 2012 [1955]. 112 p. Bhaga 2 (Sataka 3-7). samvat 2013 [1956] 131 p. Bhaga 3 (Sataka 8-9). samvat 2014 (1957] 121 p. Bhaga 4 (Sataka 10-15). samvat 2014 [1957] 111 p. Bhaga 5 (Sataka 16-17). samvat 2015 [1958] 87 p. Bhaga 6 (Sataka 18-23). samvat 2016 (1959) 141 p. Bhaga 7 (Sataka 24). samvat 2017 (1960] 103 p. Bhaga 8 (Sataka 25). samvat 2018 [1961] 139 p. Bhaga 9 (Sataka 26 41). Samvat 2019 [1962] 99 p. 1961-72 Ghasilala (Viy.1961-72) 1982-86 Amara Muni (Viy.1982-86) 1994 > Sadhvi Pramukha Kanakaprabha (Viy.1994< > Partial translations: English: 1880-90 *IR. Hoernle, translation of Sataka 15 as an appendix to his Upasakadasa.] Calcutta: Bibliotheca Indica, 1880-90. [JSBI 1, 187). See Uvas. 1880-90. 1973 K. C. Lalwani (Satakas 1-11) (Viy.Partial edition. 1973-85) 1993 Roth. Gustav. Gosala Mankhaliputta's birth in a cow-stall : including notes on a parallel in the Gospel of Luke 2. In Jain studies in honour of Jozef Deleu / edited by Rudy Smet and Kenji Watanabe. Tokyo : Hon-no-Tomosha, 1993. xvi, 504 p. 22 cm. ; p. (413)-455. Text, translation and notes on part of Sataka 10 : Teyanisagga (Viy. 214-20). Text based on Viy.1953-54, 1961-72, 1974-82. German: 1865-67 A. Weber (Viy.Partial edition.1865-67) Gujarati: 1938 *[Bhagavatisara (abridged) Gujarati translation / Gopaladasa Jivabhai Patela.] Ahamad abada : Jaina Sahitya Prakasana Samiti, 1938. 20, 783 p. ; 18 cm. (Punjabhai Jaina granthamala ; 15) [JSBI 1, 187; Viy.1982-86:4, 103 (1st group); Josi 1987, 72] Hindi: 1954 *[Hindi 'visayanuvada', Sataka 1-20.] Madanakumara Mehata. Kalakatta: Sruta-PrakasanaMandira, Vi. Sam. 2011 (1954). 598 p. [JSBI 1, 187, Josi 1987, 69) 1966 *[Bhagavatisutra : sataka 15 Gosalaka / Hindi anuvadaka Rupendra Kumara Pagariya. Amadavada : Prakta Vidyabhandara, 1966. 67 p. ; 18 cm. (Josi 1987, 71] Rajasthani version: 1981-< > Jayacarya, Bhagavati-jora! / pradhana sampadaka Yuvacarya Mahaprajna ; sampadana Sadhvi-pramukha Kanaka prabha. Ladanum, Rajasthana : Jaina Visva Bharati, 1981-1990>. <1-3, 4, 6> v. ; 28 cm. (Jaya Vangmaya , grantha 14). Contents v. 1: Satakas 1-4: Sampadakiya / Sadhavi Pramukha Kanakaprabha dated 15 August 1986. [9]-14.- [Text, Rajasthani with extracts from Mula and Vftti printed beside] [1]-552. Parisista (a number of yantras) (553-59). Contents v. 2: Satakas 5-8. Contents v. 3: Sataka 9-11: Prakasakiya / Sricanda Ramapuriya, dated 4 March 1990. (mostly same as in v.2][8].-Sampadakiya/Sadhvipramukha Kanakaprabha [9]-11. 1 Jora: in Rajasthan this means a "couplet."
Page #103
--------------------------------------------------------------------------
________________ Angas Visayanukrama [13].--Text, Satakas 9-11. [1]-472. Rajasthani verse translation of Viy. (incorporating much from Abhayadeva's commentary) printed with the appropriate original passages of the Vstti. *v. 4 1994. *v. 6 1996. ANU BL1312.3.B536 J39 1981 (v.2 and 3) ANU NBC 2 036 653 and 4 Studies: Bhatt, Bansidhar. 1977. A critical study of ... Bhagavati 11.10.419. Tulasi prajna 3 (1977) 102-20. . 1983. Stratification in satakas 1-20 of the Viyahapannatti, Indologica Taurinensia 9 (1983), 109-18. Deleu, Jozef. 1965. Over een fragment van de Viyahapannatti, Orientalia Gandensia 2 (1965) 145-87. [Superseded by Deleu 1970.] . 1970. Viyahapannatti (Bhagavai): the fifth Anga of the Jaina canon : introduction, critical analysis, commentary and indexes / Jozef Deleu. Brugge: Rijksuniversiteit te Gent, 1970. 357 p. ; 25 cm. (Facc. Lett. ; 151). Contents: Preface. 9-10.-Bibliography and abbreviations 11-15.--Introduction 17-69.Critical analysis and commentary 71-315.--Indexes [Proper names, terms and topics 319-54. Contents 355-359). Review article. K. K. Dixit, A Recent study of Bhagavatisutra reviewed Sambodhi 1.3 (1972) 59-78. ANU BL1311.552D4 and PK5003.A52B5 1970 Reprint. Delhi : Motilal Banarsidass, 1996. Review Royce Wiles IIJ 43 (2000) 54-57. -- 1987-88. A further enquiry into the nucleus of the Viyahapannatti. Indologica Taurinensia 14 (1987-88) 169-79. Devendra, Muni. 1992. * Bhagavati sutra : eka parisilana/Devendra, Muni. 1. avatarana. Udayapura : Sri Taraka Guru Jaina Granthalaya, 2049 [1992] 8,255 p. ; 22 cm. (Sri Taraka Guru Jaina granthamala ; puspa 300). ANU ON ORDER 15 May 1996 Ohira, Suzuko. 1993. An abstract of "A study of the Bhagavatisutra: a chronological analysis". In Jain studies in honour of Jozef Deleu/ edited by Rudy Smet and Kenji Watanabe. Tokyo : Honno-Tomosha, 1993. xvi, 504 p. ; 22 cm. p. [395) 411. Abstract of work under the guidance of D. D. Malvania entitled "A study of the Bhagavatisutra : a chronological analysis" (p. 395). I have not traced the appearance of the five 'Notes' given on page 411 to references in the text of the article. Full version published 1994, see below. ANU NBC 2 064 239 1994. A study of the Bhagavatisutra : a chronological analysis. Ahmedabad : Prakrit Text Society 1994. xi, 276 p. ; 28 cm. Contents: Publisher's note-Foreword / Klaus Bruhn, Klaus Butzenberger [il-v.-Table of contents vi-vii.--Preface ix-xi.- Chapter 1. Canonical stages: a chronological survey of the canonical texts. 1-39.-2. Text construction of the Bhagavatisutra I-XX : table of synopsis 40-73.--3. Text analysis 74-207.-4. Conclusion 208-39.-Appendices. 1. Notes 240-44.-2. Bibliography 245-47.-3. Dharma-adharma 248-54.-Sutra index 255-76. Review. C. Caillat. BEI 11-12 (1993-94) 469-72. Excludes chapters 15, 21-41. ANU NBC +2 178 740 Sikdar, Jogendra Chandra. 1964. Studies in the Bhagawatisatra / by Jogendra Chandra Sikdar. Muzaffarpur, Bihar : Research Institute of Prakrit, Jainology & Ahimsa, 1964. xxiv ; 658 p.; 25 cm. (Prakrit Jain Institute Research Publications Series ; volume 1). Contents: General editor's note / Nathmal Tatia (vii)-viii.-Preface fix-xv.-Contents 84
Page #104
--------------------------------------------------------------------------
________________ 1.5 Viyahapannatti [xvii]-xx.-Abbreviations [xxii]-xxiv.-1. Position of the Bhagavati sutra in the ArdhaMagadhi canon. [1]-30.-2. Authorship and date of the Bhs. [31]-61.-3. Political conditions as reflected in the BhS. [62]-145.-4. Social conditions [146]-267.-5. Economic conditions [268]-326.--6. Education [327]-387.-7. Various leaders of thought, their philosophical and religious systems mentioned and described in the BhS. [388]464.-8. [Historical data found in the Bhs.] [465)-517.-9. Cosmology, cosmography and geography (518)-554.-10. Contribution of the BhS, to the evolution of Jaina philosophical thought (556)-607.-11. Value of the Bhs. from the literary, historical and philosophical points of view (608)-626.-Bibliography (6271-638.-Index [6391-658.Correction slip. Thesis. Bihar University, Muzaffarpur, 1961 (Jain, Sagarmal and Arun Pratap Singh. 1983 $41). ANU PK5003.A52 B557 1964 *Vidyavijaya. 1975-81. Bhagavatisutra sara sangraha/lekhaka Vidyavijayaji Maharaja ; sampadaka vivecaka Purnanandavijayaji. 1. avstti. Saila [?] : Vidyavijayaji Granthamala, 1975-81.4v. ; 19 cm. (Josi 1987, 73-74) v. 1: Sataka 1-5. 1975. 35, 10, 543 p.-v. 2: Sataka 6-11 / Purnananda vijaya 1977.50, 592 p.--v. 3. Sataka 12-20.--v. 4 Sataka 21-41 / Purnanandavijaya 1981. 28, 572 p. *Vijayadharma Suri. 1961. Bhagavatisutra pravacano / pravacanakara Vijayadharmasuri. 2. avstti. Vadodara : Muktikamala Jaina Mohanagranthamala, Vi. sam. 2018 [1961]. 29, 263 p. ; 25 cm. (Muktikamala Jaina Mohana granthamala; 57). [Josi 1987, 73] 1. avstti. samvat. 2012 (1955). Vijayalabdhisuri. 1951-53. Sri Bhagavatiji sutranam vyakhyano / vyakhyanakara Vijayalabdhi surisvaraji Maharaja ; avataranakara Sri Vikramavijayaji Maharaja ; samyojaka ane sampadaka Saha Cimanalala Nathalala (Srikanta). Prathamavrtti. Chani, Ji[la]. Vadodara: Saha Candulala Jimanadasa, Sri Vira sam. 2477-79. Vi. sam. 2007-08. Sane 1951-53.2 v.[only?] ; 19 cm. Contents v.1: Grantha-mahattva [1]. Granthanirmana ange (2).-Abhara-darsana 34).--Anukramanika [5]. [Donor details 6.-Sri Bhagavatiji sutranam vyakhyano (Sri Jinastuti] [1]-556. Contents v.2: Prakasana ange abhara-darsana (3-4).--Sampadakiya nivedana [5-6).... Suddhi-sucana [71-8. [v. 2] Anukramanika [91-28.-Sri Bhagavatiji sutranam vyakhyano : 2. bhaga Sastraprastavana [1]-556. "Prata 2 000." ANU BL1312.3. B536 L3 1951 and 1953 Indexes: 1974 or 1975 (Viy.1974 or 1975) indexed in Agama sabdakosa : angasuttani sabdasuci = Word-indexes of Angasuttani/ sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2037. <1980- >.<1 v.>; 25 cm. 1974-82 (Viy. 1974-82) v.3: 1. Parisittham Viyahapannattisuttantaggayanam gahanam anukkamo p. [1191)-92.-2. Viyahapannattisuttantaggayanam saddanam anukkamo [1193)-1546.-3. Viyahapannattisuttantaggayanam visesanamanam anukkamo [15471-1557. 1982-86 (Viy.1982-86) v. 4: Parisista 1. Vyaktinamanukramanika p. [769]-772.-2. Visistasthana namanukramanika [773]-776.-3. Bhagavatinirdista sastra-namanukramanika (777]-778. 4. Katipaya visista sabdasuci (779). 1994 > (Viy.1994 > v.1: Parisista. 1. Namanukramah vyakti aura sthana. p. [303]-304.-2. Bhasyavisayanukrama [305]-310.-3. Paribhasika sabdanukrama (311)-329. Partial indexes: 1970 Deleu (Viy.Studies, 1970) Indexes [Proper names, terms and topics) p. 319-54. 1973-85 Lalwani (Viy partial edition. 1973-85) v. 1-3 each contain a word index, covering Satakas 1-8.
Page #105
--------------------------------------------------------------------------
________________ Angas 1 1876-78 *[Text and Gujarati commentary in Prakaranaratnakara (vol. 3) by Bhimsimha Manck, Bombay, 1876-78)]. [BORI Cat. 17:1, 81] 1912 2 1917 3 1912 4 1912 5 TEXTS BASED CLOSELY ON THE VIYAHAPANNATTI Nigodasarimlik "Exposition of the Nigodas in 36 verses in Prakrit together with the Sanskrit commentary. The expositon is based on [Viy. XI, 10] and the verses are quoted by Abhayadeva Suri, in his commentary on this fifth anga". [BORI Cat. 17:1, 100]. B. Bhatt in his paper at the Xth World Sanskrit Conference, Bangalore, January 1997 says this text is originally from the Vyakhya. Commentary by Ratnasimha Suri. [BORI Cat. 17:1, 101] Balavabodha (Gujarati) by Udayanandi Suri [BORI Cat. 17:1, 103] 1912 [Text and the commentary with Paramanukhandasattrimsika and Pudgalasattrimsika and the commentary on both of them by Ratnasimha Suri. Jaina Atmananda Sabha, samvat 1969 [1912. .[BORI Cat. 17:1, 93] Paflcanirgranthasamgrahap = Pafcanirgranthas@tra "... composed in 107 verses in Prakrit, explains the nature of the five types of nirgranthas or the Jaina saints. It is based on sixth uddesaka of the 25th sataka of [Viy.] " [BORI Cat. 17:1, 104] Commentary by Yasovijaya (pupil of Nayavijaya) Balavabodha [BORI Cat. 17:1, 108] Also an Avacuri [BORI Cat. 17:1, 109] *[Text with Avacuri and another work named as Prajnapanopagangatrtiyapada-samgrahani. Bhavnagar: Jaina Atmananda Sabha, samvat 1974 [1917]. "62. jewel of their series." [BORI Cat. 17:1, 104] Paramapukhandasantrimsika "Exposition of pudgalas regarding their duration from four different aspects, in 36 Prakrit verses based upon [Viy. V,7], together with their elucidation in Sanskrit. This exposition is preceded by that of Abhayadeva Suri." Written before the time of Abhayadeva. Commentary. Arthalava by Ratnasimha Suri (his probable date is 1245 according to C. M. Duff in The Chronology of India. Westminster, 1899. p. 190. [BORI Cat. 17:1, 92] [Text and the commentary with Pudgalasattrimsika and Nigodasattrimsika and the commentary on both of them by Ratnasimha Suri. Jaina Atmananda Sabha, samvat 1969 [1912]. [BORI Cat. 17:1, 93] Pudgalasarimika "Exposition of both the types of pudgalas viz. sapradesa and apradesa from four view-points. It is based on [Viy. V,8]." Written before the time of Abhayadeva. Commentary by Ratnasimha Suri. [BORI Cat. 17:1, 96] [Text and the commentary with Paramanukhandasantrimsika and Nigodasattrimsika and the commentary on both of them by Ratnasimha Suri. Jaina Atmananda Sabha, samvat 1969 [1912]. [BORI Cat. 17:1, 93] Bandhasattrimsika "A portion of [Viy. VIII,9] together with the corresponding gathas in Prakrit and the tippanaka in Sanskrit, deals with the numbers of living beings having various kinds of bodies, each having different types of bandhas." Written before the time of Abhayadeva. Commentary by Ratnasimha Suri. An avacuri by Vanarsi Gani. [BORI Cat. 17:1, 98-99] B. Bhatt in his paper at the Xth World Sanskrit Conference, Bangalore, January 1997 suggested this text was originally from the Vyakhya on the Viy. [Text with Vanarsi Gani's Avacuri, Bhavanagar: Atmananda Sabha, samvat 1969 [1912] 12 jewel of its series. [BORI Cat. 17:1, 99] 86
Page #106
--------------------------------------------------------------------------
________________ 1.6 NAYADHAMMAKAHAO (Naya.) Title: Jnatydharmakatha (Skt). Contents: Examples of religious narratives.' Book I... consists of 21 chapters, each one of which as a rule presents a complete, independent narrative. Most of these tales are of the type which lays more stress on some parable incorporated in them than on the tale itself, some are, indeed, nothing but parables spun out and enlarged to form narratives." "Book II ... is in complete contrast to Book I both in form and contents, and is more closely associated with [Uvas. and Anuttaro.l" (Winternitz 1933:2, 446, 448). "There existed two recensions of the Jnatadharmakatha-extensive and more extensive. Acarya Shri Abhayadevasuri follows the more extensive one ... The extant manuscripts are seen to follow this recension. But the variants yielded by the other recension are noted in the commentary at various places." (Muni Jambuvijaya, English introduction to Naya.1989a, p. 120). References: JRK 146-47; BORI Cat. 17:1, 113-25; JSBI 1, 217-24: Schubring 1935 846. Exegesis Abhayadeva, Vrtti, composed samvat 1120 [1063). Printed. Naya.1876; 1919; 1951-52; 1987. Kanakasundara Gani, disciple of Vidyaratna Gani of the Brhat-tapagaccha. Gujarati version (tabu), the manuscript in the India Office Library is dated samvat 1703 (CGRM 14-15). Kasturacandra, pupil of Jayaratna of Kharatara Gaccha, Tika composed samvat 1899 [1842] (JRK 147). Laksmikallola, pupil of Harsakolla, Mudgavabodha (JRK 147). Vrtti (JRK 147). Alapaka (JRK 147). Upanayagathavitti (JRK 147). 1876 Editions: *natadharmmakathanga-sutra : sasthama anga / Ganadharasudharmasvamikstamulasutra tad upari Srimadabhayadevacaryya Suriksta tika ; Vijayasadhuna samsodhitam. Kalikata : Nutana Samskrta Yantra, samvatsare 1933 [1876). [3], 1530 p. ; 11 x 25 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 6). [CLIO 2, 1190; Emeneau $3922. Roth 1983,9-10; Univ. of Chicago Library catalogue] 1918 *Inata dharmakathanga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina) : Jaina Sastroddhara Mudralaya, 1918. 792 p. ; 13 x 23 cm. 1919 Srimat Jnatadharmakathangam : Candrakulalankarasrimadabhayadeva surisutritavivaranayutam. Mehesana : Agamodayasamiti, Virasamvat 2449. Vikrama sam. 1975. Kraista 1919.253 [ie. 506) p. ; 12 x 27 cm. (CLIO 2, 1190) "In der [Naya.1919)-Ausgabe liegt ein Handshriftennachdruck vor, der gut lesbar, ubersichtlich gedruckt ist." (G. Roth, Naya.partial edition. 1983,9). "Pratayah 1000." BORI 1928 *[Nayadhammakaha/ edited by Sastri Jethalal Harishankar with Gujarati translation in two parts. Bhavnagar : Jaina Dharma Prasaraka Sabha, samvat 1986 (1928). [BORI Cat. 17:1, 114; Antagad. 1932b 116 (third group); "Vi. sam. 1985 (1928]" JSBI 1,217] 1940a Nayadhammakahao = Nayadhammakahao : the sixth Anga of the Svetambara Jain canon/ critically edited by N. V. Vaidya. Poona : Prof. N. V. Vaidya, 1940. iii, 245 p. ; 22 cm. Contents: Preface. [i].-Introduction [description of 5 MSS. from BORI] [i]-[iv]. -
Page #107
--------------------------------------------------------------------------
________________ Angas Nayadhammakahao [1]-230. Variant readings [231]-245. Numbers of the BORI MSS used: 126 (193 of 1871-72) 128 (790 of 1895-1902) 124 (32 of 1869-70) 127 (192 of 1871-72) 129 (430 of 1882-83) Only 124, 128 and 129 were fully collated to establish the text. "A word of explanation is necessary for giving all the variants at the end. Practically all the variants are merely orthographical. There are hardly any variants that change the sense. That clearly shows that the traditional text has been faithfully handed down" (Introduction, p. [iv]). Text based on BORI MS no. 124 (Roth, Naya.Partial edition. 1983, 10). Some of Vaidya's readings are to be preferred (K. R. Norman, review of Naya.Partial edition. 1978, (p. 90)). ANU BL1312.3 .N39 1940 1951-52 Srijatadharmakathangam: vartamanasasanamanyasutrakarapancamagapadharapravarasrisudharmasvamisandrbdham, tatsutrartharahasyakara-srimadbhadrabahusvaminirmita niryuktiyutam, navangivrttikara-srimadabhayadevasurivihitavivaranasusobhitam, sampadakiyavividhapratyantarapathadyanekaparisistasamalankrtam ca / samsodhakah sampadakas ca Acaryasricandrasagarasurih. Mumbai: Srisiddhacakra-sahityapracarakasamiti, Virasamvat 2478-79 [1951-52]. 2 v. ; 12 x 28 cm. (Srianandacandragranthabdau (grantharatnakare); grantharatnam 16, 18). v. 1: 58, 162 [ie. 116, 324] p.-v. 2: 6, 38, 163-260 [ie. 12, 76, 326-520] p. Contents v.1: [Donor details] 2a. Prakasikanum nivedana 2b-5a.-Parisista 1. Vacanabheda-pathantara-sangrahah 5b-9a.-2. Srijnatadharmakathangavrttau agatah arsaprayoga-nipatana-vyakaranapathah 9a-9b.-3. Saksikapathah. 9b-10b.Suddhipatrakam 11a-13a.-4. Varnaka (vannao)yavat(java)sabdatidistapathah. 13b26b.-5. Prathama-Sriutksipta(Meghakumara)-adhyayana-saramsah 27a-31b.-DvitiyaSrisanghatakadhyayanasaramsah 32a-34a.-Trtiya-Sriandakadhyayana-saramsah 34a 35b. Caturtha-Srikurmadhyayana-saramsah 35b-36a.-Pancama-Srisailakadhyayanasaramsah 36a-39b.-Sastha-Tumbakadhyayana-saramsah 40a. Saptama-Srirohiniadhyayana-saramsah 40a-41b.-Astama-Srimalliadhyayana-saramsah 41b-47b.Jnatadharmakathanga-prastavana /... Anandasagarasurisvaracaranaravindacancarikacandrasagarasuri 48a-58a.-Srijnatadharmakathange prathamavibhagasya anukramanika 58b. Srijnatadharmakathange [Adhyayanas 1-8] 1a-162b. Contents v. 2: Srijnatadharmakathange dvitiyavibhage prastaavana / Srianandasagarasurisvara-caranaravindacancarikah Candrasagarasurih 2a-4b.-Srijnatadharmakathangadvitiyavibhage prakasikanum nivedana 5a-6a.-Hamaram prakasano 6b.Srijnatadharmakathange dvitiyavibhage saramsah. 9. Srimakandidarakadhyayanasaramsah la-3a.-10. Sri Candrajnatadhyayanasaramsah 3a-4a.-11. Sridavadravaadhyayana-saramsah 4a-4b.-12. Sriudaka-adhyayana-saramsah 5a-6a.-13. Sridardura-adhyayana saramsah 6b-7b.-14. Sritetaliputra-adhyayana-saramsah 8a10a.-15. Srinandiphala-adhyayanasaramsah 10a-11a.-16. Sriaparakanka-adhyayana saramsah 11a-24a.-17. Sriasvajnata-adhyayana saramsah 24b-26a.-Adharama Sri Sumsamajnata-adhyayanano saramsah 26a-28b.-Oganisama Sripundarikaadhyayanano saramsah 29a-31a.-Srijnatadharmakathangana dvitiya srutaskandhasya saramsah 31a-37b.-Srijnatadharmakathange dvitiyavibhagasya anukramanika 37b.-- Suddhipatrakam 38a-b.-[Adhyayana 9-19] 163a-252b.-Srijnatadharmakathange dvitiyasrutaskandhavivaranam 253a-260b. Carefully edited (Roth 1983, 10, 223). ANU BL1312.3.N396 C3 1951 v. 1-2 1953-54 Suttagame/carimatitthayara-pancamaganahara-Suhammayariyaviraie ; [sutthuruvena] Pupphabhikkhuna sampadio. 1. avrtti. Gudagamva-chavani, Purvapanjaba: Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354. 2 v.; 19 cm. Nayadhammakahao v.1, 941-1125. ANU BL1310.S8 1954 2 v. 88
Page #108
--------------------------------------------------------------------------
________________ 1.6 Nayadhammakahao 1963 Sri Jnatadharmakathangasutram = Shree Jnatadharama kathanga sutram / GhasrlalajiMaharaja viracitaya Anagaradharmamrtavarsinyakhyaya vyakhyaya samalankrtam Hindi - Gurjara-bhasa'nuvadasahitam. Prathama-avsttih. Rajakota, Saurastra : Sri A[khila). Bha[rata). Sve[tambara). Stha[nakavasi). Jainasastroddharasamiti, Vira samvat 2489 [1963). 3 v. ; 25 cm. 1. bhagah (adhyayana 1.1-1.4): 2, 2, 749 p.-2. bhagah (adhyayana 1.5-1.13): 6, 44, 788 p.-3. bhagah (adhyayana 1.14-end.): 7, 852 p. "Prati 1200." Reprint. Vira samvat 2517. Vikrama samvat 2047. Isvisan 1991-93. ANU PK5003.A52J5 v.1-3 1964 Srimad Jnatadharmakathanga sutra : Hindi-anuvadasahita / sampadaka Sobhacandra Bharilla. Prathamavrtti. Pathardi, Ahamadanagara : Sri Tiloka Ratna Sthanakavasi Jaina Dharmika Pariksa Borda, 1964. 8, 616,8 p. ; 22 cm. Contents: Prastavana (3)-5.-Prakasakiya [6]-8.Srimad Jnatadharmakathangam [1]613.-Parisista [Notes] [1]-[8]. A concise translation, prepared for students (Bharilla, Naya.1981, 10 (1st group)). "1000 (copies)." ANU PK5003 A52J5 1964 Sri Jnatasutrani kathao : bamne sruta skandha sathe / sampadaka Jivanalala Chaganalala Sanghavi. 2. avstti. Amadavada : Sthanakavasi Jaina Karyalaya, Vi. sam. 2022 [1966). [8], 152 p. ; 18 cm. Contents: Arpana (3).-Prastavana (2. avstti) [4).--Paheli avsttini prastavana (51-7.Kathaono visayanukrama [8].--Sri Jnatasutrani kathao [1]-152. ANU BL1312.3.N395 S3 1966 1966 1974 or 1975 Angasuttani : Niggantham pavayanam / sampadaka Muni Nathamala [Yuvacarya Mahaprajna). Ladanum, Rajasthana : Jaina Visva Bharati (Samsthana), Vikrama samvat 2031 [1974 or 1975). 3 v. ; 25 cm. Nayadhammakahao v.3,[1]-391. [v. 3 Dvitiya samskarana. Vikrama samvat 2048. 1992.] "Original text critically edited" on the basis of three manuscripts-Ka.' palm leaf from Jaisalmer Bhandar (no details but there are only two manuscripts of this text in that collection no. 17 (undated but estimated to be last half of 13th cent. samvat) and 395 (undated, estimated to be first half of 12th cent. samvat, it has a number of pages missing); *Kha.' and 'Ga.' from the Gadhaiya Pustakalaya, Saradarasahara, 14-15th cent. samvat, and samvat 1554 [1497) respectively; and 'gha.' a Tabba made use of from adhyayana 12 onwards. Described on p. 14-15 (1st group). This volume is part 3 of a complete edition of the canon. The pagination given in the margin (ends with 257' on p. 371 here), does not match Naya. 1951-52 and so may be from Naya. 1919 (unconfirmed). ANU PK5003.A52 1974 3 v. and BL1312.2 1975 3 v. 1981 Jnatadharmakathanga sutra : Pancama Ganadhara Bhagavatsudharma-Svami-pranita sastha Anga : mulapatha, Hindi anuvada, vivecana, parisista yukta / samyojaka tatha pradhana sampadaka Yuvacarya Srimisrimalaji Maharaja 'Madhukara'; sampadaka-vivecakaanuvadaka Sobhacandra Bharilla. Byavara, Rajasthana : Sri Agamaprakasana-samiti, Viranirvanasamvat 2508 [1981). 16, 60,576 p. ; 24 cm. (Jinagama-granthamala; granthanka 4). Contents: Prakasakiya (1)-2.-Amukha/Misrimala *Madhukara'19)-11.- Donor details 13-14. Sampadakiya : yatkincit / Sobhacandra Bharilla 15-17).-Prastavana / Devendra Muni 1-45.-Visayanukrama [47]-60.-Nayadhammakahao (1)-556.Parisista 1. Uvanaya-gahao (559)-569.-2. Vyakti-nama suci (570)-573.-3. Sthalavisesasuci (574)-576.- [Donor details). Hindi translation published earlier (Naya.1964) has here been made somewhat fuller by many of the java passages being given in detail (Sampadakiya, p. 10). Reprint 1989a. ANU PK5003.A52J43 1981 Sri Jnata-dharmakathangam : pujya Ganadharapranitam navangivrttikara-pujyacaryapungava Srimadabhayadevasurisvaravivrtam sasthamanga / sampadaka [sic] samsodhakas ca Srivijayajinendra surisvarah .... Prathamavrttih. Santipuri, Baya, Jamanagara : Sri Harsapuspamrta Jaina Granthamala, Vira Sam[vat] 2513 [1987]. 16, 542 p. ; 14 x 26 cm. 1987 89
Page #109
--------------------------------------------------------------------------
________________ Angas (Sri Harsapuspamsta Jaina Granthamala ; 166). Contents: Abhara darsana 2-3-Prastavana / Jinendra Suri 4-8.-Anukramah 9-10.Suddhipatraka 11-15.Srijnatadharmakathangam [1]-541. "Prata yah 750." ANU BL1312.3.N39 1987 1989a Nayadhammakahao = Jnatadharmakathangasutram : pancamaganaharabhayavamsirisuhammasamiviraiyam chattham Angam / sampadakah, Muni Jambuvijayah ; sahayakah Muni Dharmacandravijayah. Bambai: Sri Mahavira Jaina Vidyalaya, Vira sam. 2516 [1989). 33, 129, 570 p. ; 25 cm. (Jaina-agama-granthamala, granthanka 5). Contents: Granthanukramah [9].-Prakasakaya nivedana 11-15.-Abhara [16].-Rna svikara (17).-Atma Vallabh Sanskriti Mandir : memorial, architecture and activities = Atma Vallabha Samsksti Mandira : smaraka-sthapatya evam pravsttiyam (memorial to Vijayavallabha Suri, 1870-1954)] 19-33.-Jinagama jayakara (prastavana) / Muni Jambuvijaya [1]-50.-Nayadhammakahao sutranam tippana /Becaradasa Dosi (reprinted from Bhagavana Mahavirani dharmakathao : Nayadhammakaha, 1950 (see Gujarati translations below)] [51]-76.--Eka anusilana / Devendra Muni (reprinted from Naya. 1981|1771-108.-Amukham / Muni Jambuvijayah [109]-115 = Introduction 117124.-Jnatadharmakathangasutrasya saparisistasya vinayanukramah [125]-129.Nayadhammakahao (1-373.-1. parisistam JnatadharmakathangasutrantargatavisistaSabdasucih (375)-499.-2. Jnatadharmakathangasutrantargatanam gathardhanam akaradikramena sucih (500)-501.-3. 'Vannao'adigrahyah pahah [502]-526.-4. Java'sabdagrahyah pathah (527]-557.-5. Upanayagathah (558)-563.-6. Katipayani visistani tippanani (564)-566.-Suddhipatrakam [567]-570.-Prastavananum suddhipatraka 570. ANU NBC 1 799 198 1989b Reprint of Naya.1981. 1991-93 Reprint of Naya.1963. "Prati 250." 1992 Reprint of Naya.1974 or 1975. 1996 *Illustrated Jnata dharma kathanga sutra : original text with Hindi and English translations/ editor-in-chief Amar Muni: editor Srichand Surana 'Saras'. Ist. ed. Delhi : Padma Prakashan, 1996.2 v.; col. ill. ; 25 cm. [DK-110773, DK booklist CIR-1818/98-99 item 124] Partial editions: 1881 Specimen der Navadhammakaha: Inaugural-Dissertation zur Erlangung der philosophischen Doctorwurde an der Koniglichen Akademie zu Munster / von Paul). Steinthal aus Berlin. Leipzig: G. Kreysing, 1881.84 p. ; [photocopy 22 cm). [Emeneau 3923; Guerinot 1906 $222; description from photocopy of work] Contents: Einleitung 1-7.-Naya text with variants] [8]-36.--Auszuge aus dem Commentar des Abhayadevasuri und Anmerkungen zum Texte (37)-52. Samskrt-Glossar (53)82. Sources: For the edition of the text Steinthal had six MSS, five from the konigl. Bibliothek zu Berlin (1) B. Ms.orient.fol. 651, 136 leaves; (2) C. Ms.orient.fol.652. 189 leaves, also has Abhayadeva's cty; (3) D. Ms.orient.fol.1013, the only dated MS, samvat 1658 [1601), with marginal glosses; (4) E. Ms.orient.fol. 1014; (5) F. Ms.orient.fol.1082; (6) a MS in Jacobi's collection, 199 leaves, 11 lines per pace, about 38 aksaras per line. For the commentary the editor has preferred Jacobi's well-written MS since Ms.orient.fol. 675 is badly written (sources described Einleitung, p. 1-2). The text then is based on ABC and the two good MSS of the cty (C and no.6 above). Gives text up to folio 52a of Naya.1919 (Schubring 1935, $46). 1923 Jain, Banarsi Das. Ardha Magadhi reader. Lahore, 1923. lxv, 178 p. ; 22 cm. Extract 2. Mehe kumare [Naya 1.1, variants from Naya.1876; 1919] 13-38. Translation 2. Prince Meha/B. D. Jain 94-119. Reprint. Delhi : Sri Satguru Publications, 1982. ANU PK 1255.J34 1982 90
Page #110
--------------------------------------------------------------------------
________________ 1952 1978 1982a 1982b 1983 1995 Gujarati: 1876 1928 1931 1950 *Malli-Jnata, das 8. Kapitel im 6. Anga: Nayadhammakahao, des Svetambara-Jainakanons. Hrsg., ubers. und erl. [Mschr.] / Gustav Roth. 1952. Getr. Pag.-Munchen, Phil. Diss. 1952. [Janert 1961, item 593a] Printed with additions Naya.Partial edition. 1983. Nayadhammakahao: das sechste Anga des Jaina-Siddhanta : Einfuhrung, kritische Nacherzahlung mit Ausgabe der wichtigeren Textpartien, Kommentar und Glossar / von Walther Schubring, aus dem Nachlass herausgegeben von J. Deleu. Mainz: Akademie der Wissenschaften und der Literatur, 1978. 79 p. ; 24 cm. (Abhandlungen der Geistes- und Sozialwissenschaftlichen Klasse; Jahrg. 1978, Nr. 6). Contents: Vorbemerkung des Herausgebers [5].-Einleitung [6]-11.-[Naya.1-19]. [12]64. Glossar [65]-68.-Notes [69]-72.-Anhang 1. Aryas aus der Jnata-Vrtti [72]-77.Anhang 2. Die Dhammakaha des 6. Anga / Jozef Deleu [78]-79. Review. K. R. Norman. JRAS (1981) 89-90. 1.6 Nayadhammakahao ANU PAMPHLET BL1312.3.N394G4 1978 Sri Jnatadharmakathanga sutra : Gujarati anuvada sahita / anuvadaka Sadhvi Vanitabhai; sampadaka Sobhacandra Bharilla. Ghatakopara, Mumbai: Prema-Jinagama Prakasana Samiti, Samvat 2037. I. sa. 1982. 18, 536 p. ; 24 cm. (Prema-Jinagama prakasana, granthanka 13). "Prata 1000." Pkt. text (in Devanagari) and Gujarati translation in parallel columns. Translations: English 1996 (Naya.1996) Reprint of Naya.Partial edition. 1923 (Jain, Banarsi Das). Malli-jnata: das achte Kapitel des Nayadhammakahao im sechsten Anga des Svetambara Jainakanons: herausgegeben, ubersetzt und erlautert/Gustav Roth. Wiesbaden: Franz Steiner, 1983. 230 p. ; 25 cm. (Monographien zur indischen Archaologie, Kunst und Philologie ; 4). Contents: Einleitung. [9]-64.-Der Text des Malli-Jnata [und] Deutsche Ubersetzung des Malli-Jnata [66]-143.-Anhang: Varianten zum Text des Malli-Jnata [144]-152.-- Berichtigungen und Erganzungen zum Text 153.-Erlauterungen zum Text [und zur Ubersetzung] des Malli-Jnata [154]-220.-Abkurzungen [221].-Literatur-Verzeichnis [222]-223.-Erganzungen zum Literatur-Verzeichnis [224].-Ausgewahltes Worterverzeichnis [225]-30. Text established using one MS. from Cambay samvat 1184 [1127], on p.1 of the Cambay catalogue and two from Calcutta-both from Gulab Kumari Library of P. C. Nahar, Indian Mirror Street, MS. 26 in Bundle no. 4., and one fragment of two pages-and Naya.1876; 1918; 1919; 1940; 1951-52; 1953-54 (described p. 9-16). "Munchen, Phil. Diss. 1952." Text based on Naya.1919 (p. 9). Review. AO 47 (1986) 230-33. ANU BL1312.3 .N3942 M3515 1983 Nayadhammakahao = Jnatadharmakatha : adhyayana 2 thi 7/ sampadaka Ara. Ema. Saha. Amadavada: Parsva Prakasana, 1995. 120 p. ; 22 cm. Bare text (Devanagari) facing Gujarati translation. Gujarat University course book. RW (Naya.1876) (Naya.1928) RW 91 *[Jnatadharmakathasutra [with Gujarati translation] / Dattatreya Balakrishna Kalelkar.] Ahamadabada, 1931. (Punjabhai Jaina granthamala; 3). [JSBI 1, 217; JRK 146] Bhagavana Mahavirani dharmakathao: Nayadhammakaha / anuvadaka Becaradasa DosT.
Page #111
--------------------------------------------------------------------------
________________ Angas 2. avstti. Ahmadavada : Gujarati Vidyapitha, 1950. (Sri Punjabhai Jaina granthamala ; 3). xxv, 242 p. ; [1 plate) ; 18 cm. Contents: Prakasakanum nivedana [3).-Anukramanika (5)-6.-Anuvadakanum nivedana 7-8.-Drsti ane bodha /Dattatreya Balakrsna Kalelakara 11-25.-Bhagavana Mahavirani dharmakathao: Nayadhammakaha 1-163.-Tippano 167-230.-Kosa 23142.-Suddhipatra (243). "Prathama avytti 1931." ANU BL1371.343 1950 1063 1963 1966 1982 Ghasilala (Naya.1963) [= 1991-93] Jivanalala Chaganalala (Naya. 1966) Vanitabhai (Naya.1982a) Hindi: 1918 1938 Amolaka Rsi (Naya.1917) *[Hindi anuvada / Muni Pyaracanda.] Ratlama : Jainodaya Pustaka Prakasaka Samiti. Viskrama) samsvat). 1995 (1938). [JSBI 1,217] 1963 1964 1996 Ghasibala (Naya. 1963) [ = 1991-93] (Sobhacandra Bharilla) (Naya.1964 = Naya.1981) (Naya.1996) Partial translations: English: 1940 Nayadhammakahao : chapters 4 to 8 (both inclusive), and 9 and 16: English translation, notes, etc./ by N. V. Vaidya, Poona : N. V. Vaidya, 1940.2 v. in 1. (pt. iv, 52, 34 p. ;pt. 2. xx, 17-44. Contents pt. 1. : Introduction (i)-iv.-Nayadhammakahao translation, chapter IV [1]3.--Chapter V 3-16.--Chapter VI 17.-Chapter VII 18-23. Chapter VIII 23-52.--Notes Chapter IV [1]-3.--Chapter V 3-12. Chapter VI 12.--Chapter VII 12-15.--Chapter VIII 15-34. Contents pt. 2.: I largely the same as in pt. 1]i-v.-II. Summary of Chapter IX v-ix.III. Summary of Chapter XVI ix-xvii.-Appendix (i) The story of Draupadi xvii-xix.Appendix (ii) Textual and general questions (model exam questions xix-xx. [Pages 117 presumably contain the translation of chapters 9 and 16, however they are not present in the Univ. of Washington copy) Chapter XVI [Notes 17-44. Text from Naya.1940 edition (Roth. Naya.Partial edition. 1983, 10). [University of Washington, Seattle] 1990 Bollee, Willem B. The Peacock egg: a parable of Mahavira (annotated translation of] Nayadhammakahao 1,3). In, Granoff, Phyllis. The Clever adulteress and other stories: a treasury of Jain literature / edited by Phyllis Granoff. Oakville, Ontario: Mosaic Press, 1990. 290 p. ; 23 cm. p. 7-16. German: 1993 Bollee, Willem. B. Die Geshichte vom Frosch: Nayadhammakahao 1,13. In Jain studies in honour of Jozef Deleu/ edited by Rudy Smet and Kenji Watanabe. Tokyo: Hon-no-Tomosha, 1993. xvi, 504 p. ; 22 cm. p. [133]-149. Uses Naya. 1951-52; 1974. ANU NBC 2 064 239 1983 G. Roth (1,8: Naya.Partial edition. 1983) Gujarati: 1928 Adhyayana 1-8. (Naya.Partial edition. 1928) 1995 Adhyayana 2-7 / Ara. Ema. Saha (Naya.Partial edition. 1995) 92
Page #112
--------------------------------------------------------------------------
________________ Studies: Dahlmann, J. *1895. Das Mahabharata als Epos und Rechtsbuch. Berlin, 1895. [BORI Cat. 17:1, 114] Dixit, K. K. 1978. The five Anga texts of the form of a story-collection [Naya., Uvas., Antag., Anuttaro., Viva.] In, Early Jainism. Ahmedabad: L. D. Institute of Indology, 1978. 8, 99 p. ; 25 cm. (LD series; 64), p. [62]-75. ANU BL1351.2.D53 Hiramuni. 1971. *Meghacarya / lekhaka Hira Muni Himakara'; sampadaka Sobhacandraji Bharilla. Asirvacana: Upadhyaya Amaramuni; preraka Punita Muni. 1. samskarana. Agara: Sanmati Jnanapitha, Vikrama Samvat 2027 [i.e. 1971]. 30, 264, [2] leaves of plates : ill. (part. col.); 23 cm. (Sanmati Sahityaratna mala; 115). [CRL catalogue; Univ. of California library catalogue] Story of Prince Meghakumar; being an exposition, with original Prakrit text, of Ukkhittanaya, chapter one of the Nayadhammakahao. Huttemann, Wilhelm Ferdinand. 1907. Die Jnata-Erzahlungen im sechsten Anga des Kanons der Jinisten. Dissertation. Strassburg: Karl J. Trubner, 1907. vi, 49 p. ; 23 cm. Contents: Vorwort [v]-vi.-Inhalt [vii].[Study] 1-49. Based on the Naya.1876 and a MS. in Berlin (Vorwort, p. 5). ANU PAMPHLET PK5003.A8 H8 *Nayadhammakahasuttam [Jnatadharmakathasutra], Vidyodaya 1897- (Calcutta). [Guerinot 1906 SS223; BORI Cat. 17:1, 114] 'Exposition' of the sutra, with introduction, in the periodical Vidyodaya. Indexes: 1950 1.6 Nayadhammakahao (Naya.Gujarati translation. 1950): Kosa p. 231-42. 1974 or 1975 (Naya. 1974 or 1975) indexed in Agama sabdakosa: angasuttani sabdasuci = Wordindexes of Angasuttani/ sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2037. <1980->. < 1 v. >; 25 cm. 1981 1989a (Naya.1981): Parisista 1. Uvanaya-gahao p. [559]-569.-2. Vyakti-nama suci [570]-573.-- 3. Sthala-visesasuci [574]-576. (Naya.1989a): 1. parisistam Jnatadharmakathangasutrantargatavisistasabdasucih p. [375]499.--2. Jnatadharmakathangasutrantargatanam gathardhanam akaradikramena sucih [500]- 501.-5. Upanayagathah [558]-563. Partial indexes: 1978 1983 (Naya.partial edition. 1978): Glossar p. [65]-68. (Naya.partial edition. 1983): Ausgewahltes Worterverzeichnis p. [225]-30. 93
Page #113
--------------------------------------------------------------------------
________________ 04
Page #114
--------------------------------------------------------------------------
________________ Title: Upasakadasah (Skt). Contents: "[T]he ten (chapters on the duties) of the lay adherent' ... contains narratives for the most part. Legends are told of ten pious householders, most of whom are wealthy merchants, who impose on themselves certain forms of self-denial, take the vows enumerated by Mahavira, and become pious lay adherents. By dint of their asceticism they actually attain to miraculous powers while they are still lay adherents: finally they die a voluntary death by starvation as genuine Jaina saints, and are reborn as gods in the heaven of the pious. ... ten stories of this kind are included in one and the same frame, being told by the venerable Suhamma to Jambu. The legends are all told after a stereotyped pattern,,, so much so that in the later stories there is often only a catchword given by way of allusion to the earlier stories... the whole work was only compiled for devotional purposes" (Winternitz 1933:2, 449). References: JRK 55-56; JSBI 1, 227-30; BORI Cat. 17:1, 126-33; Schubring 1935 $46.7. Exegesis: 1 2 3 4 1.7 UVASAGADASAO (Uvas.) 6 Abhayadeva Suri wrote a collective cty on Uvas.-Antag.-Anuttaro., very likely composed in samvat 1127 [1070], this is stated at the end of the Anuttaro. cty. (Hoernle, Uvas. 1880-90:2, xxi). Printed. Uvas. 1876; 1880-90; 1920ab; 1935; 1946. Translated into Gujarati Uvas. 1935. Curni, before samvat 1186 [1129] (JRK 56). Vivekahamsa, Stabaka, one MS. dated samvat 1610 [1553] (JRK 56). Harsavallabha Upadhyaya, Stabaka, samvat 1693 [1636] (JRK 56). Vrtti, (JRK 56). Editions: 1 1876 *Upasakadasasutra: saptama anga / Ganadharasudharmasvamikrtamula sutra tadupari Srimadabhayadevacaryya Surikrtatika; Sri Bhagavan Vijayaksta [Gujarati] bhasa samsodhita. Calcutta: s.n., 1933 [1876]. [3], 4, 233 p.; 11 x 25 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 7). [Emeneau 3924; CLIO 4, 2818; Univ. of Chicago Library catalogue] 1880-90 *The Uvasagadasao, or, The religious profession of an Uvasaga, expounded in ten lectures, being the Seventh Anga of the Jains, edited in the original Prakrit with the Sanskrit commentary of Abhayadeva [and English translation]/ by A. F. Rudolf Hoernle... 2 v. ; [text] xxiii, 251, 76 p. ; [translation] xiv, 171, 92 p. Calcutta: Asiatic Society of Bengal, 1890, 1880. 22 cm. (Bibliotheca Indica work 105). [Emeneau 3925]. [LD 11611 (v.1)] Another copy listed with a different title-page, dated 1885, with a different 'preliminary' introduction, lacking p. 169-251. v. 1 xi, 168, 76 p. v. 2 as above. [CLIO 4, 2818]. The BORI has the following incomplete (brittle) copy: 1890 Upasakadasa-sutram : Jainamatagamasangraha saptamangam / Srimadabhayadevacaryasurikrtavivaranasahitam; Srilasri ... E.-Apha-Rudolpha-Harple sahibena parisodhitam prathama bhagah [?], mulam vivaranam ca. samvat 1890 I. (various pagings); 22 cm. Contents: Anukramanika. Introduction. ix-xxiii.-Akaradivarnakramena sabdasuci. 169- 245.-Additional critical note 247-50.-Suddhipatram 251. [Text, printed in red and black] 29-30, 39-40, 49-50, 55-56, 59-66, 75-76, 83-[84], 139-40, 147-48, 151-58, 165-68, 1 There is also an edition *Upasakadasanga/sampadaka Jivaraja [Ghe]la Bhai Dosi. Ahamadabada (Kothari 1988 p.24 item 10) but I have not been able to establish a date of publication, although judging by other editions by that editor it is probably between 1900 and 1920.
Page #115
--------------------------------------------------------------------------
________________ Angas 25-30.--Additional critical note 75-76.- [Translation] 19-20, 43-44, 55-56, 59-60, 8182. BORI "[A]n excellent edition of the seventh Anga ... (which evoked from Pischel the praise of being the only Jain work with commentary which was critically edited" (Ghatage 1942, 166). Review. *E. Leumann WZKM 3(1889) 328-50 (Guerinot 1906 $225).--*G. A. Grierson, IA 16, 78-80 (Guerinot 1906 $225).-A. A. Barth Revue de l'histoire des religions 19 (1889) 284 = Oeuvres 2,61f. (Winternitz 1933:2, 449n2). Reprint. 1989 v. 2 (only) reprinted: xiv, 171,92 p. : 21 cm.2 Sources for the mula: seven MSS and the one printed edition: (1) A. India Office library MS (no. 1363), paper, 40 leaves, dated samvat 1621 [15647--(2) B. Asiatic Society of Bengal, samvat 1824 [17671--(3 and 4) C. and D., private MSS from Calcutta, dated samvat 1916 [1859 and 1745 [1688) respectively (C. used only for the first chapter).(5) F., private MS belonging to R. Garbe, dated samvat 1748 (1691] (used only from the second chapter onwards).--(6) G. Asiatic Society of Bengal, undated, estimated by Hoernle to have been made in about the 1830s, purchased from a Jain in Murshidabad by Rajendralal Mitra--(7) H. property of the "Jain Association of India," Bombay, dated samvat 1740 [1683]. -- (8) Printed edition ("MSS E.") Uvas. 1876. Sources for the cty: four MSS and one printed edition (1) a. property of E. Hultzsch, undated but Hoernle estimates it to be from the mid-15005--(2) c. (part of MS C. above, dated samvat 1916 (1859]).--(3) f. private MS. of R. Garbe, estimated to be of the 16th century.--(4) h. property of the "Jain Association of India," Bombay, dated samvat 1673 11616).-(5) e. Cty as printed in Uvas. 1876. (Sources described, Introduction, [ix]-XV) Contents: Introduction vii-xiv.-Abbreviations [1] (xv)-The Seventh Anga called Uvasagadasao, or, The religious profession of an uvasaga, expounded in ten lectures 1 171.-Appendix. The history of Gosala Mankhaliputta (Viy. 15.1] 1-14.-II. The doctrines of Gosala Mankhaliputta : translated from the Pali of the Sumannaphala-sutta-vannana, in the Sumangala-vilasini, Buddha ghosa's cty to the Digha] Nikaya) II, 20 [15]-29.III. Additions and emendations 30-60.-Index [61]-89.-Errata [90]-91.-Abbreviations [2.] [92). ANU BL1312.3.U832E5 1989 (faulty copy, p. ii-viii, 5-8 missing) 1896 *Iti-Sri-Uva salga-dasanga-namam sattama angam sammantam [from the colophon] [Gujarati-bhasantara-sahitam.] [1], 1, 124 p. ; 11 x 25 cm. (s.l. : s.n., 1896) (CLIO 4, 2818] 1917a *Upasakadasanga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1917. 156 p. ; 13 x 23 cm. (See Uvas. 1980, 225] 19176 *Sudharma-svami-viracita-Upasaka-dasa-sutra (Hindi-anuvada-sahita) / anuvadaka Rhajanaci Ramajaina ... Bombay: Nirnaya-sagara Press, 1917.8, 197 p.; 13 x 18 cm. [CLIO 4, 2818.) 1920a Srimaccandrakalina [sic] Srimadab[hayadevacarya vihitavivaranayutam Srimadupasaka dasangam. Mahesana : Agamodayasamiti, Virasamvat 2446. Vikramasamvat 1976. Kraistasan 1920.54 [ie.108] p. ; 12 x 27 cm. [CLIO 4, 2818] BORI 11593 1920b *[Text and Abhayadeva's commentary. Bhavnagar: Jaina atmananda Sabha, samvat 1977. (Jaina Atmananda Sabha series ; no. 65). [BORI Cat. 17a:1, 127] 2 The Asiatic Society (Calcutta) wanted to reprint v. 1 as well but was unable to secure a copy suitable for reproduction (S. R. Banerjee personal communication January 1997). 3 K. V. Abhyankar collection. It is bound with a Srimadantakrdasah and Srianuttaropapatikadasa) (1921). 96
Page #116
--------------------------------------------------------------------------
________________ 1.7 Uvasagadasao 1930 The Uvasagadasao, the seventh anga of the Jain canon = Niggantha pavayanesu Sattamangabhuyao: tao ya Veijavamsupannenam Parasuramenam saddakosa-vannavasaGosaladitthiyadi-parisitthasahiyahim tippanihim parikkhayao/edited by P. L. Vaidya. Poona : P. L. Vaidya, 1930. xiii, 248 p. ; 19 cm. [Emeneau 3926). Contents: Introduction (viil-xiii.-Suddhipatram.-Uvasagadasao [1]-72.--Sabdasuci [75]-115.-1. parisistam (varnakadivistarah) [119]-136.-2. Gosalamatam (The 15th chapter of the Bhagavati Viyahapannatti)[139]-201.-Notes (205)-248. Appendix 2 reprinted 1954 by N. V. Vaidya with the commentary of Abhayadeva (see Viy.partial edition. 1954). Review by Schubring OLZ 1931, 1083f. (Schubring 1935, $46). BORI 1935 Upasakadasangam : Srimadabhayadevasuriviracitavrttisahitam (with Gujarati translation of Abhayadeva's Tika] / by Bhagavanadasa Harsacandra. Ahamadabada : Jaina Sosaiti, Vi. sam. 1992 1935). 111 p. ; 12 x 28 cm. (Jainasosaiti ; no. 15). [Devendra Muni 1977, 713 item 6] "Pratayah 500." Front cover photograph of Munis Sukhasagara, Mangalasagara and Kantisagara. BORI 1936 Sri Upasakadasangasutram : Samskrta-Hindi-Gujarati-lika-sametam/vsttiracayita Ghasilalaji Maharaja. 1. avstti. Karaci: Sri Svetambara Sthanakavasi Jaina Sangha, Vira samvat 2463. Vikrama samvat 1992. I. sa. 1936. 20, 565 p. ; 25 cm. Contents: Nivedana (31-5.-Prastavana / Atmarama [6]-12.-Sammaivattam = Sammatipatra / Atmarama [13]-15.-Visayanukramah [19]-20.-Sri Upasakadasangasutram [1]-565.--[Donor details 566-67].-Advertising 568). "Prata 1100." 3rd reprint 1961. ANU PK5003.A5206 1936. *[Upasakadasatika. Kota : Sri Hindi Jainagama Prakasaka Sumati karyalaya, san 1946). Nirukta kosa / vacana pramukha Acarya Tulasi ; pradhana-sampadaka Mahaprajna; sampadaka Sadhavi Siddhaprajna, Sadhavi Nirvanasri. Ladanam: Jaina Visva Bharati, 1984. p. 23 (first group)) This publication presumably contains Abhayadeva's commentary.] 1946 1953 The Uvasagadasao = Uvasagadasao : the seventh Anga of the Jain canon / edited with introduction, translation and notes by N. A. Gore. Poona : Oriental Book Agency, 1953. x, 176 p. ; 18 cm. (Poona Oriental series; no. 87). "It is hoped this edition with a short introduction, literal translation and notes will meet the requirements of the students of Ardhamagadhi in Indian Universities" (Preface, p. iii). Seems to be based on Uvas. 1880-90; 1930. ANU BL1312.3.U832E5 1953/LD kha. 1238] 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie ; (sutthuruvena] Pupphabhikkhuna sampadio. Padham avstti. Gudagamva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 1953-54. 2 v. ; 19 cm. Uvasagadasao v.1, [1127)-1160. ANU BL1310.58 1954 2 v. 1961 Upasakadasangasutram = Upasakdasangsutram / Ghasrlalaji-Maharaja viracitaya Acaramanimanjusakhyaya vyakhyaya samalankstam Hindigurjarabhasanuvadasahitam. Trtiyavrttih. Rajakota, Saurastra : Sri Akhila Bharatiya Svetambara Sthanakavasi Jainasastroddhara Samiti, Vira samvat 2487. Isvisan 1961. 6, 2, 40, 532 p. ; 25 cm. "Prati 1000." Third reprint of 1936 edition. BORI/RW 1964 Sri Upasakadasangasutram : Samskrtacchaya, sabdartha, bhavarthopetam, Hindibhasatikasahitam ca/anuvadaka Atmarama , sampadaka Indracandra Sastri. Prathamavstti. Ludhiyana: Acarya Sri Atmarama Jaina Prakasana Samiti, Mahavirabda 2491. Vikramabda 2021. Isvi san 1964. [7], 72, 412 p. ; 24 cm. (Sastramala ; 7 ratnam). Contents: Sanketika.- Prakasakiya vaktavya [2].--Sadasya-suci (3-4).-Prasasti [67).-Prastavana / Indracandra Sastri. 1-69.-Acarya Sri ji ki sruta-sadhana [70]-72. 97
Page #117
--------------------------------------------------------------------------
________________ Angas Upasakadasanga-sutram [1]-382.-Parisista. Upasakadasanga (384-86).-Bhaugolika sthanom ka paricaya (3871-89.-Aitihasika namom ka paricaya (390)-97. Paribhasika sabdom ki vyakhya [398]-412. "1000 [copies]." The frontispiece is a photo of Atmarama. ANU PK5003.A52U6 1964 1974 or 1975 Angasuttani : Niggantham pavayanam / sampadaka Muni Nathamala (Yuvacarya Mahaprajna). Ladanum, Rajasthana : Jaina Visva Bharati [Samsthana), Vikrama samvat 2031 [1974 or 1975). 3 v. ; 25 cm. Uvasagadasao v. 3, [393)-537. [v. 3: 2. samskarana. Vikrama samvat 2048. 1992.] "Original text critically edited" on the basis of two MSS-Ka.' palm leaf from Jaisalmere Bhandar, before samvat 1186[1129); "Kha' from Gadhaiya Pustakalaya, Saradarasahara, samvat 1775 [1718]. Described on p. 15 (1st group). This volume is part 3 of a complete edition of the canon. ANU PK5003.A52 1974 3 v. and BL1312.2 1975 3 v. 1975 *[Text and translation by Sadhvi Sriurvasibai] Ghatakopara, Bambai : Prema Jinagama Prakasana Samiti, samvat 2031 [1975). Basic text and Gujarati translation (see Uvas. Studies below Kothari 1988, 25 item 12). 1977? *[Angapavitthasuttani] / sankalana Ratnalala Dost, Paramala Candaliya. Sailana : Akhila Bharatavarsiya Sadhumargi Jaina Samskrti Raksaka Sangha, 2034 [1977). Text only (see Kothari 1988 below, 1982' (p. 25 item 15) but 2034' p. 231. 1980 Upasakadasanga sutra : mulapatha, Hindi anuvada, vivecana, parisista yukta : pancama Ganadhara Bhagavatsudharma-Svami-pranita saptama Anga / samyojaka tatha pradhana sampadaka Yuvacarya Sri Misrimalaji Maharaja 'Madhukara'; anuvadaka-vivecakasampadaka Chaganalala Sastri. Byavara, Rajasthana : Sri Agamaprakasana Samiti, Vira Nirvanasamvat 2037. Vi. sam. 2037. I. san 1980. 3, 3, 2, 20, (5), 233 p. ; 25 cm. (Jinagama granthamala ; granthanka 3). Contents: Prakasakiya (1)-3.-Amukha/Misrimala 'Madhukara' [1]-3.- Donor details 1)-2.-Prastavana / Chaganalala Sastri (1)-20.-Anukramanika (1-5).--Uvasagadasao 1]-197.-Parisista 1. Sabdasuci [198]-223.-Prayukta-grantha-suci (224)-229.- [Donor details) (230)-33. ANU PK5003.A5206 1980 Translations: English: 1880-90 A.F.R. Hoernle (Uvas. 1880-90) 1953 N. A. Gore (Uvas. 1953) Gujarati: 1896 (Uvas. 1896) 1931 First printing of Gujarati translation by Becaradasa Dosi, reprinted 1948. 1948 Bhagavana Mahavirana dasa upasako: Uvasagadasao/anuvadaka Becaradasa Dosi. Avstti 2. Ahmadavada : Gujarata Vidyapitha, san 1948. 28, 144 p. ; 18 cm. (Sri Punjabhai Jaina granthamala ; 4). Contents: Sampadakiya nivedana (3)-5.-Anukramanika [6].--Anuvadakanum nivedana 7-10.--'Satpurusadharma' / Dattatreya Balkrsna Kalelakara [131-28.-Bhagavana Mahavirana dasa upasako : Uvasagadasao [1]-109.-Tippana [110]-21.-Parisista 1. Mankhaliputta Gosalaka [122]-26.-2. Gosalakano Ajivika siddhanta 126-32.-3. Mahavira ane Gosalakani mulakata 132-34.-4. Mahavira-Gosalakani antima mulakata 134 40.-Suci 141-44. First printed 1931. "[Prati) 1 700." "Learned introduction by D. B. Kalelkar" (BORI Cat. 17:1, 127). ANU BL1312.3 U834G8 1931 [sic] 1936 Ghasilala (Uvas.1936 [ = 1961]) 98
Page #118
--------------------------------------------------------------------------
________________ 1.7 Uvasagadasao Hindi: 1917a 1917b 1936 1964 1975 Amolaka Rsi (Uvas. 1917a) Rhajanaci Ramajaina (Uvas. 1917b) Ghasilala (Uvas.1936 [ = 1961]) Atmarama (Uvas. 1964) Sadhvi Sriurvasibai (Uvas. 1975) 1977 *[Upasakadasangasutra, Hindi translation] / by Sri Dhisalala Pitaliya. Sailana : Sri Akhila Bharatiya Sadhumargi Jaina Samraksaka Sangha, 1977. [See Uvas, studies below, Kothari 1988. 24 item 7] Short explanations "useful for general readers." 1980 Chaganalala Sastri (Uvas. 1980) Related works: Dasasravakacaritra Contents of the Uvas. retold in [Gujarati?) prose (Schubring 1944, 12). Rajakirti, Vardhamanadesana, Sanskrit Contents of the Uvas. retold in prose, filled out with kathas (Schubring 1944, 13). Winternitz however says this is a metrical, elaborated version in Prakrit gathas with interlinear version in Sanskrit (Winternitz 1933:2, 449n.2). Studies: Kothari, Subhasa. 1988. Upasakadasanga aura usa ka sravakacara : eka parisilana /Subhasa Kothari. 1. samskarana. Udayapura : Agama-Ahimsa-Samata evam Praksta Samsthana, 1988. xii, 243 p. ; 21 cm. (Agama Samsthana granthamala; 2). Contents: Prakasakiya [iii].--Prakkathana [iv]-ix.-Visayanukramanika [x]-xii.-1. adhyayana Agama sahitya aura Upasakadasanga [1]-20.-2. Upasadasasanga ka paricaya [21]-27.-3. Upasakadasanga ki visayavastu aura visesataem [28]-50.--4. Upasakadasanga ka racanakala evam bhasa (51)-69.-5. Sravakacara 1701-114.-6. Upadakadasanga mem varnita samaja evam samskrti[115)-223.-Parisista. Paribhasikasabda [224]-230.-Sandarbha grantha suci 231-43. List of previously published editions p. 23-25. ANU NBC 1 860 289 Dixit, K. K. 1978. The five Anga texts of the form of a story-collection [Naya., Uvas., Antag., Anuttaro., Viva. In, Early Jainism. Ahmedabad: L. D. Institute of Indology, 1978. 8, 99 p. ; 25 cm. (LD series ; 64), p.[62]-75. ANU BL1351.2 .053 Dutt, Romesh Chunder. 1889-90. A history of civilization in ancient India : based on Sanscrit literature. 2 v. Reprint. Delhi : Vishal Publishers, 1972. v.2 analysis and episode of Ananda from the Uvas. (BORI Cat. 17:1,127). ANU DS451.D97 1972 Indexes: 1964 (Uvas. 1964): Bhaugolika sthanom ka paricaya p [387]-89.-Aitihasika namom ka paricaya [390]-97.-Paribhasika sabdom ki vyakhya [398] 412. 1974 or 1975 (Uvas.1974 or 1975) indexed in Agama sabdakosa : angasuttani sabdasuci = Word indexes of Angasuttani/ sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2037. <1980->.<1 v.>; 25 cm. 1980 (Uvas. 1980): Parisista 1. Sabdasuci p. [198]-223. 99
Page #119
--------------------------------------------------------------------------
________________ 100
Page #120
--------------------------------------------------------------------------
________________ 1.8 ANTAGADADASAO (Anta g.) Title: Antakyddasah (Skt). Content: "The ten (chapters) on the (pious ascetics) who have made an end,' originally consisted of ten chapters, but is now divided into eight sections. ... As we learn from Thananga 10, the original contents of [Antag. and Anuttaro, were totally different from the present contents" (Winternitz 1933:2, 450). References: JRK 10-11; JSBI 1,233-38; BORI Cat. 17:1, 134-38; Schubring 1935 $46.8. Exegesis: Abhayadeva Suri wrote a collective cty on Uvas.-Antag.-Anuttaro., very likely composed samvat 1127 [1070), this is stated at the end of the Anuttaro. cty. (Hoernle, Uvas. 1880-90:2, xxi). Printed. Antag. 1920; 1932b. Translated into Gujarati Antag. 1933. Editions: 1874 * Sriantagadadasanam Tavva bhasya sahita prarambhithai. Calcutta : Satya Press. [1], 82, [1] p. ; 11 x 27 cm. Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 8). ["Volume contains no series statement" (Univ. of Chicago Library catalogue).) (CLIO 1, 133] 1893 1917 19192 *[Text edition with Gujarati version) Bombay, samvat 1950 [1893). [Guerinot 1909, $937. Schubring 1935 $46.8] "[A]n almost worthless lithograph that appeared at Bombay in 1893" (Barnett, Antag. 1907, x). *[With Hindi translation (by Atmarama?)]. Lahore, 1917. [Schubring 1935, $46.8] * Antagadadasanga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919. 139 p. ; 13 x 23 cm. Vi. sam. 2446 [1920] (Devendra Muni 1977, 713 item 6). 1920 * Srimad-Amtakrd-dasanuttaropapatika-dasa-Vipaka-srutani : ... Abhayadevacarya-vihitavivarana-yutani. Mahesana : The Agamodaya Samiti, 1920. foll. [1], 96, 12 x 27 cm. oblong. (Agamodaya Samiti granthamala; 23). [CLIO 1,129; Schubring 1944, 11; Tripathi 1975, 72] 1932a *The Antagada-dasao and Anuttarovavaiya-dasao=Antagadadasao, Anuttarovavaiyadasao/ edited by P. L. Vaidya. Poona : Shri Ganesh Printing works, 1932. xiii, 160 p. ; 18 cm. [Emeneau 39271 1932b The Antagada-dasao and the Anuttarovavaia-dasao, the eighth and the ninth Angas of the Jain canon = Nigganthapavayanesu atthamanavamangabhuyao Antagadanuttarovavaiyadasao/ edited with introduction, translation, notes and appendices by M. C. Modi. 1. edition. Ahmedabad : Gurjar Granth Ratna Karyalay, 1932. xl, 116, 191 p. ; 19 cm. (Prakrta granthamala ; no. 1). Contents: Introduction v-xl.-Antagadadasao 1-64.-Anuttarovavaiyadasao 65-84.Abhayadeva's commentary on each text (no variants cited) 85-106, 107-113.Suddhipatram '114-116.- Translations 1-96.-[Appendix I.) Notes 97-125. Appendix | I have not been able to establish further details of three other editions of the Antag.: (1) with Hindi translation and Vivecana by Atmarama. Ludhiyana: Acarya Sri Atmarama Jaina Prakasana Samiti, although this could be Antag. 1917 above. (Devendra Muni 1977, 713 item 8)--(2) Prakrit text edited and English translation by N. V. Vaidya, Antagadadasao, Anuttarovavaiyadasao, and Bambhadatta. Poona : N. V. Vaidya, n. d. (Folkert 1993, 412), however it is listed as being out-of-print in 1954 (Viy.Partial edition. 1954, inside back-cover)-(3) another edition in the BORI without title-page, bound between Uvas. 1920a and Anutt. 1921, it begins Sricandragacchiyasrimadabhayadevasurisutrita vittiyutah srimadantakydasah. 32 f. ; 12 x 26 cm. A second edition of this work is mentioned as the back cover of the Hindi prose version by Kalyana Rsi of Amolaka Rsi's earlier work Pradyumnakumaracarita (4th ed. 1980), but I have not traced further details.
Page #121
--------------------------------------------------------------------------
________________ Angas II. Varnakas (only those 'materially necessary to understand the text are given] 126144. Appendix III. Jain cosmography 145-48.-Glossary 149-91. Sources: The text is based upon four MSS and one printed edition [1920]: 2 (paper) MSS from Patan (1) A. from Sri Hemacandracarya Jain Sabha, Box (Dabala) no. 1 MS no. 19;--(2) B. Lerubhai Vakil's Bhandar, Patan. Box no. 4. Ms no. 19 [Copy of next MS.);(3) C. Lerubhai Vakil's Bhandar, Patan. Colophon samvat 1554;--(4) D. Box 7 No. 8. Seth Dosabhai Abhechand Jaina Sangha Bhandara, samvat 1664, with commentary of Abhayadeva, this last was used in preparing the text of the commentary, as was Antag. 1920 and Antag. 1907. (Introduction, vii-ix). ANU PK5003.A52 A62 1932 and BL1312.3 A585 E5 1932 1933 *[Text with a Gujarati translation of Abhayadeva's Vrtti.] Bhavanagara : Jainadharma Prasaraka Sabha, Vi. samvat 1990 (1933). Devendra Muni 1977, 713 item 4] 1950 Sri Antakrtadasangasutram: Munikumuda Candrika tika samalankatam, Hindigurjara-bhasasahitam/tikaracayita Ghasilalaji, niyojaka Samiramallaji tatha Kanhaiyalalaji. Rajakota, Kathiyavada : Sri Svestambara). Stha nakavasi. Jaina-Sastroddharaka-Samitih, Vira samvat 2477 [1950). [1] leaf of plates ; 25, 267 p. ; 21 cm. Contents: [Donor details) [3]-5.-Antagadasutra (Antakytasutra) ki "Prastavana" /Samira Muni (6)-20.-Sri Antaksta dasanga sutra ki visayanukramanika 21-23.-[Notice from Sthanakavasi Jaina Sastroddhara Samiti] 24-25.- Donor details tipped in to face page 11--Sri Antakstadasangasutram (1)-267.-Donor details on end paper] **Prati 500." Second printing / edition 1958. ANU PK5003.A52A62 1950 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie ; (sutthuruvena Pupphabhikkhuna sampadio. 1. avrtti. Gudagamva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354.2 v. ; 19 cm. Antagadadasao v.1, [11611-1190. ANU BL1310.58 1954 2 v. 1958 *Antakstadasangasutram = Antakrita Dashanga sutra / Ghasilalaji-Maharaja-viracitaya Munikumudacandrikakhyaya vyakhyaya samalankstam Hindigurjarabhasanuvadasahitam. Dvitiyavrttih. Rajakota, Saurastra : Sri Akhila Bharatiya Svetambara Sthanakavasi Jainasastroddhara Samiti, Vira samvat 2484 [1958]. 5, 16, 37, 217, 22 p. ; 21 cm. "Prati 1000." Reprint of 1950 edition. BORI 1970 *Sri Madantakrddasanga (sic) sutram, astama anga-sutra : Piyusadhara tika sahita / sampadaka Muni Pyaracandaji. 2. avrtti. Byavara, [Jila) Ajamera : Sri Jaina Divakara Divya Jyoti Karyalaya, 1970. 176 p. ; 26 cm. (CRL catalogue 73-904112] "Meaning (paraphrase?] in Hindi" (CRL catalogue record). 1972 Antagadadasa sutra/anuvadaka Ghevaracandaji Barhthiya (vartamana Muni Sri Viraputraji). Trtiyavstti. Sailana : Akhila Bharatiya Sadhumargi Jaina Samskrti Raksaka Sangha, Vira samvat 2498 (1972). illus. 4, 192 p. ; 18 cm. Contents: Prakasakiya nivedana (3)-4.-Asvadhyaya (5-6).-Sri Antakrtadasanga sutra 11-185.-Parisista. Gunaratna samvatsara tapa (186).-Ratnavali tapa [187]. - Laghusimha niskririta tapa 188.-Kanakavali tapa 189.-Muktavali tapa 190.Mahasimha niskririta tapa 191.-Laghu sarvatobhadra tapa. Mahasarvatobhadra tapa. Bhadrottara pratima tapa 192. *2000 (copies)." ANU PK5003.A52A62 1972 Reprint of Antag. 1907. Varanasi : Prithivi Prakashan, 1973. ANU BL1312.3.A582E4 1973 and PK5003.A52A6213 1973. 1973 1974 or 1975 Angasuttani : Niggantham pavayanam / sampadaka Muni Nathamala (Yuvacarya Mahaprajna). Ladanum, Rajasthana : Jaina Visva Bharati (Samsthana), Vikrama samvat 2031 [1974 or 1975). 3 v. ; 25 cm. Antagadadasao v. 3, [539]-610. [v. 3 Dvitiya samskarana. Vikrama samvat 2048. 1992.] "Original text critically edited" on the basis of four MSS--(1) 'Ka.' palm leaf from 102
Page #122
--------------------------------------------------------------------------
________________ 1.8 Antagadadasao Jaisalmer Bhandar; (2-4) *Kha.''Ga.' and 'Gha.' from Gadhaiya Pustakalaya, Saradarasahara, samvat 1495 [1438), the others are undated. Described on p. 15-16 (1st group). This volume is part 3 of a complete edition of the canon. ANU PK5003.A52 1974 3 v. and BL1312.2 1975 3 v. 1978 *Siri Antagadadasao : mula, Samskrta chaya, Hindi sabdartha, evam bhavartha sahita / anuvadaka Hastimala ji Maharaj; sampadaka Gajasimha Rathaura, Candamala Karnavata, Premaraja Bhogavata. 2. parivartita evam parivarddhita samskarana. Jayapura : Samyagjnana Pracaraka Mandala, 1978. 10, 272 p. ; 26 cm. [Devendra Muni 1977, 713 item 9] 1981 Antakyddasasutra : pancama Ganadhara Bhagavatsudharma-svami-pranita astama Anga : mulapatha, Hindi anuvada, vivecana, parisista yukta / samyojaka tatha pradhana sampadaka Srimisrimalaji Maharaja Madhukara'; anuvadana-Vivecana-sampadana Ba. Bra. Jaina Sadhvi Divyaprabha. Byavara, Rajasthana : Sri Agamaprakasana-Samiti Viranirvanasamvat 2508 [1981). 32, 202 p. : ill. ; 25 cm. (Jinagama-granthamala ; 5). Contents: Prakasakiya [7].-Amukha / Misrimala 'Madhukara' 9-11.--Sampadakiya / Sadhavi Divyaprabha 13-19.-Prastavana : Antakrddasa : eka adhyayana / Devendra Muni. 21-32.-Visayanukrama. 33-36.-Antagadadasao 1-177.-Parisista [list of contents] 179.-1. Agama mem varnita visesanama 180-84.-2. Vyakti aura bhaugolika paricaya 185-204.- List of donors. 205-208.--*Anadhyayakala' [[Nandi.1966c, 7-9) se uddhtta). 209-11. ANU PK5003.A52A7 1981 1984 *Srimadantakrddasangam-Srimadanuttaropapatikadasanganca : astamam navamam cangasutram/Sudharmasvamipranitam : Srimadabhayadevasurikrtavrttisahitam; mula-tikatatha mula ane tikana Gurjaranuvada sahita ; punarmudrana preraka tatha sampadaka Arunavijayaji Maharaja. 1. avrtti. Mumbai: Sri Mahavira Jaina Sahitya Prakasana, 1984. 1 v. (various pagings); 13 x 27 cm. 1993 *Illustrated Antakrd-dasa sutra : accurate original text, Hindi-English version, variant readings, elucidations and sentimental illustrations/Sudharma Svami (compiler) ; editor Amar Muniji; assistant editor, Srichand Surana 'Saras.' Ist. ed. Delhi : Padma Prakashan, 1993. 293 p.; 166 p. of plates: col. ill. ; 25 cm. (Illustrated Agama publication series; no. 2). [DK-110727, DK booklist CIR-1818/98-99 item 123] Partial edition: 1888 *Jacobi, Hermann. Die Jaina Legende von dem Untergange Dvaravati's und von dem Tode Krsna's. ZDMG 42 (1888) 493-529. Gives a portion of the Antag. as an appendix. Translations: English: 1907 * The Antagada-dasao and Anuttarovavoiya-dasao/translated from the Prakrit (with text in Roman script by L. D. Barnett. London: Royal Asiatic Society, 1907. xi, 158 p. ; 1 plate. 22 cm. (Oriental Translation Fund, New Series; v. 17). [CLIO 1, 128] Contents: Introduction [v]-xi.-Antagada-dasao (translation] 1-107.-Anuttarovavaiyadasao (translation 109-122.-Appendix 1. Text of the Anuttaro. 123-136.-2. Notes on the Jain cosmology 137-47.--Index 149-58. "[P]rovisional text ... from the materials at my disposal. These were, for the Antagadadasao, two manuscripts in the British Museum ([1] Or. 2100 and [2] 5129), and [3] another kindly lent from the library of the Indian Institute at Oxford, together with [4] a printed edition of little merit published at Calcutta in [1874] by Satyavrata Samasrami, and [5] an almost worthless lithograph that appeared at Bombay in 1893. The first, second, fourth and fifth of these contain Gujarati glosses; the fourth has also the Sanskrit gloss ascribed to Abhayadeva" (Introduction p. x.) Review. Leumann JRAS 1907, p. 1079-83. Reprint. 1973. 1932 M. C. Modi (Antag.1932b) 103
Page #123
--------------------------------------------------------------------------
________________ Angas ANU BL1312.3.A582E4 1973 and PK5003.A52A6213 1973. 1973 1993 Reprint of Antag. 1907. (Antag.1993) Gujarati: 1874 (Antag.1874) 1893 (Antag. 1893) 1940 *Papa, punya, ane samyama : Vipaka, Antakrdasah, Anuttaraupapatikadasah : e namana Ilma, 8ma, ane Oma Angagranthono chayanuvada/ sampadaka Gopaladasa Jivabhai Patela. 1. avrtti. Amadavada : Sri Jaina Sahitya Prakasana Samiti : Praptisthana, Navajivana Karyalaya, 1940. xxxii, 184 p. ; 19 cm. (Sri Punjabhai Jaina granthamala; 20). CRL catalogue SAMP early 20th-century Indian books project ; item 11415. Microfilm BVB-GUJ-401 (B) MF-10758 reel 001 1950 1984 Ghasilala (Antag. 1950 [ =1958]) Arunavijaya (Antag. 1984) Hindi: 1917 1919 1950 1970 1972 1978 1981 1993 (Antag.1917) Amolaka Rsi (Antag.1919) Ghasilala (Antag. 1950 [ =1958]) Pyaracandaji (Antag. 1970) Ghevaracanda Barthiya (Antag. 1972) Hastimala (Antag. 1978) Sadhvi Divyaprabha (Antag.1981) (Antag.1993) Studies: Bruhn, Klaus. 1983. Repetition in Jaina narrative literature. Indologica Taurinensia 11 (1983) 27-75. Includes a detailed analysis (p. 32-37) of Antag. "in order to demonstrate the main types of repetition ... as found in Varga Literature (defined as Naya., Uvas., Antag., Anuttaro., Viva., Niraya Su.)." Dixit, K. K. 1978. The five Anga texts of the form of a story-collection (Naya., Uvas., Antag., Anuttaro., Viva.] In, Early Jainism. Ahmedabad : L. D. Institute of Indology, 1978. 8, 99 p. ; 25 cm. (LD series ; 64), p. [62]-75. ANU BL 1351.2.D53 Indexes: 1932 (Antag. 1932b): Glossary p. 149-191. 1974 or 1975 (Antag.1974 or 1975) indexed in Agama sabdakosa : angasuttani sabdasuci = Word indexes of Angasuttani/ sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2037. <1980->. <1 v.>; 25 cm. 1981 (Antag. 1981): Parisista 2. Vyakti aura bhaugolika paricaya p. 185-204. 104
Page #124
--------------------------------------------------------------------------
________________ 1.9 ANUTTAROVAVAIYADASAO (Anuttaro.) Title: Anuttaraupapatikadasah (Skt). Content: "[T]he ten (chapters) on the (pious ascetics) who have attained to the very highest (regions of heaven),' is now divided into three sections with thirty-three lessons, instead of the original ten lessons. As we learn from Thananga 10, the original contents of these two Angas were totally different from the present contents" (Winternitz 1933:2, 450). "[A] hopelessly monotonous account of how the saints again and again attain to the highest perfection by starving themselves to death" (Winternitz 1933:2, 452). "Stories of those reborn in the highest heaven" (Schubring 1935 SS46.9). References: JRK 8-9; JSBI 1, [241]-43; BORI Cat. 17:1, 139-44; Schubring 1935 SS45.9. Exegesis: 1 Editions:1 1874 1894 1907 Abhayadeva Suri wrote a collective cty on Uvas.-Antag.-Anuttaro., very likely composed in samvat 1127 [1070], this is stated at the end of the Anuttaro. cty. (Hoernle, Uvas.1880-90:2, xxi). Printed.Anuttaro.1920; 1921; 1961; 1984. Gujarati translation Anuttaro.1933. *Sri Anuttarovavaiyadasanam [Gujarati] Tavva bhasya sahita prarambhi thai. Calcutta : Satya Press, samvat 1931 [1874]. [1], 18, [1] p. ; 11 x 27 cm. [Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 9]. [CLIO 1, 133. Schubring 1944, 13; "Volume contains no series statement." Univ. of Chicago Library catalogue] "[T]he Calcutta edition, published samvat 1931 [correcting 1631'] by Satyavrata Samasrami. This edition contains the Prakrit text, a Gujarati interpretation, and Abhayadeva's commentary. The last-named portion is comparatively well edited; the remainder is bad" (Barnett, Anuttaro.1907, 123). *[Text with Gujarati 'version.'] Bombay, 1894. [Anuttaro.1907, 124] "[A] lithograph containing the Prakrit text with a Gujarati interpretation, published at Bombay in 1894. It is so senselessly corrupt that its readings without support are of no value. Some of them, however, are interesting, and in one or two cases better than those of the other sources" (Barnett, Anuttaro. 1907, 124). *The Antagada-dasao and Anuttarovavaiya-dasao/translated from the Prakrit [with text in Roman script] by L. D. Barnett. London : Royal Asiatic Society, 1907. xi, 158 p.; 1 plate; 22 cm. (Oriental Translation Fund, New Series; v. 17). [CLIO 1, 128] Contents: Introduction [v]-xi.-Antagada-dasao [translation] 1-107.-Anuttarovavaiyadasao [translation] 109-122.-Appendix 1. Text of the Anuttaro. 123-36.-2. Notes on the Jain cosmology 137-47.-Index 149-58. "The Prakrit text of the Anuttarovavai which is here presented can make no claim to critical exactness. It aims merely at presenting the vulgate, more or less faithfully with the ordinary blunders corrected ... only variants of some slight importance being noted. The materials used in forming this text are: A = British Museum Or 5130, about the 17th cent; B = British Museum Or 5131, about the same age; C = a manuscript ... from the library of the Indian Institute at Oxford... samvat 1622; D= the Calcutta edition, published samvat 1931 [correcting '1631'] by Satyavrata Samasrami. This edition contains the Prakrit text, a Gujarati interpretation, and Abhayadeva's commentary. The last-named portion is comparatively well edited; the remainder is bad; E = a lithograph containing the Prakrit text with a Gujarati interpretation, published at Bombay in 1894. It is so senselessly corrupt that its readings without support are of no value. Some of them, however, are interesting, and in one or two cases better than those of the other sources. (Appendix 1, p. 123-24). 1 I have not been able to trace further details of the Prakrit text of Anuttaro. edited with English translation by N. V. Vaidya, Antagadadasao, Anuttarovavaiyadasao, and Bambhadatta. Poona : N. V. Vaidya, n. d. (Folkert 1993, 412), however it is listed as being out-of-print in 1954 (Viy.Partial edition. 1954, inside back-cover).
Page #125
--------------------------------------------------------------------------
________________ Angas Review. Leumann JRAS 1907, p. 1079-83. Reprint. 1973. 1914 *[Text.) Bombay, 1914. [Schubring 1935, $46.9] 1919 *Anuttarovavai dasanga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina) : Jaina Sastroddhara Mudralaya, 1919.40 p. ; 13 x 23 cm. Vi. sam. 2446 [1920) (BORI Cat. 17:1,140; JSBI 1, 241 item e). 1920 *Srimad-Antakrd-dasanuttaropapatika-dasa- Vipaka-srutani : ... Abhayadevacarya-vihitavivarana-yutani. Mahesana : The Agamodaya Samiti, 1920. foll. [1], 96 lie. 2, 192] p. ; 12 x 27 cm. (Agamodaya Samiti granthamala ; 23). [CLIO 1, 129; Tripathi 1975.721. Surat : Agamodaya Samiti, 1920 (Schubring 1944, 11; BORI Cat. 17:1,135, 140; JSBI 1. 241). 1921 Srianuttaropapatikadasah : Srimatsudharmasvamiganabhrdviracitam Candrakulabhusanasrimadabhayadevasurikrta vrttiyutah : sa vacurikam Pudgalapara varttastotran ca / Danavijayena samsodhitam. Bhavanagara : Sriatmanandajainasabha, Virasamvat 2447. Atmasamvat 25. Vikramasamvat 1977. San 1921. 11 [ie. 22) p. ; 13 x 27 cm. (CLIO 1, 133] BORI 11592 1932a *The Antagada-dasao and Anuttarovavaiya-dasao=Antagadadasao, Anuttarovavaiyadasao/ edited by P. L. Vaidya. Poona : Shri Ganesh Printing works, 1932. xiii, 160 p. ; 18 cm. [Emeneau 3927] 1932b The Antagada-dasao and the Anuttarovavaia-dasao, the eighth and the ninth Angas of the Jain canon = Niggantha pavayanesu atthamanavamangabhuyao Antagadanuttarovavaiyadasao/ edited with introduction, translation, notes and appendices by M. C. Modi. 1. edition. Ahmedabad : Gurjar Granth Ratna Karyalay, 1932. xl, 116, 191 p. ; 19 cm. Contents: Introduction v-xl.-Antagadadasao 1-64.-Anuttarovavaiyadasao 65-84.Abhayadeva's commentary on each text (no variants cited) 85-106, 107-13.Suddhipatram' 114-16.-Translations 1-96.-[Appendix I.) Notes 97-125. Appendix II. Varnakas (only those "materially necessary" to understand the text are given)-12644. Appendix III. Jain cosmography 145-48.-Glossary 149-91. Sources: 'Text is based upon five MSS: 13 1/2 x 5", Shrimad Hemacandracarya Jain Sabha, Patan Box 1 No. 20. B 10 1/4 x 4 1/4" Lerubhai Vakil's Bhandar, Patan, Box 5 No. 15. 11 1/2 x 5 1/4" Lerubhai Vakil's Bhandar, Patan, Box 6 No. 35. samvat 1554 D 1 0 1/4 x 4 1/4" 8 leaves, Seth Dosabhai Abhechand Jain Sanga Bhavanagar, Box 7, no. 5. The only MS with Abhayadeva's commentary. At many places it contains Gujarati glosses which I have used in the Notes.' E Anuttaro.1920. Readings noted from Barnett's MSS are also noted. (A), (B) etc. (Introduction ix-x). ANU PK5003.A52 A62 1932 and BL1312.3 A584 E5 1932 1933 *(Antakrddasanga-sutra, Text with a Gujarati translation of Abhayadeva's Vitti. Bhavanagara : Jainadharma Prasaraka Sabha, Vi. Sam. 1990 [1933]. [JSBI 1, 241: Nagraj 1986, 739 n. 41 1936 *Anuttaropapatikadasasutram : Samskrtacchaya-padarthanvaya-mularthopetam: Ganipatigunaprakasika Hindi-bhasa-tikasahitam ca anuvadaka Atmarama. Prathamavstti. Lahaura : Jaina Sastramala Karyalaya, Mahavirabda 2462. Vikramabda 1993. Isavi san 1936. 4, 2, 99, 15 p. ; 18 cm. (Jainasastramala ; 2). [JSBI 1, 241 item u] Contents: Prastavana/atmarama 1-4.-Visayasuci 1-2.-Anuttaropapatikadasasutram 1-99.-Sabdarthakosa 1-15. "1000 (prati]" Prakrit text in red, Sanskrit in black. Bollee 2 Bound with Uvas. 1920 and an edition of Antag. 106
Page #126
--------------------------------------------------------------------------
________________ 1948 1959 1953-54 Suttagame 1961 1973 1976 Sri Anuttaropapatikasutram : Arthabodhinivrttisamalankrtam : Hindi Gurjara bhasha sahitam/ vrttiracayita Ghasilalaji; niyojaka Samiramallaji tatha Kanhaiyalalaji. Avrtti 1. Rajakota, Kathiyavada: Sri Sve[tambara]. Stha[nakavasi]. Jaina Sastroddhara ka Samitih, Vira samvat 2474 [1948]. 12, 160 p. ; 24 cm. Contents: Prakasakanum nivedana [1]-5.--Atha Sri Anuttaropapatikadasanga sutra ka visayanukrama [1]-2.-Prastavana / Samira Muni [1]-11.-Sanmatipatram/Atmarama [12] Sri Anuttaropapatikadasanga-sutram 1-160. "Prati 1000." Reprinted 1959. 1981 1.9 Anuttarovavaiyadasao ANU BL1312.3.A594H4 1948 /carimatitthayara-pancamaganahara-Suhammayariyaviraie ; [sutthuruvena] Pupphabhikkhuna sampadio. 1. avrtti. Gudagamva-chavani, Purvapanjaba: Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354. 2 v.; 19 cm. Anuttarovavaiyadasao v.1, [1191]-1198. Reprint of Anuttaro.1907. Varanasi : Prithivi Prakashan, 1973. ANU BL1312.3.A582E4 1973 and PK5003.A52A6213 1973. 1974 or 1975 Angasuttani: Niggantham pavayanam / sampadaka Muni Nathamala [Yuvacarya Mahaprajna]. Ladanum, Rajasthana: Jaina Visva Bharati [Samsthana], Vikrama samvat 2031 [1974 or 1975]. 3 v. ; 25 cm. Anuttarovavaiyadasao v. 3, [611]-633. [v. 3: 2. samskarana. Vikrama samvat 2048. 1992.] "Original text critically edited" on the basis of three MSS Ka.' palm leaf from Jaisalmere Bhandar, dated before samvat 1186 [1129]; 'Kha.' and 'Ga.' both from Gadhaiya Pustakalaya, Saradarasahara, [samvat] 1495 [1438], the second is undated. Described on p. 16-18 (1st group). This volume is part 3 of a complete edition of the canon. ANU PK5003.A52 1974 3 v. and BL1312.2 1975 3 v. Anuttarovavaiya dasa: Vairagyakulaka Virastuti sahita. Sailana, Madhya-pradesa: A[khila]. Bha[ratiya]. Sadhumargi Jaina Samskrti-raksaka Sangha, Vira samvat 2502. Vikrama samvat 2033. [19]76. 4, 68 p. ; 12 cm. (Samskrti Raksaka Sangha sahitya ratnamala ; 54). Contents: Pratah smaraniya dhanna anagara/Ratanalala Dosi [1]-4.-Anuttarovaiyadasa suttam [mula with Hindi translation 11-55.-Vairagya kulakam [22 Pkt. verses] [56]61. Virastuti [29 Pkt. verses] 61-68. "Prati 2000." ANU BL1310.S8 1954 2 v. Anuttaropapatikasutram = Anuttaropapatika sutram / Ghasilalaji-Maharaja-viracitaya Arthabodhinyakhyaya vyakhyaya samalankrtam Hindigurjarabhasanuvadasahitam. Dvitiyavrttih. Rajakota, Saurastra: Sri A[khila]. Bharatiya Svetambara Sthanakavasi Jainasastroddhara Samiti, Vira samvat 2485 [1959]. 2, 4, 4, 13, 16, 4, 17-35, 148 p. ; 25 cm. "Prati 1000." Reprint of 1948 printing / edition. BORI/RW Anuttaropapatika-dasa-sutra / sampadaka Vijaya Muni. Agara : Sanmati Jnana Pitha, 1961. 24, 24, 83 p. ; 24 cm. (Agama-sahitya-ratna-malaya; 8. ratnam). Contents: Outline of Agama literature 1-24.-Study of the Anuttaropapatika /Becaradasa Dosi 1-29. [Text with Hindi translation on facing pages] 1-38.-[Abhayadeva's cty, as source a reference to Modi's ed., Anuttaro.1932] 39-48.-Notes 49-70.-[tables summarizing the text details] 71-72.-Glossary 73-75.-Meaning of indeclinable words, verbs 76-78, 79-83. Mentions Hindi translations of Atmaramaji [1936] and Ghasilala [1948 = 1959]. ANU PK5003.A52A7 1961 ANU NBC 2 118 347 Anuttaropapatikadasanga: Pancama Ganadhara Bhagavatsudharmasvami-pranita navama Anga: mulapatha, Hindi anuvada, vivecana, parisista yukta / adya samyojaka tatha pradhana sampadaka Misrimalaji Maharaja 'Madhukara'; anuvadaka-vivecaka Sadhvi Muktiprabhaji. Byavara, Rajasthana: Sri Agamaprakasana-samiti, 1981. 32, 99 p. ; 25 cm. (Jinagamagranthamala; granthanka 6). 107
Page #127
--------------------------------------------------------------------------
________________ Angas Contents: Prakasakiya [7].-Amukha / Muni Misrimala 'Madukara' 9-11.Sampadakiya / Sadhvi Muktiprabha 13-16.-Prastavana : Anuttaropapatikadasa : eka anucintana / Devendra Muni 17-30.-Visayanukrama 31-32.-Anuttarovavaiyadasao [1]-51.-Parisista 1. Tippana [55]-71.-[2.] Kosthaka 72-74.-[3.] Paribhasika sabdakosa [75]-77.-Atyaya-pada-sankalana [78]-79.-Kriya-pada-sankalana [80]81. Sabdartha (82)-92.- [Donor list] 93-96.-Anadhyayakala "[Nandi.1966c, 7-9) se uddhfta" [97]-[99]. Reprint. 1990. ANU PK5003.A52A48 1981 *Srimadantakrddasangam-Srimadanuttaropapatikadasangan ca : astamam navamam cangasutram/Sudharmasvamipranitam : Srimadabhayadevasurikrtavrttisahitam; mula-tikatatha mula ane tikana Gurjaranuvada sahita ; punarmudrana preraka tatha sampadaka Arunavijayaji Maharaja. 1. avrtti. Mumbai : Sri Mahavira Jaina Sahitya Prakasana, 1984. 1 v. (various pagings) ; 13 x 27 cm. 1984 1990 Reprint of Anuttaro.1981. Vira Nirvana sam. 2527. Vikrama sam. 2047. I.san 1990. RW 1992 Reprint of Anuttaro.1974 or 1975. Translations: English: 1907 L. D. Barnett (Anuttaro. 1907 1=1973) 1932 M. C. Modi (Anuttaro. 1932b) Gujarats:3 1940 *Papa, punya, ane samyama : Vipaka, Antakrdasah, Anuttaraupapatikadasah-e namana Ilma, 8ma, ane Oma Angagranthono chayanuvada / sampadaka Gopaladasa Jivabhai Patela. 1. avrtti. Amadavada : Sri Jaina Sahitya Prakasana Samiti : Praptisthana, Navajivana Karyalaya, 1940. xxxii, 184 p. ; 19 cm. (Sri Punjabhai Jaina granthamala; 20). [CRL catalogue SAMP early 20th-century Indian books project; item 11415. Microfilm BVB-GUJ-401 (B) MF-10758 reel 001 1948 1984 Ghasilala (Anuttaro. 1948 (=1959) Aruna vijaya (Anuttaro. 1984). Hindi: 1919 1936 1948 1961 1976 1981 Amolaka Rsi (Anuttaro. 1919) Atmarama (Anuttaro. 1936) Ghasilala (Anuttaro. 1948 (=1959) Vijaya Muni (Anuttaro. 1961) (Anuttaro. 1976) Muktiprabha (Anuttaro. 1981) Studies: Dixit, K. K. 1978. The five Anga texts of the form of a story-collection [Naya., Uvas., Antag., Anuttaro., Viva.] In, Early Jainism. Ahmedabad: L. D. Institute of Indology, 1978. 8,99 p. ; 25 cm. (LD series : 64), p. [62]-75. ANU BL 1351.2.D53 3 *Gujarati anuvada / Sramani Vidyapitha, Ghatakopara, Bambai) Devendra Muni 1977, 714 item 11). No further details traced. 108
Page #128
--------------------------------------------------------------------------
________________ Title: Prasnavyakarana (Skt). Content: "Questions and explanations,' treats in ten 'gates' (dara) firstly of the five 'great vows' (not to hurt any living being, not to lie, not to steal, not to be unchaste, not to be attached to possessions), and then of the five virtues corresponding to these. It is a purely dogmatic presentation, which does not correspond either to the title of the work or to the table of contents in the Thananga 10 and in Nandi. Thus a later work took the place of the old Anga which had got lost" (Winternitz 1933:2, 452). References: JRK 275; JSBI 1, 247-52; BORI 17:1, 145-58; Schubring 1935 SS46.10. Exegesis: 1 2 3 4 5 6 7 Editions: 1876 1918 1919 1938 1.10 PANHA VAGARANAIM (Panha.) 1950 Abhayadeva Suri, Tika, corrected by Dronasuri (JRK 274). Printed. Panha.1876; 1919; 1989. Jnanavimala Suri, pupil of Nayavimala, pupil of Dhiravimala of the Tapa Gaccha, Tika, (JRK 274). Printed. Panha.1938. Ajitadeva Suri, pupil and successor of Mahesvara Suri of the Candra Gaccha, Dipika (JRK 275). Curni, (JRK 275). Tika, (JRK 275). Parsvacandra, pupil of Sadhuratna, Balavabodha (JRK 275). Paryaya (JRK 275; BORI Cat. 17:1, 157-58). *Prasnavyakaranakasutra : dasama anga / Ganadharasudharmasvamikrtasutra tadupari Srimadabhayadevacaryya Surikrta tika; Sribhagavan Vijayakrta [Gujarati] bhasa samsodhita. Calcutta: Nutanasamskrtayantre, 1933 [1876]. [4], 542 p. ; 11 x 25 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha; 10). [CLIO 3, 1957; Schubring 1944, 14; JRK 274; JSBI 1, 247; Univ. of Chicago Library catalogue] "Hindi [?] gloss by Vijaya Sadhu" (BORI Cat. 17:1, 145). *Prasnavyakarana sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918. 228 p. ; 13 x 23 cm. Vi. sam. 2446 [1920] (JSBI 1, 247 item u). *Sriprasnavyakaranangam: Srimatsudharmasvamiganabhrtprarupitam Srimaccandrakulalankarasrimadabhayadevasurisutritavivaranayutam. Bombay: Agamodayasamiti, Virasamvat 2445. Vikramasamvat 1975. Kraista 1919. 165 p.; 12 x 27 cm. [CLIO 3, 1957] "Pratayah 1000." BORI *[Text with Jnanavimala's Vrtti/Tapogacchiya Sri Sagarananda Suriji dvara samsodhita.] Ahmedabada: Sri Vardhamana Jaina Agama Mandira, Palitana, Vi. sam. 1995 [1938]. 19 p. (Muktivimala Jaina granthamala; 7). [JSBI 1, 247; Panha. 1950, 1 (fourth group), bibliography facing p. 17 (6th group)] Contains printing mistakes and uses the 'ta-sruti' (Panha. 1950, Prati paricaya, p. 1). Sriprasnavyakaranasutram: chaya-bhasatika-tippanyadibhir alankrtam / anuvadakah Srihastimallo Munih. Pali, Maravara: Sri Hastimallji Surana, Vira ni. 2477 [1950]. 2, 2, 4, 3, 17, 3, e, 310, 37, 38, 11, 14 p. ; 22 cm. Contents: Prakasaka ka vaktavya [1]-2.-Prabandhaka ke do sabda [1]-2.- Prakasaka ka sanksipta paricaya [1]-2.-Agamajna Munirajom se avasyaka nivedana [1]-4.--Prati
Page #129
--------------------------------------------------------------------------
________________ Angas paricaya : samsodhana mem prayukta pratiyam [1]-3.-Prakkathana [1]-17.Samsodhana sampadana mem prayukta granthom ka paricaya.--Sri Prasna vyakarana sutra ki visayanukramanika [1]-3.- Avasyaka nivedana (4).-Suddhi patram ['a'l-'e'Prasnavyakarane prasastislokah (1)-3. Sri Prasnavyakaranasutrasya purva-khandam: panca asrava dvarani [1]-182. - Sri Prasnavyakaranasutrasya uttara-khandam : panca samvata dvarani [183]-310.--Sri Prasnavyakaranasutrasya parisistam : visistapada tippanani. Prasna vyakarana sutragata paribhasika sabdanam visesanamnam ca suci l37.-2. Prasnavyakarana sutrasya visistapada tippanani [1]-38.-3. Katha-vibhaga 111.-Prasna vyakarana sutra ki pathantara suci [1]-5.-Pathantara-suci 6-14.Abhidhana Rajendra mem mudrita Prasna. ke pathantara 14.-Dusara asrava ka tippana [15). Sources: Text is based on two printed editions Panha.1938 and Panha. 1919 (especially the latter) and five MSS (1) A. samvat 1849; (2) B. samvat 1856 (location of these two MSS not indicated); three MSS from the Sri Svestambara). Stha[nakavasi). Jaina grantha bhandara, Jayapura' (3) 'Ka.' samvat 1602; (4) Kha.' samvat 1620. (5) 'Ga.' the best MSS with tika, but the final page is missing, estimated to be 15th-16th cent.--and one printed edition Panha.1938 (Prati paricaya p. 1-3, (4th group)). ANU BL1312.3.P356H3 1950 |Text with Hindi translation. Sailana : Samskrti Rakyaka Sangha. (Samsksti Raksaka Sangha sahitya ratnamala ; 34). [Devendra Muni 1977, 714 item 7]. Date unknown, estimated as 1950s. 1950z 1950za *[Panhavagaranaim: mula, artha vivecana sahita. Lohamandi, Agara : Sanmati Jnanapitha. [Devendra Muni 1977, 714 item 8). Date unknown estimated as 1950s. 1952 *[Text with Hindi translation / by Ghevaracandra Banthiya. Bikanera : Sethiya Jaina Paramarthika Samstha, Vi. sam 2009 (1952). [JSBI 1, 247 item ul 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie ; (sutthuruvena Pupphabhikkhuna sampudio. 1. avstti. Gudagamva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354.2 v. ; 19 cm. Panhavagaranam v.1, [1199)-1239. ANU BL1310.58 1954 2 v. 1962 Prasnavyakarana-sutram = Prashnavyakarana sutram / Ghasrlalaji-Maharaja-viracitaya Sudarsinyakhyaya vyakhyaya samalankstam Hindi-Gurjara-bhasa'nuvadasahitam ; niyojakah Srikanhaiyalalaji-Maharajah. 1. avstti. Rajkota : Sri A[khila). Bharata). Svetambara). Sthanakavasi Jaina Sastroddhara Samiti, Vira samvat 2488. Vikrama samvat 2018. Isavisan 1962. 8, 3, 40, 952 p. ; geneal. table ; 25 cm. Here the ten sections are number part 1, 1-5 and part 2, 1-5. Prati 1000." Reprint. 1988 RW 1973 *Prasnavyakarana sutra :asrava aura samvara ka gambhira vivecana: mula, Samskrtacchaya, padartha, malartha, vistrta vyakhya / vyakhyakara Hemacandra ji Maharaja ; sampadaka Amara Muni. Agara : Sanmati Jnanapitha, Vira Nirvana 2499. 1973. 39, 891 p. ; 1 leaf of plates ; 22 cm. Contents: Prakasakiya (3)-4.Sampadakiya / Amara Muni (5-6. Prastavana / Amara Muni. 171-24.- Plate with seated portrait of Hemacandra ji Maharaja. Panditaratna Sri Hemacandra ji Maharaja ki sanksipta jivana-jhamki/Tilakadhara Sastri (25)-27.Anukramanika [29]-39. Sri Prasnavyakarana sutra. [3)-864.-Parisista. 1. (Subhasitas in the text (in order of occurrence)] 867-70.-2. Visesa sabda suci (proper names etc) 871-91. Hemacandra, disciple of Atmarama, has written Hindi tikas on a number of works, Acaranga, Sthananga, Uttarajjhayana etc. [Sampadakiya, p.5 and 23 (first group)]. Amara Muni's grand-guru (bavaguru) was Pandita Sri Hemacandra ji Maharaja, who studied with Atmarama. Amara Muni's teacher was Padmacandra ji Bhandari. Hemacandra wrote a cty called Subodhini (bahut samaya pahale) in the style of Atmarama, that has here 110
Page #130
--------------------------------------------------------------------------
________________ been rendered in a more up-to-date style. No details given on the source of the text. ANU PK5003.A52P34 1973 1974 or 1975 Angasuttani: Niggantham pavayanam / sampadaka Muni Nathamala [Yuvacarya Mahaprajna]. Ladanum, Rajasthana: Jaina Visva Bharati [Samsthana], Vikrama samvat 2031 [1974 or 1975]. 3 v. ; 25 cm. Panhavagaranaim v. 3, [635]-713. [v. 3 Dvitiya samskarana. Vikrama samvat 2048. 1992.] "Original text critically edited" on the basis of six MSS (1) 'Ka.' palm leaf from Jaisalmere Bhandar, 11th cent.; (2) 'Kha.' MS from Gadhaiya Pustakalaya, Saradarasahara. 13th cent.; (3) 'Ga.' MS Gadhaiya Pustakalaya, 16th cent. judging by the script; (4) 'Gha.' about 1570. Private copy (?); (5) 'Ca.' Gadhaiya Pustakalaya, mula and tabba; (6) 'Kva.' from the Jaina Visva Bharati, Ladanum, samvat 1667 with Balavabodha. Described on p. 18 (1st group). 1983 1984 1988 1989 1992 1 This volume is part 3 of a complete edition of the canon. The pagination of Panha.1919 is indicated in the margin. 1.10 Panhavagaranaim ANU PK5003.A52 1974 3 v. and BL1312.2 1975 3 v. Prasnavyakaranasutram: dasamamangam: mulapatha, Hindi anuvada, vivecana, parisista, Sabdakosa sahita / samyojaka tatha pradhana sampadaka Misrimalaji Maharaja 'Madhukara'; anuvadaka Pravinarsiji; sampadaka Sobhacandra Bharilla. Byavara, Rajasthana: Sri Agama Prakasana-Samiti, Vi. sam 2040 [1983]. 35, 319 p. ; 25 cm. (Jinagamagranthamala; granthanka 17). Contents: Prakasakiya 7.-Adi-vacana / Misrimala 'Madhukara' 9-12.-Prastavana: Agamasahitya aura Prasnavyakaranasutra/Devendrakumara Jaina 13-28.-Apni bat / Pravanarsi 29-30. Visayanukramanika 31-35. Panhavagaranaim 1-264. Parisista 1. Utthanika-pathantara. 265-66.-2. Gathanukramasuci 267.-3. Kathacm (Sita, Draupadi, Rukmini, Padmavati, Tara, Kamcana, Raktasubhadra, Ahinnika, Suvarnagutika, Rohini) 268-81.-4. Visista sabdom evam namam ka kosa 282-312.-Anadhyayakala "[Nandi. 1966c, 7-9] se uddhrta" 313-15.-[Donor list] 316-19. ANU BL1312.3.P354H5 1983 Panhavagarana-suttam saparisittham / Suya-thavira-viraiyam; sampadaka Kanhaiyalala 'Kamala'; preraka Vinayamuni Vagisa'. Ahmadabada: Agama Anuyoga Trasta, Vira samvat 2510. Vikrama samvat 2041. Isvi san 1984. 16, 132 p.; 14 cm. Bare text. Mentions Panha.1918; 1919; 1962; 1973; 1983 and is presumably based on those (Prakasakiya p. 14). Appendices contain six quotations from the tika (p. 125-32). ANU NBC 2 118 351 Reprint of Panha. 1962. 2. avrtti. Ahamadabada: A[khila]. Bha[rata]. Sve[tambara]. Stha[nakavasi]. Jainasastroddharasamiti, Vira samvat 2514. Vikrama samvat 2044. Isavisan 1988. 8, 952 p. 25 cm. "Prati 250." Pages 169-72 are missing. RW Suripurandara-Candrakulina-Srimadabhayadevacaryadevadrbdhavyakhyayutam Srimadganadharadeva pranitam Sri Prasnavyakarana dasa sutram/ sampadaka [sic] samsodhakas ca Vijayajinendras urisvarah. Prathamavrtti. Lakhabavala Santipuri, Saurastra: Sri Harsapuspamrta Jaina Granthamala, Vira sam 2515. Vikrama sam. 2045. San 1989. 8, 322 p.; 13 x 26 cm. (Sri Harsapuspamrta Jaina granthamala; 187). Contents: Abhara darsana 2.-Prastavika 3.-Anukramanika 4.-Suddhipatrakam 5- 6. Srirsivardhanasurikrta yamakamayi Nemistutih 8.-Sriprasnavyakarana-dasa-sutram 1-321. "750 pratayah." ANU NBC 2 036 6571 Reprint of Panha. 1974 or 1975. 2. samskarana. 111
Page #131
--------------------------------------------------------------------------
________________ Angas Partial editions: 1923 Jain, Banarsi Das. Ardha Magadhi reader. Lahore, 1923. lxv, 178 p. ; 22 cm. Extract 7. Panavaho (Panha. 1, reprint from Panha.1919?] 49-51. Translation. 7. Injury to life/B. D. Jain. 133-36. Reprint. Delhi : Sri Satguru Publications, 1982. ANU PK 1255.J34 1982 Translations: Gujarati: 1876 Vijaya Sadhu (Panha.1876) 1939 1955 *[Gujarati translation Muni Chotalala.] Limbari : Ladhaji Svami Pustakalaya, 1939. [JSBI 1, 247 item u]. Reprinted 1955. Sri Prasnavyakarana sutra : Gujarati anuvada / anuvadaka Muni Sri Chotalalaji. Avrtti 3. Limbari, Saurashtra : Kantilala Vrajalala Setha, Sri Ladhaji Svami Pustakalayana Vyavasthapaka, Vira samvat 2489 (1955). 16, 156 p. ; 18 cm. Contents: Prastavana / Muni Chotalalaji (5)-12.--Triji avstti vise [13]-14.-Pattavali 15.--Anukramanika 16.--Sri Prasnavyakarana sutra [1]-154. **Prata 1000." First printing 1939. ANU BL1312.3.P354G8 1955 Ghasilala (Panha.1962) 1962 1918 1973 Hindi: Amolaka Rsi (Panha.1918) 1950 Hastimalla Muni (Panha. 1950) 1950Z (Panha.1950z and 1950za) 1952 Ghevaracandra Baithiya (Panha.1952) 1962 Ghasilala (Panha. 1962) Hemacandra (Panha.1973) 1983 Pravinarsi (Panha.1983) Studies: Dixit, K. K. 1978. Prasnavyakarana. In, Early Jainism. Ahmedabad : L. D. Institute of Indology, 1978. 8,99 p. ; 25 cm. (LD series ; 64), p. [76]-80. ANU BL1351.2 .053 Sen, Amulyachandra. 1937. A critical introduction to Panhavagaranaim, the tenth Arga of the Jaina canon. Wurzburg 1935.67 p. Hamburg Phil. Diss. 1935 [1937). [Janert 1961, 65) Review. Ludwig Alsdorf. OLZ 41 (1938) 448-50 [Alsdorf, Kleine Schriften 1974, xiv] Contains a "useful discussion of the vedha metre" (Norman, Review of G. Roth. JRAS (1981) 89-90. Weber, Albrecht. 1887. Ahalya, 'Ayeug und Verwandtes. Sitzungsberichte der Koniglich Preussischen Akademie der Wissenschaften. 1887. [Guerinot 1906 $341] Text of Abhayadeva's cty on the name of Ahalya in Panha. Indexes: 1950 (Panha.1950): Parisista 1. Glossary p. 1-37.-2. Detailed glosses 1-38. 1973 (Panha.1973): Parisista. 1. (Subhasitas in the text (in order of occurrence)] p. 867-70.-2. Visesa sabda suci (proper names etc) 871-91. 1974 or 1975 (Panha.1974 or 1975) indexed in Agama sabdakosa : angasuttani sabdasuci = Word indexes of Argasuttani/ sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2037. <1980->.<1v.>; 25 cm. 1983 (Panha.1983): Parisista 2. Gathanukramasuci p. 267.-4. Visista sabdom evam namam ka kosa 282-312. 112
Page #132
--------------------------------------------------------------------------
________________ 1.11 VIVAGASUYA (Viva.) Title: Vivagasuya; Vipakasruta (Skt). Content: "The text of the ripening (of actions),' contains legends on the retribution of good and evil deeds after the manner of the Buddhist karman stories in the Avadana-sataka and Karma-sataka. Goyama Indabhuti (sic), the oldest pupil of Mahavira, sees various unhappy people, and at his request Mahavira explains by what actions in a former birth the person had deserved such misfortune, through what bad rebirths the person has already passed, what is still in store for him, and by what means he may finally attain to a good rebirth again" (Winternitz 1933:2, 452-53). References: JSBI 1, 253-68; BORI Cat. 17:1, 159-66; Schubring 1935 846.11. Exegesis: Abhayadeva Suri, Vrtti (JRK 357). Printed. Viva.1876; 1919; 1920a; 1935a. Parsvacandra, Stabaka (JRK 357). Editions: 1876 *Vipakasutra/Ganadhara Sudharmasvamikrtamulasutra, tadupari Srimadabhayadevacaryya Surikstatika ; Vijayakstabhasa samsodhita. Kalikata : Nutanasamskrtayantra, samvat 1933 (1876). 279 p. ; 11 x 26 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 11). [Emeneau 3930; Univ. of Chicago Library catalogue 1917 *[Text]. Bhavnagar. [Vava.1935a, Introduction p.1] *Vipaka sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1917. 204 p. ; 13 x 23 cm. Vi. sam. 2446 [1920] (JSBI 1,255 item i). 1919 *Sri-Vipaka-Srutam : Srimad-Abhayadeva-Suri-pranitaya vittya vibhusitam Sri-SudharmaSvami-vinirmitam ... / Pandita-Haragovinda-dasena samsodhitam Samskstacchayaya vibhusitam ca. Calcutta : Bharatiya-Jaina-Siddhanta-Prakasaka Press, 1976 [1919). [1], 2, [2), 115 p. ; 13 x 28 cm. (Sriman-Muktikamala-Jaina-Mohanamala , no. 10). [CLIO 4,3002] ("Baroda edition" JRK 357; BORI Cat. 17:1,159; Schubring 1935 $46.11; Vaidya 1935a Introduction p. 1) 1920 * Srimad-Antakrd-dasanuttaropapatika-dasa-Vipaka-srutani : Abhayadevacarya-vihitavivarana-yutani. Mahesana : The Agamodaya Samiti, 1920. foll. [1],96 [ie. 2, 192] p. ; 12 x 27 cm. (Agamodaya Samiti granthamala ; 23). [CLIO 1, 129; Tripathi 1975, 72] 1930 *Text with Gujarati translation. Bhavnagar : Jainadharma Prasaraka Sabha, samvat 1987 [1930]. [JRK 357.JSBI 1, 255) 1933a The Vivagasuya = Vivagasuyam, the eleventh Anga of the Jain canon, edited for the use of university students, with introduction, glossary and notes / by P. L. Vaidya. Poona : P. L. Vaidya, 1933. xvi, 176 p. ; 19 cm. Contents: Introduction [i]-xvi. Vivagasuyam [1]-84.-Varnakadi vistarah (85)-90.Sabdakosah 1931-147.-Notes (151)-176. "[Based) on the material supplied by the printed editions ... the commentary of Abhayadeva ... and MSS of the bare text at the BORI, Pune" (Introduction). Second edition, revised, 1935. BORI 1933b * The Vivagasuyam, the eleventh Anga of the Jains, and comparative Prakrit grammar/[by V[adilal]. J[ivabhai]. Chokshi ; with a foreword by K. V. Abhyankar. Ahmedabad : Chokshi Brothers, 1933. [Hara 1985, 23). May contains a translation into English (Viva. 1935a, 16 (1st group)).
Page #133
--------------------------------------------------------------------------
________________ Angas 1935a The Vivagasuyam, the eleventh Anga of the Jain canon = Niggantha pavayanesu Egarasangabhuyam Vivagasuyam : edited with introduction, translation, notes, glossary, Abhayadeva's commentary etc. / by V[adilal]. J[ivabhai]. Chokshi and M. C. Modi. Ahmedabad, Gurjar Granth Ratna Karyalaya, 1935. 16, 102, 136, 122 p. ; 18 cm. (Praksta granthamala ; no. 6). Contents: Foreword 1-2.-Introduction 2-13.-Vivagasuyam (Text) 1-84.-Notes 85- 102.--Translation 1-136.-Abhayadeva's commentary 1-65. Glossary 67-122 p. Text is mainly based on Vava. 1920a with the help here and there of the MS from Bhavnagar and the excellent edition of of P. L. Vaidya Vava.1935b). "Last year, one of us published the complete translation of Vivagasuya (ie. 1933b)" (page 16 (first group). ANU PK5003.A52V5 1935a 1935b The Vivagasuya : the eleventh Anga of the Jain canon = Vivagasuyam: edited for the use of university students, with introduction, glossary and notes / by P. L. Vaidya. Second edition, revised. Poona : Dr. P. L. Vaidya, 1935. xvi, 176 p. ; 19 cm. Contents: Vivagasuyam 3-84.-Varnakadivistarah 85-90.-Sabdakosah 91-147.--Notes 149-76. "I have availed myself of the opportunity of the second edition to revise the text and notes thoroughly" March 1935 (p. xvi). First edition Viva. 1933a. ANU PK5003.A52V5 1935 *[Text with Hindi translation / by Muni Sagarananda). Kota : Hindi Jainaagama Prakasaka Sumati Karyalaya, 1935. [JSBI 1, 255] 1935c 1935d 1952 The Vivagasuyam : the eleventh Arga of the Jaina canon = Vivagasuyam / edited with introduction, notes and English translation / by A. T. Upadhye. Satara : A. T. Upadhye, 1935. xxxvi, 228 p. ; 19 cm. (Sanskrit and Prakrit Jain literature series ; 1). Contents: Foreword (v).-Suddhipatram (vi).--Preface (viil-viii.-Introduction [ixxxxvi.--Vivagasuyam [1]-62, 2 [ie. 63-66).--Notes (65)-128.--Translation [129]-228. In doubtful cases and in the numbering of paragraphs this edition generally accepts the text of P. L. Vaidya [1933a]. The notes make "judicious" use of Abhayadeva's commentary therefore "its inclusion was unnecessary" (p. viii). University of Pune CASS Library Q31:21123 / MG5 / 11002-RW (photocopy) Sri Vipakasutram : Ghasilalajimaharaja-viracitaya Vipakacandrika-tikaya samalankstam Hindi-Gurjarabhasanuvadasahitam /Gavvulalajimaharajah ; Munisrisamiramalaji Maharajah Kanhailalaji Maharajasca. Prathamavsttih. Rajakota, Saurashtra : Sri Svetambara). Stha[nakavasi). Jainasastroddharasamitih, Vira samvat 2479 [1952). [3] pages of plates ; 702, 84 p. ; 24 cm. Contents: [Donor details 1-5).-Sri Vipakasutra ki visayanukramanika [6]. - Suddhipatram (7-10)--Sri Vipakasrutasutram [1]-702.-Atha dvitiyah srutaskandhah [1]-84. Devendra Muni (Viva. 1982, 49 (Ist group) states that the influence of Abhayadeva's commentary is clear on Ghasilalaji's commentary. Reprint 1959. ANU PK5003.A52V5 1952 1953 or 1954 Sri Vipakasutram: Samskrta-cchaya-padarthanvaya-mularthopetam: Atmajnanavinodini hindibhasatikasahitam ca/anuvadaka Jnanamuni, samsodhaka Hemacandra. Prathamavstti. Ludhiyana, Panjaba : Jainasastramala Karyalaya, Mahavirabda 2480 [1954). Vikramabada 2010 (1953). 3, 70, 738 p. ; 24 cm. Contents: Samarpana 3.-Prakasakiya nivedana 1-6.-Karma-mimamsa / Phulacanda 1-9.-Samsodhakiya vijnapti / Muni Hemacandra 10-11.-Svadhyaya. 12- 15.Prakkathana/Jnanamuni 16-62.-Visayanukramanika 63-70.--Text, Sanskrit version, word-equivalents, translation 1-711.-Parisista Nam. 1 Booklist. 715-16.-Nam. 2 Vipakasutriya sabdakosa 717-31.--Nam. 3 Suddhipatraka 732-38. "1000 (copies.)" Sthanakavasi text. Lists Viva. 1952 [ =1959); 1935a; "Ananda Sagara" (Viva. 1920a], item 62 probably means Viva.1876 (page 716). ANU PK5003.A52V5 1954 114
Page #134
--------------------------------------------------------------------------
________________ 1.11 Vivagasuya 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie ; [sutthuruvena) Pupphabhikkhuna sampadio. 1. avstti. Gudagamva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354.2 v. ; 19 cm. Vivagasuyam v.1, [1241]-1287. ANU BL1310.58 1954 2 v. 1959 Sri-Vipakasutram = Shri Vipaka sutram/Ghasilalaji-Maharaja-viracitaya Vipakacandrika tika samalankstam Hindigurjarabhasanuvadasahitam. Dvitiyavsttih. Rajakota, Saurastra : Sri Akhila Bharatiya Svetambara Sthanakavasi Jainasastroddhara Samiti, Vira samvat 2485 [1959). 10, 33, 706, 84 p. ; 25 cm. Reprint of 1952 printing. "Prati 1000." BORI 1974 or 1975 Angasuttani : Niggantham pavayanam / sampadaka Muni Nathamala (Yuvacarya Mahaprajna). Ladanum, Rajasthana : Jaina Visva Bharati (Samsthana), Vikrama samvat 2031 [1974 or 1975). 3 v. ; 25 cm. Vivagasuyam v.3, 1715)-813. [v. 3: Dvitiya samskarana. Vikrama samvat 2048. 1992.] Sources: "Original text critically edited" on the basis of three MSS-(1) 'Ka. 'photoprint of a Jaisalmer palmleaf MSS of 1186 CE; (2) 'Kha.' from the Gadhaiya Pustakalaya, Saradarasahara, samvat 1633; (3) 'Ga.' from Hanutamalaji Mangilalaji Bengani Bidasara, 16th cent. CE--and Vr.' Viva. 1935a. Described on p. 19 (1st group). The page numbers in the margin seem to be from Viva.1920 (unconfirmed). This volume is part 3 of a complete edition of the canon. ANU PK5003.A52 1974 3 v. and BL1312.2 1975 3 v. 1982 Vipakasruta : Pancama Ganadhara Bhagavatsudharma-Svami-pranita gyarahavai Anga: mulapatha, Hindi anuvada, vivecana, parisista yukta / samyojaka tatha pradhana sampadaka Srimisrimalaji Maharaja 'Madhukara'; anuvadaka Rosanalala Jaina ; sampadaka Sobhacandara Bharilla. Byavara, Rajasthana : Sri Agamaprakasana-Samiti, Viranirvanasamvat 2508 [1982]. 50, 156 p. ; 25 cm. (Jinagama granthamala ; granthanka 11). Contents: Prakasakiya (3).-Donor details 4). -Adi vacana / Misrimala 'Madhukara' 151-8.-Visayasuci 9-10-Prastavana : Vipakasruta : cka samiknatmaka adhyayana / Devendra Muni [11]-50.-Vivagasuyam [1]-138.-Parisista. Visista-sabda suci [141]149.-Anadhyayakala [[Nandi.1966c, 7-9 se uddhrta] [150]-152.- [Donor list) (153) 156. ANU PK5003.A52V5 1982 1992 Reprint of Viva.1974 or 1975. Partial editions: 1923 Jain, Banarsi Das. Ardha Magadhi reader. Lahore, 1923. lxv, 178 p. ; 22 cm. 1. Miyaputte darae [Viva. 1.1, edited from four MSS and Viva. 1919] 1-12. Translation. 1. The child Miyaputta /B. D. Jain. 80-93. Reprint. Delhi : Sri Satguru Publications, 1982. ANU PK 1255.J34 1982 1972 *Subahukumara : Sukhavipaka sutra ka prathama adhyayana, mula, artha aura vivecana/ sampadaka evam vivecaka Hiramuniji Himakara. 1 avrtti. Padarada : Sri Paraka Guru Jaina Granthalaya, 1972.16, 120 p. ; 22 cm. (CRL catalouge] "Bhagavan Mahavira ke paccisa saivem navanimahotsava samaroha ke upalaksa mem." Translations: English: 1933? 1935 (Viva.1933b)? V. J. Chokshi and M. C. Modi (Viva.1935a); A. T. Upadhye (Viva. 1935d) 115
Page #135
--------------------------------------------------------------------------
________________ Angas Gujarats: 1930 (Viva. 1930) 1940 *Papa, punya, ane samyama : Vipaka, Antakrdasah, Anuttaraupapatikadasah : e namana 17ma, 8ma, ane Ima Angagranthono chayanuvada/ sampadaka Gopaladasa Jivabhai Patela. 1. avrtti. Amadavada : Sri Jaina Sahitya Prakasana Samiti : Praptisthana, Navajivana Karyalaya, 1940. xxxii, 184p. ; 19 cm. (Sri Punjabhai Jaina granthamala ; 20). [CRL catalogue SAMP early 20th-century Indian books project ; item 11415. Microfilm BVB-GUJ-401 (B) MF-10758 reel 001. 1952 Ghasilala (Viva. 1952 [ =19591) Hindi: 1876 1917 1935 1952 1954 1982 Vijaya Sadhu (Viva.1876) Amolaka Rsi (Viva. 1917) Sagarananda (Viva.1935c) Ghasilala (Viva. 1952 [ =19591) Jnana Muni (Viva.1954) Rosanalala Jaina (Viva.1982) Partial translation: English: 1923 Jain, Banarsi Das (Viva.partial edition. 1923) Hindi: 1972 Hiramuni Himakara (Viva.partial edition.1972) Studies: Ballini, Ambrogio. 1925. L'undecimo Anga dei Jaina chiamato la sacra dottrina del frutto delle opere meritorie e peccaminose, Sezione prima, lettura prima. Atti del Reale Instituto Veneto di Scienze, Lettere ed Arti, no. 84, ii, pp. 645-84, Venice, 1925. 24 x 16 cm. (CLIO 4, 3002] Dixit, K. K. 1978. The five Anga texts of the form of a story-collection [Naya., Uvas., Antag., Anuttaro., Viva. In, Early Jainism. Ahmedabad : L. D. Institute of Indology, 1978. 8,99 p. ; 25 cm.(LD series ; 64), p. [62]-75. ANU BL1351.2.D53 Indexes: 1933 (Viva. 1933a): Sabdakosah [93]-147. 1935 (Viva.1935a): Glossary p. 67-122;(Viva.1935b): Sabdakosah p. 91-147. 1953 or 1954 (Viva. 1953 or 1954): Parisista 2. Vipakasutriya sabdakosa p. 717-31. 1974 or 1975 (Viva. 1974 or 1975) indexed in Agama sabdakosa : angasuttani sabdasuci = Word indexes of Angasuttani/ sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2037. <1980->. <1 v.>; 25 cm. 1982 (Viva.1982): Parisista. Visista-sabda suci p. [141]-149. 116
Page #136
--------------------------------------------------------------------------
________________ 117
Page #137
--------------------------------------------------------------------------
________________ 2 U VANGAS / UPANGAS GENERAL WORKS 1948 Upangaprakirnakasutravisayakramah : Sriaupapatika-Rajaprasniya-JivajivabhigamaPrajnapana-Candrasuryaprajnaptiyugma-Jambudvipaprajnapti-UpangapancakamayaNirayavalika-Catuhsaranadiprakirnakadasakanam sutrasutragathanam akaradikramah laghur brhams ca visayanukramah. Suryapure (Surat] : Srijainapustakapracarakasamstha, Vikramasamvat 2005. Virasamvat 2475. I. sa. 1948. 72, 108 p. ; 25 x 12 cm. (Sriagamoddharasangraha ; 2). Contents: Prastavah / Anandasagara (reverse of cover).-Aupapatikadyupanganam Catuhsaranadiprakirnakadasakasya ca sutragatha karadih 1-72.-Sriupangadinam visayanukramadih 1-107.-Suddhipatrakam 107.-[List of books published by the publisher) 108. "Pratayah 250." ANU BL1312.59.U8 1948 1987-89 Uvangasuttani / sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2044-45. I[svi san). 1987-89.2 v. ; 25 cm. v. 1. Ovaiyam. Rayapaseniyam. Jivajivabhigame. 74, 515, 774 p. v. 2. Pannavana. Jambuddivapannatti. Canda pannatti, Surapannatti. Upanga Nirayavaliyao. Kappavadimsiyao. Pupphiyao. Pupphaculiyao. Vanhidasao. 75, 1100 p. Contents v. 1: Granthanukrama [8].--Prakasakiya [9]-11.- Sampadakiya / Yuvacarya Mahaprajna [13]-30.-Bhumika / Acarya Tulasi (31)-40.-Editorial /[ = English translation of Sampadakiya] [41]-59.-- Introduction [ = English translation of Bhumika] [61]-70.-Visayanukrama [71]-74.-Sanketa-nirdesika (75). Ovaiyam [1]-77.Rayapasenaiyam [78]-212.-Jivajivabhigame (213)-515. -Parisista 1. Sanksipta-patha, purta-sthala aura adhara-sthala nirdesa (519)-534.-Parisista 2. Tulanatmaka (parallels in other texts (535)-544.-Parisista 3. Saddasuci. 545-774.-Suddhi-patra (775). Contents v. 2: Granthanukrama [8]. Prakasakiya 19-11.-Sampadakiya / Yuvacarya Mahaprajna (13)-28.-Bhumika / Acarya Tulasi (29)-37.-Editorial [ = English translation of Sampadakiya) (39)-57.-Introduction (59)-67.-Visayanukrama [69]-75.Pannavanasuttam [1]-356.-Jambuddivapannatti [3571-588.-Candapannatti. Surapannatti [589]-712.-Nirayavaliyao. Kappavadimsiyao. Pupphiyo. Pupphaculiyao. Vanhidasao. [713]-785.-Parisista 1. Sanksipta-patha, purta-sthala aura purti adharasthala [7897-805.- Parisista 3. [sic] [Saddasuci] [807)-1093.-Suddhi patra [1094)1096.--Corrections to Sabdakosa [1097)-1100. "Original text critically edited." Forms v. 4 (parts 1 and 2) of a complete edition of the Jaina Agama. The sources for individual text editions are presented separately in the sections which follow here. ANU BL1312.5 1987
Page #138
--------------------------------------------------------------------------
________________ 118
Page #139
--------------------------------------------------------------------------
________________ 2.1 UVAVAIYA (Uvav.) Title: Uvavaia; Aupapatika (Skt). Content: "The first part describes the departure of Mahavira for the Punnabhadda shrine, and the pilgrimage of King Kuniya Bhimbhasaraputta to the same place, in order to hear Mahavira's sermon ... In the second part, which has no connection whatsoever with the first, Goyama Indabhuti journeys to the Master, in order to question him regarding the various re-births" (Winternitz 1933:2, 454). References: JSBI 2,7-33; BORI Cat. 17:1, 167-73; Schubring 1935 847.1. Exegesis: Abhayadeva, Vrtti composed samvat 1115 (1058). Printed. Uvav. 1879; 1916 [=1937); 1985. Amstacandra Suri, Balavabodha. Printed Uvav. 1879. 3 Dharmasi, Stabaka, 18th cent. V.S. (Uvav.1987, 63 (first group)). Editions: 1879 Sri Ubabaisutra : prathama upanga / Ganadhara Sri Sudharmma Svami klta mulasutra, tadupari Saratharagache Sri Abhayadeva Suri keta tika : tadupari Lupakagache Sri Amrtacandra Suri krta Balasvalbodha ; Sri Satyavrata ke dvara samsodhita hokara. Kalakatta : Sri Satyavrata, samvat 1936 (1879). [2], 164 [ie 4, 364) p. ; 12 x 31 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 12). [Schubring 1935 $47. CLIO 1, 238; Univ. of Chicago Library catalogue]2 "Yaha 500 pustaka Raya Dhanapatisimgha Bahadura ke tarapha se bhandara karane ku [sic] chapi. Rijastari hui hai." Date from end of Hindi preface by publisher. Patan 563 1882 *Das Aupa patika Sutra, erstes Upanga der Jaina. 1. Theil, enthaltend Einleitung mit Inhaltsangabe und vom Texte $81-38:(Der philosophischen Facultat der Universitat Leipzig zur Erlangung der Doktorwurde) / vorgelegt von Ernst Leumann. Leipzig : G. Kreysing, 1882. 50 p. (See Uvav.1883). [Emeneau $3931] Contains the introduction and text of the first 38 chapters (Guerinot 1906 $231). 1883 Das Aupapatika Sutra, erstes Upanga der Jaina. 1. Theil. [all published] Einleitung, Text und Glossar / von Ernst Leumann. Leipzig : F. A. Brockhaus, 1883. [6), 166 p. ; 20 cm. (Abhandlungen fur die Kunde des Morgenlandes ; 8,2). [CLIO 1, 238; Guerinot 1906 $231] Contents: Einleitung mit Inhaltsangabe 1-20.- [Text] [21]-90.-Glossar [91]-163.Nachwort [1641-165.-Druckfehler 165-66. "[Leumann's beautiful edition of the Aupapatikasutra ... the work is noteworthy on account of the presence of nearly all the important Varnakas which are often referred to in other parts of the canon. The glossary brings many new explanations of words in ArdhaMagadhi" (Ghatage 1942, 166). Text based on eight MSS (1-5 with the text, 3,5-8 with ctys), the first two belonging to Hermann Jacobi (1) A. of 59 leaves; (2) B. samvat 1658, 36 leaves; five from the Staatsbibliothek in Berlin (3) D. MS no. 1000, samvat 1674, 57 leaves, text with Prakrit cty of Parsvacandra; (4) Q. MS no. f1.637, samvat 1612, 41 leaves (5) B. fl. 646, 72 leaves, with Abhayadeva's cty. The following with Abhayadeva's cty only (6) f1.1001 1 Uvangasuttani 4:2 (1989, 13) mentions an edition of Uvav. perhaps by Yuvacarya Mahaprajna, but provides no details. 2 The copy in the British Library is missing p. 17-32. The Pata copy seen (Hemacandra Jain Bhandar) is bound between boards without a solid spine, and the head, foot and leading edge of the pages have been rather indifferently marbled with a combed pattern (colours used are red, yellow, blue and a darker colour perhaps dark green or black). In the same collection I saw another copy of this work in poorer condition) bound identically and with the same coloured boards (a light plum colour) and marbling, which suggests the binding is original.
Page #140
--------------------------------------------------------------------------
________________ Upangas 1916 1917 1931 1936 1937 1959 and (7) fl. 1069 and (8) another MSS of this cty from Hermann Jacobi (described on p. 18-20). 1963 Leumann's text does not always cite the full passage, cf. Roth, Gustav. 1974. Notes on the Pamca-namokkara-parama-mangala in Jaina literature, The Adyar Library bulletin 38 (1974) [1]-18, p. 7n3) Review. H. Jacobi Literatur-Blatt f. d. oriental. Philol. 2, 46-49. Reprint [without the Sanskrit title-page of the original]. 2nd. printing Nendeln, Liechtenstein: Kraus Reprint, 1966. 166 p. ; 24 cm. (Schubring 1935 SS47). ANU PJ5.D5 Bd.8, Nr.2 Sricaturdasapurvadhara srutasthavirapranitam Candrakulina srimadabhayadevasurivihitaSrimaddronacaryasodhitavrttiyutam Srimadaupapatikasutram. Mehesana: Agamodayasamiti, Vira samvat 2442. Vikramasamvat 1972. Kraista 1916. 2, 119, [1] [ic 4, 238, 2] p.; 12 x 26 cm. Contents: [Donor details 1]-2.-Sriaupapatikasutram 1a-119b. "Pratayah [500]." BORI 38151; Patan 1042 and 1043 Second [ie. re-typeset ] edition 1937. *Uvavai sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1917. 216 p. ; 13 x 23 cm. Ovavaiyasuttam = Aupapatikasutram/critically edited by N. G. Suru. Punyapattanam [Pune] : Arhatamataprabhakara Karyalaya, 1931.99 p. ; 22 cm. (Arhatamataprabhakara series ; 7). [CCDPL :1(1), xxiii; Emeneau SS3931a] Contents: [plate of Sri Vijayakanaka Suri]-Preface [1].-Aupapatikasutram [1]-99. Textbook prepared for university students, based on Uvav.1883; 1916 and one MS from BORI (no. 72 of 1880-81), some variant readings are given. ANU BL1312.6.U83 1931 *[Text only / Chotelala Yati.] Ajmera : Jivana Karyalaya, 1936. [Devendra Muni 1977, 715; Uvav.1982, 39 (first group). JSBI 2, 10] Srimadaupapatikasutram: Sricaturdasapurvadharasrutasthavirapranitam ; CandrakulinaSrimadabhayadevasurivihitasrimaddronacaryasodhitavrttiyutam/ Sriagamodaya Samiti prakasitaprathamadarsanusarena pancavimsatipatratah samsodhita, Acaryadeva Srisagaranandasurisvarajisisya [sic] Muni Hemasagarena. Dvitiyavrtti. Suryapuri [Surat] : Pandita Bhuralala Kalidasa, Virasamvat 2464. Vikramasamvat 1994. 227 p.; 12 x 27 cm. "Reprint" [ie re-typesetting] of Uvav.1916, the footnotes of which are reprinted almost verbatim, 'pra.' however being revised to 'pratyantare' in the first instance. 1953-54 Suttagame/carimatitthayara-pancamaganahara-Suhammayariyaviraie ; [sutthuruvena] Pupphabhikkhuna sampadio. 1. avrtti. Gudagamva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 1953-54. 2 v.; 19 cm. Ovavaiyasuttam v.2, [1]-40. One source says this work is in the "Pandita Dayavimalaji granthamala" (Nirukta kosa. Ladanum: Jaina Visva Bharati, 1984. p. 24 (first group)). Patan 233 ANU BL1310.S8 1954 2 v. Aupapatika-sutram = Aupapaatika sutra / Ghasilalaji-Maharaja-viracitaya Piyushavarpinyakhyaya vyakhyaya samalankrtam; Hindigujarabhasanuvadasahitam. Rajakota, (Saurastra): Sri Akhila Bharatiya Svetambara Sthanakavasi Jainasastroddhara Samiti, 2485 [1959]. 5, 3, 39, 737, 24 p. ; 24 cm. Reprint. 1990. BORI Uvavaiya sutta/anuvadaka Muni Sri Umesacandraji Ma[haraja]. 'Anu'. Sailana, Madhya Pradesa: Akhila Bharatiya Sadhumargi Jaina Samskriti [Raksaka] Sangha, 1963. 5, 4, 374 p.; 18 cm. Contents: Sutra paricaya [1]-5.-Asvadhyaya [6-7].-Suddhi patra [8-9].-- Visayanukramanika [1]-4.-Uvavaiya suttam [1]-374. ANU PK5003.A53U8 1963 120
Page #141
--------------------------------------------------------------------------
________________ 1982 1985 1988 1990 2.1 Uvavaiya Aupapatikasutra : Caturdasapurvadharasthavirapranita prathama Upanga : mulapatha, Hindi anuvada, vivecana, parisista yukta / samyojaka tatha pradhana sampadaka Yuvacarya Srimisrimalaji Maharaja 'Madhukara'; anuvadaka-vivecaka Chaganalala Sastri. Byavara, Rajasthana: Sri Agamaprakasana-samiti, Viranirvanasamvat 2508 [1982]. 42, 198 p. ; 25 cm. (Jinagama-granthamala; granthanka 13). Contents: Prakasakiya [7].-Adi vacana 9-12.-[Donor details] 13.-Prastavana: Aupapatikasutra : cka samiksatmaka adhyayana / Devendra Muni. 15-40.-Anukrama 41-42. Uvavaiyasuttam [1]-191.-Parisista 1. 'Gana' aura 'kula' sambandhi visesa vicara [182]-187.-Prayukta grantha-suci [188]-191. Anadhyayakala [[Nandi. 1966c, 79] se uddhrta] 192-94. The text divisions and numeration match those of Uvav. 1883 [1966]. ANU PK5003.A53U8 1982. Sri Aupapatikasutram: Srimaccaturdasapurvadharasrutasthavirasankalitam Srimadabhayadevasurisvara sandrbdha-Srimaddronacaryasamsodhitavivaranayutam/sampadakah samsodhakas ca Vijayajinendrasurisvarah. Prathamavrtti. Lakhabavala, Santipuri, Saurastra: Sri Harsapuspamrta Jaina granthamala, Vira 2511. Vikrama sam. 2041. San 1985. 8, 123 p.; 13 x 26 cm. (Sri Harsapuspamrta Jaina granthamala; granthankah 141). Contents: Abhara [2].-Prastavana / Jinendrasuri [3-4]. Suddhipatrakam [4]-8.-- Srimadaupapatikasutramla-123b. 1987-89 Uvangasuttani / sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2044-45. I[svi san]. 1987-89. 2 v. ; 25 cm. "750 pratayah." Although there is no mention of it in the prefatory matter, this is a retypesetting of Uvav.1916. The footnotes of Uvav.1916 are repeated verbatim, with occasional minor additions however; many hyphens are also added to break up long compounds, and there are a number of insertions and additional numbers which tend to be between parentheses. The pagination though is different from Uvav.1916. RW Ovaiyam v.1, [1]-77. "Original text critically edited" on the basis of three manuscripts of the text, all from the Sricanda Ganesadasa Gadhaiya Library, Sardarsahara-Ka.' samvat 1623 [1566], 'Kha.' samvat 1665 [1608]; 'Ga.' undated but about samvat 17th cent.and one of the vrtti, 'Vr.' from the same library, dated samvat 1996 [1939]. Described on p. 20-21 p. 48-49 (1st group). "There are no variant readings between the 'special' manuscript of the cty (visesa-hastalikhita vrtti) and the printed version, we have taken the manuscript of the vrtti as authoritative." (Introduction (Hindi), p. 21) Forms v.4 (parts 1 and 2) of a complete edition of the Jaina Agama. ANU BL1312.5 1987 Uvavaiya suttam: Aupapatika sutram: mula evam Hindi-Angla bhasanuvada sahita / sampadaka Ganesa Lalavani; Hindi anuvadaka Ramesa Muni Sastri; Angla bhashanuvadaka Ke. Si. Lalavani. Jayapura: Prakrta Bharati Akadami, 1988. xxvii, 324, iv p. ; 23 cm. (Prakrta Bharati pushpa; 50). Contents: Prakasakiya [viii]-x.-Publisher's note [xi]-xiv.-Bhumika [xv]-xviii.Foreword [ix]-xxii. Suci= Contents [xiii]-xxvii.-Uvavaiya-suttam [1]-324.-- [Advertising] [i]-iv. ANU NBC 1 622 441 Aupapatika-sutram = Aupapaatika sutra / Ghasilalaji-Maharaja-viracitaya Piyushavarpinyakhyaya vyakhyaya samalankrtam; Hindigujarabhasanuvadasahitam; niyojaka Srikanhaiyalalaji. Ahamadabada: A[khila]. Bha[arata]. Sve[tambara]. Stha[nakavasi]. Jainasastroddhara Samiti, Vira samvat 2516. Vikrama-samvat 2046. Isvisan 1990. 7,736 p.; 25 cm. "Prati 250." Reprint. Originally published, 1959. 121 RW
Page #142
--------------------------------------------------------------------------
________________ Upangas Translations: English 1988 Gujarati: 1879 1959 Hindi: 1917 1959 1963 1982 1988 Lalwani, K. C. (Uvav. 1988) (Uvav.1879) Ghasilala (Uvav.1959) Amolaka Rsi (Uvav.1917) Ghasilala (Uvav.1959) Umesacandraji (Uvav.1963) Chaganalala Sastri (Uvav.1982) Lalwani, K. C. (Uvav.1988) Partial translation: SS1 and a number of other extracts from Uvav.1883 are translated into English in: 1907 *The Antagada-dasao and Anuttarovavaiya-dasao: translated from the Prakrit / by L.D. Barnett. London: Royal Asiatic Society, 1907. xi, 158 p. (Oriental Translation Fund, New Series, v. 17). Review. E. Leumann. JRAS 1907, p. 1078 ff. [Schubring 1935 SS47] Reprint. 2. printing Varanasi : Prithivi Prakashan, 1973. ; 22 cm. ANU BL1312.3.A582E4 1973 Studies: Bollee, W. B. 1978. On royal epithets in the Aupapatikasutra. JOI(B) 27 (1978) 95-103. Text from Uvav.1883 [1966] with translations and variants from parallel passages. Indexes: 1883 (Uvav.1883): Glossar p. [91]-163. 1987-89 (Uvav.1987-89): Uvav., RayPa. and Jivabhi. indexed together in Uvangasuttani part 1 (ie. v.4, pt.1): Parisista 3. Saddasuci, p. 545-774. 122
Page #143
--------------------------------------------------------------------------
________________ Title: Rajaprasniya (Skt). Content: "[T]he nucleus of the work is really the dialogue ... between King Paesi and the monk Kesi, concluding with the conversion of the free-thinking king. This is a splendid, lively dialogue, in which Kesi endeavours to prove to Paesi that there is a soul independent of the body, whilst Paesi thinks that he has established the contrary by means of experiments" (Winternitz 1933:2, 455-56). References: JSBI 2, 37-63; JRK 330-31; BORI Cat. 17:1, 174-81; Schubring 1935 SS47.2. Exegesis: 1 2 3 4 5 Editions: 1879 1910 1918 1925 2.2 RAYAPASENAIJJA (Ray Pa.) 1 2 Malayagiri, Tika or Vrtti, 3 700/3500/3 650 granthas including text (JRK 330). Printed. RayPa.1879; 1925; 1937; 1937 or 1938; RayPa.partial edition.1938. Abhayadeva Suri, pupil of Jinesvara, Tika, 3 125 granthas (JRK 330). Inspite of other references (Schubring (1962 (English version of his 1935 work) 97, Jain 1984, 481) the existence of this cty is highly doubtful (fax from W. Bollee, received July 1999). Megharaja, pupil of Sravanamuni, Stabaka, composed during the reign of Rajacandra, successor of Samaracandra of the Parsvacandra Gaccha (JRK 331).1 Printed. RayPa. 1879. Ratnaprabhasuri, Tika (JRK 330). Tika (JRK 330). *Raya paseni ji sutra : dusara Upanga / Ganadhara Srisudharmmasvamikrta mulasutra, tadupari Malayagiri Acaryya krtatika, tadupari Megharajaji krta Valabodha. Kalakatta: Sri Yasodananda Sarkara ke Chapekhana, Samvat 1936 [1879]. 296 p. ; 26 x 17 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha; 13). [BORI Cat. 17:1, 174-75; Schubring 1944, 16; Univ. of Chicago Library catalogue; An Illustrated AMg. dictionary 1923-38:1, xxxiii, item 40; copy also held in Strasbourg] "Jaini svadharmmi ke vaste mulya 8III) ata rupaiya cara ana arthat adha mulya. Anya grahaka ke vaste 1711) sattare rupaiya atha ana [sic]." *[Edition] [Cited in the bibliography of The Kalas. [?] / A. Venkatasubbiah. Adyar : 1911. (fax from W. B. Bollee received July 1999)]. *Rajaprasniya sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918. 304 p. ; 13 x 23 cm. Srimatra japrasnyas@tram: Srimanmalayagiriprapitavrttiyuktam. Bombay: Agamoday Samiti, Vira samvat 2451. Vikrama samvat 1981. Kraista 1925. 149 [ie. 298] p. 13 x 27 cm. [Agamodaya Samiti series; no. 42]. [CLIO 3, 2056; JRK 330] "Pratayah 750." BORI; Patan 36062; RW 1937 *[Text with Malayagiri's Tika.] [Devendra Muni 1977, 715 item 1] 1937 or 1938 Rayapasenaiya-suttam: parisodhitamulapatha-pathantara-vivarana-tippana-visistanekaparisistadibhih samyutam/sampadakah Becaradasa Jivaraja Dosi. Amadavada: Gurjara Grantharatna Karyalaya, Vi. sam. 1994 [1937]. Vira samvat 2464 [1938]. 2 v.; 13 x 28 cm. A manuscript in the India Office Library could be of this text (CGRM 18-19). "Printed at the Ary-bhushan [sic] Printing Press Pages 72 and remaining 'Viri-Shasan Printing Press" Ahmedabad by Shah Vithaldas Mahabhai." (reverse of the title-page). "Idam pustakam Sa. Venicanda Suracanda ityanena dvasaptatidala paryantam puna 'Aryabhusana' mudranalaye sesam ca Rajanagara (Amadavada) madhye Srivirasamajiya Sri 'Vira-sasana' mudranalaye Sa. Viththladasa Mohanabhaidvara mudrayitva prakasitam." (reverse of final page).
Page #144
--------------------------------------------------------------------------
________________ Upangas (Praksta-granthamala ; 9). [Roth 1983, 223; Viy. 1994<<1996?>:1, 335 item 138] Contents v.1: Rayapasenaiyam 1-132.Srirayapasenaiya suttano sara (annotated Gujarati translation). 1-60. Contents v.2: Pravesaka/Becaradasa Jivaraja Dosi 3-30.-Visayanukrama 31-39.-1. pathabheda ane 2. vacanabheda 41-42.-1. sampadake upayogamam ... granthoni yadi ane 2. sanketonum spastikarana 43.- [Text] 133-344.-Sabdakosa 345-77. - Srirayapasenaiya suttano sara (annotated Gujarati translation, continued] 61-146. Publication dates from v. 2. BORI 1158 (v. 1), 33082 (v. 2) 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie ; (sutthuruvena Pupphabhikkhuna sampadio. 1. avstti. Gudagaiva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354.2 v. ; 19 cm. Rayapasenaiyam v.2, (41)-103. ANU BL1310.58 1954 2 v. 1965-66 Sri Rajaprasniyasutram = Raajprashniya sutram : Ghasilalaji-Maharaja-viracitaya Prameyacandrikakhyaya vyakhyaya samalankrtam Hindi Gurjara-bhasa 'nuvadasahitam / nivojakah ... Panditamuni-Srikanhaiyalalaji-Maharajah. "Prathamo-avrttih." Rajakota, Saurastra : A[khila). Bha[ratiyaSve[tambara Stha[nakavasi] Jainasastroddharasamitipramukhah Sresthi-Sri-Santilala-Mangaladasabhai-Mahodayah. Vira-samvat 249192 [1965-66). 2 v. ports. ; 25 cm. Contents v. 1: [Donor details [1]-3.-... Visayanukramanika [4-5).-Sri Rajaprasniyasutram [Su. 1-97] 1-706. Contents v. 2: (Donor details [1]-6.-Visayanukramanika 7.-Suddhi patra (with one or two corrections for his editions of Acar., Dasa., Utt., Viy.) 8-10.--[RajPa.) Bha[ga]. 2 ... Suddhi patraka [1]-28.-Sri Rajaprasniyasutram (Su. 98-175). 1-449. "Prati 1200." ANU PK5003.A53R3 1965 2 v. 1982 Rajaprasniyasutram: dvitiya-Upanga, mulapatha, Hindi anuvada, vivecana, parisista yukta / samyogaja tatha pradhana sampadaka Sri Misrimalaji Maharaja Madhukara'; sampadakaVivecaka-anuvadaka Sri Ratana Muni ji. Byavara, Rajasthana : Sri Agamaprakasanasamiti, Viranirvanasamvat 2509 [1982]. 40, 244 p. ; 25 cm. (Jinagama-granthamala , granthanka 15). Contents: Prakasakiya [7].-Adi vacana / Muni Misrimala 'Madhukara' 8-11.Visayanukramanika 12-14.- Prastavana : Rajaprasniyasutra : eka samiknatmaka adhyayana/Devendra Muni 15-39.-Rajaprasniyasutram [1]-213.-Parisista 1. Nrtyasangita-natya-vadya se sambandhi sabdasuci (214)-218.-2. Visista sabdom ki anukramanika [219-237.-Anadhyayakala [[Nandi.1966c, 7-9 se uddhrta) (238-40]. - [Donor list 241-44). ANU BL1312.6.R38 1982 1987-89 Uvangasuttani/ sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2044-45. I[svi san). 1987-89.2 v. ; 25 cm. Rayapasenaiyam v.1, [78]-212 "Original text critically edited on the basis of seven MSS of the text-Ka.' Shrichand Ganeshdas Gadhaiya Library, Sardarshahar, dated samvat 1671 [16141--Kha.' 'Ga.' "55 and 61 leaves respectively, both of them are similar to MS 'Ka."-"Gha.' "belongs to Yati Kanakachandji of Pali (Marwar) samvat 1566 [1509)--'Ca.' and 'Cha.' are "from the collection of Punamchand Duddhamal Dudheria of Chhapar (Rajasthan)" 16th cent. (samvat?] and samvat 1665 (1608) respectively-one MS of Malayagiri's cty. Vr.' from the Shrichand Ganeshdas Gadhaiya Library, Sardarshahar, dated samvat 1605 [1548)-- described briefly on p. 23-24 = p. 51-52 (1st group). Apparently no printed editions were used. Forms v.4 (parts 1 and 2) of a complete edition of the Jaina Agama. ANU BL1312.5 1987 124 124
Page #145
--------------------------------------------------------------------------
________________ 1990 Partial editions: 1934 1936 1938 Reprint of RayPa.1965-66: 2. avrtti Vira samvat 2517. Vikrama samvat 2047. Isvisan 1990 "250 Prati". ela Rayapaseniyamsi Paesikahanayam : portion of the Rayapaseniyasutta prescribed for the Intermediate Arts Examination / edited for the use of university students with introduction and exegetical notes by P. L. Vaidya. Poona: Shri Ganesh Printing Works and Arya Bhushan Press, 1934. xvi, 52, 113 p.; 19 cm. Contents: Introduction iii-xvi.-Peasikahanayam [1]-52.-Notes [53]-113. 22 Rayapascoaja "I published in 1930 the bare text [no details of this edition have been traced yet], rather in a hurry... but I found that the text, then presented, required some improvements in textual matters. The students also required some additional help in the form of explanatory notes, etc.... I have effected improvements in both directions, first by giving a better and more accurate text which I was able to do with the help of numerous MSS of the text, the cty of Malayagiri and similar passages occuring elsewhere in the Jain canon and secondly, by adding exhaustive notes in English and extracts from the cty wherever they were likely to be useful... this edition will now solve all the problems relating to the text ..." (P. L. Vaidya, Introduction iii-iv). Translations: English: 1938 Rayapaseniyasutta: Paesikahanayam pp. 113 to end: critically edited with notes, introduction and complete translation etc. /by R. C. Tripathi. Ahmedabad: Ramnik P. Kothari, 1936. xiv, 47, 138 p.; 18 cm. Contents: Preface [1].-Introduction [i]-xiv. Paesikahanayam [1]-47.-Translation: the tale of Pradeshi [1]-53.-Notes [54]-138. "Prescribed for F[irst]. Y[ear]. A[rts]. Examination 1937." The indication "p.113 to end" refers to RayPa.partial edition. 1934. University of Pune CASS Q31:21212/G4/12979 RW-photocopy ANU BL1312.6.R3842P2 1936 Rayapasenaijjam: the second Upanga of the Jain canon: text, edited with commentary, introduction, notes & translation / by N. V. Vaidya. Ahmedabad: Khadayata Book Depot, 1938. 7, 235, 80. 39, 22 p.; 19 cm. Contents: Preface [1]. Introduction [3]-7.-Srimanmalayagiryacaryavihitavivrttiyutam Srimadrajaprasniyam Upangam [1]-235.-Rajaprasniya sutra translation [1]-80.-Notes [1]-39. [Text of Malayagiri's cty on SS46-85, ie. that part of the text not covered in p. 1- 235 above 11-22. 1-235) the relevant cty This work includes only the first half of the book, Suriyabho section. "I undertook the present edition of RayPa, part 1, at the suggestion of my publisher, Mr. R. P. Kothari ... For the second part there is already an excellent edition by Dr. P. L. Vaidya [RayPa.partial edition. 1934]. ... I have mainly followed the text as given in [RayPa. 1925], correcting the obvious misprints and removing 'ta-sruti' and other such bad writings. I have given the cty in full (even for the second part), as the text is very terse ... the translation is, as far as possible, literal and the notes leave nothing unexplained." "Mr. Tripathi's book [RayPa.partial edition.1936] is independent of mine, and I am in no way connected with it." (N. V. Vaidya, Preface). N. V. Vaidya (RayPa.1938) ANU BL1312.6.R384E4 19303 University of Pune, CASS Library Q31:21212/111G802/115994 3 Part 1 only, p. 1-235, 1-48. 4 Part 2, p. [1], [3]-7, 49-80, [1]-39, [1]-22. Photo-copy RW. 125
Page #146
--------------------------------------------------------------------------
________________ Upangas Partial 1936 R. C. Tripathi (RayPa.partial edition. 1936) Gujarati: 1935 *[Gujarati translation /Becaradasa Jivaraja Patela.] Limbati : Ladhaji Svami Pustakalaya, 1935. [Devendra Muni 1977 715 item 4] 1937 or 1938 Becaradasa Jivaraja Dosi (RayPa. 1937 or 1938) Reprint 1948? 1948 Sri Rayapasenaiya sutta : Gujarati anuvada tippano sathe/anuvadaka Becaradasa Jivaraja Dosr. Avrtti 2. Limbadi, Saurastra : Kantilala Vrajalala Setha, Vira samvat 2494 [1948). 40, 220 p. 19 cm. (Pujya Sri Ladhajisvami Smaraka granthamala; manako 24 me). Contents: Abharapatra (5). Prakasanum nivedana [71-8.-Upodghata/Muni Chotalalaji [9]-19.-Pravesaka / B. J. Dosi [20]-33.-Visayano anukrama (34)-40.-Sri Rayapasenaiya sutta [1]-145.-Tippano [147]-220. "Prata 1 000." Text based on RayPa.1938 (p. 32). First edition 1937 (Raya. 1982, Prastavana p. 38 (1st group)). ANU BL1312.6.R384G8 1948 1965-66 Ghasilala (RayPa. 1965-66) Reprint (RayPa.1990) Hindi: 1919 Amolaka Rsi (RayPa.1919) 1965-66 Ghasilala (RayPa. 1965-66). Reprint (RayPa. 1990) 1982 Ratana Muni (RayPa. 1982) Marathi 1980 Paesikahanayam: Paesi rajaci katha / anuvadaka Ja. Ra. Josi. Pune: Tattvajnana-Vibhaga, Pune Vidyapitha, 1980. 6, 35 p. ; 22 cm. Contents: Manogata [3].-Anukramanika [4].-Anuvadakaci prastavana (5)-6.Paesikahanayam [1]-25.-Parisista 1. Payasisutta [26]-30.2. Paesikahanayam va Parisista 1. yavara tipa. [31]-35. "Prati 500." CASS and Jayakar libraries, Univ. of Poona, Pune Studies: Kapadia, H. R. 1932-33. Rajaprasniyasutra, its claim as [anUpanga, its title etc. Annals of the Bhandarkar Oriental (Research) Institute 14 (1932-33) 145-49. Leumann, Ernst. 1883. Beziehungen der Jaina-Literatur zu andern Literaturkreisen Indiens. Actes du Vie Congres international des Orientalistes, Ille Partie, Section II, p. 467-564. Leiden, E.J. Brill, 1885. [Guerinot 1906 $44] Comparison of the Buddhist and Jain legends of Payasi / Paesi. Includes an analysis of the RayPa. with some translations into German (p. 490-527). Indexes: 1937 or 1938 (RayPa.1937 or 1938) v.2: Sabdakosa p. 345-77. 1982 (RayPa.1982): Parisista 1. Nrtya-sangita-natya-vadya se sambandhi sabdasuci[214]-218. 2. Visista sabdom ki anukramanika [219]-237. 1987-89 (RayPa. 1987-89): Uvav., RayPa. and Jivabhi. indexed together in Uvangasuttani part 1 (ie. v.4, pt.1): Parisista 3. Saddasuci, p. 545-774. 126
Page #147
--------------------------------------------------------------------------
________________ 2.3 JIVABHIGAMA (JI vabhi.) Title: Jivajivabhigama (Pkt and Skt). Content: "The doctrine of the living and the lifeless things' gives in 20 sections a comprehensive classification of living creatures and a description of the universe in all its details (oceans, islands, palaces of gods, etc. The section dealing with the continents (diva) and the oceans (sagara) is connected with the Jambuddiva-Pannatti, and is an interpolation." (Winternitz 1933:2, 456). References: JRK 257-58; Schubring 1935 847.3. Exegesis: Curni, 1 500 granthas (JRK 144). Malayagiri, Tika, 14 000 granthas, (JRK 144). Printed Jivabhi.1883; 1919; 1938. Haribhadra, 700-770, Laghuvitti ( = Pradesavrtti), 1 192 granthas (JRK 144). Devasuri (?), Vrtti, (MS dated samvat 1564) (JRK 144). Padmasagara, pupil of Dayasagara (Ancala Gaccha), Tika (composed samvat 1700) (JRK 144). Vrtti (JRK 144). Pilhika, 200 granthas (JRK 144). Paryaya and Vittiparyaya (BORI Cat. 17:1, 191-94). Tabba (Gujarati] before 1702 (?) (BORI Cat. 17:1, 185-86). Partial commentaries: Abhayadeva, Sangrahani, cty on 3rd. pada (JSBI:1, 66nl). 2 Sricandra Suri, pupil of Salibhadra Suri, Vyakhya on uddesa 20 (JSBI:1, 66 nl). Editions: 1883 *Atha-Sthananga-namnas trtiyangayopangam Jivabhigama-nama sutram / Sri Malayagiri Suri-ksta-vitti-sahitam Gurjara-bhasa-yuktam ca prarabhyate. Ahmedabad : Times Press, 1883. 2 v. : 13 x 32 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 14). [CLIO 2, 1168; Univ. of Chicago Library catalogue] Pagination: 4, 1114 [ie. 8, 2228 p.)? 1913 *[Edition by N. G. Javeri.] Bombay, 1913. [Kohl 1937, viii n3] 1918 *Jivabhigama sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918. 768 p. ; 13 x 23 cm. ANU NBC 1919 Sristhanargakhyatrtiyangasambaddham Caturdasapurvadhara viracitam Srimanmalayagiryacaryasutrita vivarana yutam Srimaisivajivabhigamopangam / edited by Sagarananda). Prathamasamskare. Bombay: Sheth Devchand Lalabhai Jain Pustakoddhar Fund, Virasamvat 2445. Vikramanrpasya 1975. Kraista 1919. f. [2], 466,[1]: 12 x 27 cm. (Sresthi-DevacandraLalabhai-Jaina-pustakoddhara ; grantharkah 50). [CLIO 2, 1168; DLJP list] Bombay: Agamodaya Samiti, 1919 (Schubring 1935 $47). "Pratayah 1000." BORI *Jivabhagamatika (Devacanda Lalabhai Jaina Pustakoddhara, sam. 1995 [193811. [Nirukta kosa / vacana pramukha Acarya Tulasi; pradhana-sampadaka Mahaprajna ; sampadaka Sadhavi Siddhaprajna, Sadhavi Nirvanasri, 1984. p. 24 (first group)).] 1938
Page #148
--------------------------------------------------------------------------
________________ Upangas 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie ; (sutthuruvena Pupphabhikkhuna sampudio. 1. avrtti. Gudagarva-chavani, Purvapanjaba : Sirisutta gamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354.2 v. ; 19 cm. Jivajivabhigame v.2 [105]--264. ANU BL1310.58 1954 2 v. 1971-74 Sri-Jivabhagamasutram / Ghasilalalaji (sic)-Maharaja viracitaya Prameyadyotikakhyaya vyakhyaya samalankstam; niyojakah Srikanhaiyalalaji. 1. avstti. Rajakota; A[khila). Bha[rat) Sve(tambara). Stha[nakavasi). Jainasastroddharasamiti. Vira-samvat 2497-2501. Vikramasamvat 2027-31. Isavisan 1971-74. 3 v. ; illus; 26 cm. v. 1: (1-2. pratipatti): 8, 640, (Suddhipatra) 9-28 p.--v. 2: (3. pratipatti) 8,902 p. University of Pune Q31:21213 / 15.152K1.1/218080/RW V. 3: (3.-10. pratipatti ...) 8, 1534 p. ; 3 leaves of portraits. RW 1987-89 Uvangasuttani/ sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2044-45. I[svi san). 1987-89.2 v. ; 25 cm. Jivajivabhigame v.1 [213]-515. "Original text critically edited" on the basis of four MSS of the text-Ka, Kha and Ga, all from the Sricanda Ganesadasa Gadhaiya library Saradarasahara, Ka dated samvat 1575, the other two estimated to be 16th cent. (samvat]; "Palmleaf photo-print of Jaisalmer Bhandara"-a MS of a Tabba samvat 1800; and a MS of Malayagiri's?] tika, dated samvat 1717-described briefly on p. 28-29 = Editorial p. 56-57 (1st group). Forms v. 4 (parts 1 and 2) of a complete edition of the Jaina Agama. ANU BL1312.5 1987 1989-91 Jivajivabhigamasutra : Srutasthavirapranita-Upangasutra : mulapatha, prastavana artha, vivecana tatha parisista adi yukta / sampadaka Rajendramuniji ; mukhya sampadaka Sobhacandra Bharilla. Byavara, Rajasthana: Sri Agama Prakasana-Samiti, 2515-17 [1989- 91). 2 v. ; 25 cm. (Jinagama-granthamala , granthanka 30, 31). v. 1. 41, 450 p.--v. 2. 14, 215 p. Contents v. 1: Prakasakiya (5).-Sampadakiya vaktavya / Rajendra Muni 6-10.Prastavana: Jivajivabhigama : eka samiknatmaka adhyayana/Devendra Muni 11-36.Visayanukrama 37-41.- [Text] 1-443.-Anadhyayakala [[Nandi.1966c, 7-9 se uddhrta [444] 46.- [Donor list 447-50. Contents v. 2: Prakasakiya [7].-Sampadakiya vaktavya [9]-12.-Anukramanika 1314.- [Text] 1-215.-Anadhyayakala [[Nandi. 1966c, 7-9] se uddhtta (217-1914[List of donors) [221-24). RW Translations; Gujarats: 1883 (Jivabhi.1883) 1971-74 Ghasilala (Jivabhi.1971-74) Hindi: 1918 Amolaka Rsi(Jivabhi.1918) 1971-74 Ghasilala (Jivabhi.1971-74) 1989-91 (Jivabhi.1989-91) Indexes: 1987-89 (Jivabhi.1987-89): Uvav., RayPa. and Jivabhi.indexed together in Uvangasuttani part 1 (ie. v. 4, pt.1): Parisista 3. Saddasuci, p. 545-774. 128
Page #149
--------------------------------------------------------------------------
________________ 2.4 PANNAVANA (Pannav.) Author: attributed to Syamacarya (Ajja Sama, Syamarya), who is at times identified with Kalikacarya (BORI Cat. 17:1, 195; Schubring 1935 $48nl). Title: Prajnapana (Skt). Content: "[The Pannav.) gives in 36 chapters a classification of living beings, containing under 'human being' a geographical-ethnographic outline, in which the Aryans (ariya, arya) and the barbarians (milikkha, mleccha) are enumerated with their habitations" (Winternitz 1933:2, 456). There are "close relations between Satkhandagama and (Pannav.), see Introduction to [Pannav.1969-71] and Hiralalji's and A. N. Upadhye's article 'Satkhandagama aura Prajnapana sutra" in the Sampadakiya of Satkhandagama, 1985, 6-13)." (Roth, Gustav. 1974. Notes on the Pamca-namokkara-parama-mangala in Jaina literature, The Adyar Library bulletin 38 (1974)[1]-18, p. 13.1). References: BORI Cat. 17:1, 195-211; JRK 257-58; Schubring 1935 847.4 Exegesis: (See Pannav.1969-71:2, 424487) Haribhadra, pupil of Jinabhata (mentioned by Malayagiri (JRK 58)) tika known as Pradesavyakhya, 3728 granthas, other names are Prajnapanamulatika and Sravakaprajnaptimulatika (JRK 258; Pannav.1969-71:2, 424-25, 429). 1947-49 Haribhadra, Sriprajnapanopangam : Suvihitadhurandharasahityasaudhananyastambhopamasriharibhadrasurisutrita-Pradesavyakhyasankalitam. [Ratlam] : Malavadesantargatasriratnapuriyasrirsabhadevakesarimalaji ityabhidhana Svetambara Samstha, Virasamvat 2473-76 (1947-49). 2 v. ; 13 x 27 cm. v. 1 (Purvabhagah): Havadiyacakala, Surata : Phakiracanda Maganalala Badami, Sri Jainavija yananda' Printinga Presa. 84 p. v.2 (Uttarabhagah): Suryapuriya : Srijainapustakapracarakasamstha. 85-158. (Sriagamoddharakasangraha ; bhagah 9). No introduction, variant readings or other footnotes, only the text of the commentary. Part 2 has ten Sanskrit verses on the reverse of the title page "Sriharibhadrasurisamayadipika." Final page: "granthagram 4 700." ANU LARGE PAMPHLET BL1312.6.P356 1947 2 v. Malayagiri, fl. 1170, Vrtti (15 000, 14 000 slokas) (BORI Cat. 17:1, 200-201), 14 500 (JRK 258). Discusses variants in the text (Pannav.1969-71, 426-31, 436-40). Printed. Pannav.1884;1918-19 [=1988). Translated into Gujarati Pannav.1934 Harsakulagani (?), Prajnapanabijaka (Pannav.1969-71:2, 431-32). Padmasundara, Avacuri, based on Malayagiri (Pannav.1969-71:2, 432). Dhanavimala, Tabo (Balavabodha, composed before 1767 V.S. [1710] (Pannav.1969-71:2, 432-33). Jivavijaya, Tabo (Balavabodha), based on Malayagiri, 1784 (Pannav.1969-71:2, 433-34. JRK 258). Paramananda, pupil of Anandacandra, Stabaka composed samvat 1876(1819) (Pannav.1969- 71:2, 434). Printed. Pannav.1884. Nanakacandraji, Sanskrit chaya, written before 1884. (Pannav.1969-71:2, 434). Printed. Pannav.1884. Vrtti (JRK 258). Prajnapanaparyaya and Vivaranaparyaya (JRK 258; BORI Cat. 17:1, 208-11; Pannav.1969 71:2, 435).
Page #150
--------------------------------------------------------------------------
________________ Upangas Partial commentaries: Abhayadeva, Pra jnapana-trtiyapada-sangrahani= Samgahani, 150 granthas (BORI Cat. 17:1. 205). Begins: disigai indiyakae (JRK 258; Pannav.1969-71:2, 426). 1917-18 *Navangi-vrtti-kara-Srimad-Abhayadeva-Suri-racite Panca-nirgranthiPrajnapanopangatsttiya-pada-sangrahani-prakarane (savacurnike) / Muni-Caturavijayena samsodhite. Bombay: Nirnaya-sagara Press, 1974 [1917-18). 2, 16, 26 sie. 4, 32, 521 p. ; 12 x 27 cm. (Jaina-Atmananda-grantha-ratna-mala ; no. 62). [CLIO 3, 1849] Avacurni seems to be that by Kulamandana, see 1.2 below. 1.1 Nivrtti (Sanskrit) on this (BORI Cat. 17:1, 207). 1.2 Kulamandanagani wrote an Avacurni / Tika on this composed 1444? V.S.) = Prajnapanasutravivaranavisamapadaparyaya (Pannav.1969-71:2, 426; BORI Cat. 17:1, 211. JRK 258; Pannav.1969-71:2, 426). Punyavijaya, Malvania and Bhojak think that the avacurni printed with Abhayadeva's Sangrahani (1917-18 above), although more extensive than Kulamandanagani's, seems to be merely an elaboration of it (Pannav. 1969-71:2, 426). Municandra Suri, d. 1178 V.S. (1121), on the first chapter of Pannavana, Vanaspativicara or Vanaspatisaptatika (Pannav. 1969-71:2, 431). Editions: 1884 *Pannavana-sutra : caturthopanga (Gujarati anuvada sameta) prarambha /Lonka-gacchiya Sri Ramacandra Gani klta Samskrtanuvada yuta ; Nanakacandaji se samsodhita hoke mudrita hua; Kalikacarya sankalitasutra, tadupari Malayagiri Suri krta Samskrta tika aura Paramanandarsi krta bhasa tika yuta. Benares: s.n., 1884. 3 v. ; 16 x 30 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 15). [CLIO 3, 1932; Univ. of Chicago Library catalogue Pagination: f. [1], 6, 849, 37,11). Jaina Prabhakara Press (CLIO). The editor of this edition was Nanakacandra, it contains Paramanandarsi's (Gujarati] Stabaka (composed in 1819) and the Sanskrit version by Nanakacandra, pupil of Ramacandra Gani. The prasasti clearly states that it was made by him and contradicts the information on the title-page (Guerinot 1906 8234; Devendra Muni 1977, 715 item 1; Pannav.1969-71:2, 434). "[T]he text ... printed in this edition is fraught with unauthentic readings. Moreover, punctuation marks are wrongly placed and word-divisions are wrongly made. We think that this printed text is based on some manuscript of the same nature" (Pannav. 1969-71:2, 440). In spite of this criticism the Sanskrit and Gujarati versions are faithful to the sutra text rather than the commentary (Pannav.1969-71, 439). 1918-19 Srimacchyamacaryadrbdham srimanmalayagiryacaryavihitavivaranayutam Sriprajnapano pangam. Mehesana : Agamodayasamiti, Virasamvat 2444 45. Vikramasamvat 1974-75. Kraista 1918-19. 2 v. ; 12 x 26 cm. (CLIO 3, 1932] Part 1. f. [2], 373.- Part 2. f[1], 2, 1, 374-611. "Critically prepared by ... Sagaranandasuriji " (Pannav. 1969-71:2, 23); "This edition is superiour to [Pannav.1884) from the standpoint of correct readings as well as correct printing. Hence after its publications scholars have utilized this edition alone ... there do appear major and minor mistakes" (Pannav.1969-71:2, 441). "Pratayah 1000." Reprint. Pannav. 1988 BORI 1919 *Pannavanna sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919. 1358 p. ; 13 x 23 cm. "The text of Prajnapanasutra contained in this edition is very corrupt ... he has used a manuscript or manuscripts belonging to the very group that the 1884 edition used)." (Pannav.1969-71:2, 441). 1934 *[Text with Malayagiri's tika / edited and translated into Gujarati by Bhagavanadasa 130
Page #151
--------------------------------------------------------------------------
________________ 2.4 Pannavana Harsacandra, in three parts.] Ahmadabada: Jaina Sosayani, Vikram 1991 [1934]. [Devendra Muni 1977, 716 item 4] "in three parts ... this edition is mainly based on [the] Agamodaya Samiti's edition [Pannav.1918-19]. But the editor has pointed out in the introduction that he has utilised two manuscripts belonging to Santisagaraji Bhandara, Ahmedabad... In spite of this it too, like the Agamodaya Samiti edition, does contain, at many places, major and minor mistakes. Not only that but there are places where the editor having rejected the correct readings yielded by [the] Agamodaya Samiti edition has accepted corrupt ones in their stead. Translation of the text proper as also that of the commentary follow the respective versions of the texts printed therein. Hence many a time the translation of the text proper is not in tune with that of the commentary" (Pannav. 1969-71:2, 441-42). 1953-54 Suttagame /carimatitthayara-pancamaganahara-Suhammayariyaviraie ; [sutthuruvena] Pupphabhikkhuna sampadio. 1. avrtti. Gudagamva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354. 2 v.; 19 cm. Pannavanasuttam v.2 [265]-533. "On examining the version of [the] Prajnapanasutra contained in Suttagame we have come to entertain doubt regarding the authenticity not only of the text of Prajnapanasutra contained therein but also of the texts of other Agamas contained therein." (Pannav.196971:2, 443). "Our notes on the readings accepted in Suttagame and our, 'Examination of some readings of Prajnapanasutra' [printed p. 447-87], on the contrary, prove that the editor of Suttagame has no critical acumen required for the selection of correct readings." (Pannav.196971:2, 444). "[W]e confidently say that the editor has not compared the printed text of Prajnapanasutra with any old handwritten manuscript of the same...." (Pannav. 1969-71:2, 444). Because he has not described his sources, these editors doubt them. "[Suttagame] is very defective from the standpoint of correct readings." "[W]e are in a position to say positively that the editor of Suttagame has not made any honest attempt whatsoever to prepare the critical and authentic version of Prajnapanasutra' (Pannav.1969-71:2, 445). ANU BL1310.S8 1954 2 v. 1969-71 Sirisamajjavayagaviraiyam Pannavanasuttam/sampadakah Punyavijayo Munih; Dalasukha Malavaniya; Amrtalala Mohanalala Bhojaka ityetau ca. Bambai: Sri Mahavira Jaina Vidyalaya, Vira sam. 2495-97 [1969-71]. 2 v. ; 25 cm. (Jaina Agama series; granthanka 9, bhaga 1-2). v. 1 Mulagranthatmakah prathamo bhagah, 51, 450 p.-v. 2. Parisista-prastavanatmako dvitiyo bhagah (including index). Contents v. 1: Prakasakiya nivedana [9]-11.-[Donor details] [12-13]-Granthanukrama [14]. Sampadakiya/Punyavijaya, Dalasukha Malavaniya, Amrtalala Mo. Bhojaka [15]19.-Editors' note / [translated by Nagin J. Shah?] [21]-25.-Sanketasucih [26].Prajnapanasutrasya visayanukramah [27]-51.-Bhagavamsirisamajjavayagaviraiyam Pannavanasuttam [1]-446.-Suddhipattayam 447-50. Contents v. 2: Prakasakiya nivedana [9]-11.-Rnasvikara [12].-Asadharana khota [about the death of Muni Punyavijaya, 4 June 1971] 13-16.-Granthanukrama [17].-- Prastavanano visayanukrama [18]-22.-Sanketasuci [23].-Suddhipatrakam [25]-27.-- Prastavana / Punyavijaya, Dalasukha Malavaniya, Amrtalala Bhojaka 1-199.Introduction/ [translation of Prastavana by Nagin J. Shah] [201]-487.-Pannavanasuttaparisitthaim. 1. Gahanukkamo [1]-4.-2. Saddanukkamo-sakkayatthasahio [5]407.-3. Visesanamanukkamo 408-15. Text established from eight manuscripts (1) 'Kham.', Cambay (no. 17 in Punyavijaya, 1961-66), 14th cent.); (2-3) 'Je.' and 'Dha.' from Jaisalmer (no.s 27 and 29) samvat 1389 [1332], 1489 [1432]; (4) 'Ma.' Sri Mahimabhakti Jaina Jnana Bhandara, Bikaner (17th cent. V.S.); (5) 'Pra.' Kantivijayaji Collection, Sri Atmaramaji Jaina Jnana Mandir, Baroda, samvat 1776 [1719]; (6-8) Pu.1-3', Punyavijayaji's collection, L. D. Institute, 131
Page #152
--------------------------------------------------------------------------
________________ Upangas Ahmedabad, catalogue no. 6695 (samvat 1611 [1554), no. 6709 (17th cent. V. S.), no. 7250 (samvat 1565 (1508)--and one printed edition Pannav. 1918-19. Extensive introduction and analysis as well as details on commentaries and previous editions given in the second volume, in Gujarati and in English. As well as the oldest manuscripts available the editors have used Pannav. 1884; 1918-19; 1919; 1934; 1941, 1953-54 (v. 2, 440-447). ANU PK5003.A53P3 1969 2 v. 1974-80 Sri-Prajnapanasutram/Ghasrlalaji-Maharaja-viracitaya Prameyabodhinivyakhya vyakhyaya samalankrtam Hindi-Gurjara-bhasa'nuvadasahitam; niyojakah Srikanhaiyalalaji Maharajah. Prathama-avstti. Rajkot : Sri A[khila). Bha[rata). Sve(tambara). Sthanakavasi Jaina Sastroddhara Samiti, Vira-samvat 2500-07. Vikrama samvat 2030-37. Isavisan 1974-80.5 v. ; 25 cm. Contents: v. 1: Vira-samvat 2500. Vikrama-samvat 2030. Isvisan 1974.6, 1015 p.; Padas 1-2. Contents v. 2: Vira-samvat 2500. Vikrama-samvat 2032. Isvisan 1975. 7, 1162 p. ; 5 leaves of portraits. Padas 3-6. Contents v.3: Vira-samvat 2503. Vikrama-samvat 2033. Isvisan 1977. 8, 939 p.; Padas 7-16. Contents v. 4: Vira-samvat 2504. Vikrama-samvat 2034. Isvisan 1978.7, [826 p. Padas 17-21. Contents v. 5: Vira-samvat 2507. Vikrama-samvat 2037. Isvisan 1980.7, 1160 p. Padas 22-36. "Prata 1200." v. 1, 2 RW / v. 3 ANU 1983-1986>Prajnapanasutra : Sri Syamaryavacaka-sankalita caturtha Upanga : mulapatha, Hindi anuvada, vivecana, tippanayukta / sampadaka-vivecaka-anuvadaka Jnanamuniji ; sahasampadaka Sricanda Surana 'Sarasa'. Byavara, Rajasthana : Sri Agamaprakasana-samiti, Viranirvanasamvat 2509_<2512>[1983<1986>]. v.<1-3>; 25 cm. (Jinagama-granthamala; granthanka <16, 20, 27>). Text based on Pannav.1969-71. Translation and notes based on Malayagiri. (1, 23 (1st group). v. 1: 2509 (1983). 31, 536 p.-v. 2: 2511 [1984). 15, 526 p. (2. edition 2520 [1993]).--v. 3: Not yet seen] Contents v. 1: Donor details 17-8]. Prakasakiya 9.-Adi vacana / Muni Misrimala *Madhukara' (11-14).-Acaryasamrat Sri Atmaramaji Maharaja : jivana aura sadhana ki eka sanksipta jhamki/Jnana Muni (15)-17.-Sampadakiya / Jnana Muni [18]-24.Visayanukramanika (25)-31.-Pannavanasuttam (Pada 1-9) 1-525.-Parisista 1. Prajnapanusutra : Shana 1-9 : Gothanukramas@ci [5267-528.-Anadhyayakala [[Nandi. 1966c, 7-9 se uddhfta] [529]-531.- [Donor details) [533]-536. Contents v. 2: Prakasakiya 7]. [Donor details [8]-Adi-vacana / Muni Misrimala *Madhukara' 9-12.-Visayanukramanika 13-18.-Pannavanasuttam (pada 10-22][1]519.-Anadhyayakala [[Nandi.1966, 7-9 se uddhrta) (520)-522-[List of donors) (523) 526. ANU BL1312.6.P35 1983 <2 v.> 1987-89 Uvargasuttani/ sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2044-45. I[svi san). 1987-89.2 v. ; 25 cm. Pannavanasuttam v.2, [1]-356. "Original text critically edited on the basis of four MSS-ka, 15th cent. (samvat), from the Punamacandaji Budhamalaji Dudhoriya 'Chapara' library: Kha, with Tabba. Jaina Visva Bharati MS library. Ladanum, samvat 1775; Ga. (with vrtti), from the sangha's MS library Ladanum, 17th cent. samvat; Gha. 16th cent. (samvat), from the Sricandaji Ganesadasaji Gadhaiya library Saradarasahara; Vr, from the same library, samvat 1577, Malayagiri's Vrtti--and the printed editions Pannav.1918-19, Vrtti of Malayagiri, the Ratlam edition of Haribhadra's Pradesavyakhya 1947-49--described briefly on p. 23 = 132
Page #153
--------------------------------------------------------------------------
________________ 2.4 Pannavana 1988 Editorial p. 49-51 (1st group). Forms v.4 (parts 1 and 2) of a complete edition of the Jaina Agama. ANU BL1312.5 1987 Sri Prajnapanopangam = Prajnaapanopaangam / Purvadhara Sri Syamarya viracitam ; Malayagirisuri viracitavrttiyutam; punarmudranaprerakah Vijaya Bhuvanabhanusurisvarah. Cikapeta, Bengalora : Sri Adinatha Jaina Svetambara Mandira Trasta, 1988. 8, 20, 10, 408 p. ; 29 cm. Reprint of 1918-19 edition with preface. ANU (BL1312.6.P856M3 1988 Translations: Gujarati 1884 Paramanandarsi (Pannav.1884) 1934 Bhagavanadasa Harsacandra (Pannav.1934) 1974-80 Ghasilala (Pannav. 1974-80) Hindi: 1919 Amolaka Rsi (Pannav.1919) 1983<1986> Jnanamuni (Pannav. 1983-<1986>) 1974-80 Ghasilala (Pannav. 1974-80) Studies: Malvania, D. 1969. *Prajnapana and Satkhandagama. Journal of Oriental Research 19 (1969) p. 35f. (SatAg.1985:1, Introduction, 91 Indexes: 1969-71 (Pannav. 1969-71): Pannavanasuttaparisitthaim. 1. Gahanukkamo [1] 4.-2. Saddanukkamo sakkayatthasahio (51-407.-3. Visesanamanukkamo 408-15. 1983 <1986> (Pannav. 1983<1986>): v.1: Parisista 1. Prajnapanasutra : Sthana 1-9: Gathanukrama suci (526)-528. 1987-89 (Pannav. 1987-89): Pannav., Jambuddi., SuraP., CandaP., and Niraya. indexed together in Uvangasuttani part 2 (ie. v.4, pt.2): Parisista 3. [sic] [Saddasuci] [807)-1093.- Corrections to] Sabdakosa (1097)-1100. 133
Page #154
--------------------------------------------------------------------------
________________ 134
Page #155
--------------------------------------------------------------------------
________________ 2.5 JAMBUDDIVAPANNATTI (Ja mbuddi.) Title: Jambudvipaprajnapti (Skt). Content: The mythical geography of the Jainas, the description of Jambudvipa, the central continent (Winternitz 1933, 457), Winternitz also links this work with a section of the Jivabhigama (p. 456). References: JRK 130-31; JSBI 2, 113-26; BORI Cat. 17:1, 215-40; Schubring 1935 $48.6. Exegesis: Malayagiri, Tika, referred to by Punyasagara (1588 CE) and santicandra (1603 CE), the latter says it is no longer extant (JRK 130-31). Hiravijaya Suri, pupil of Vijayadana Suri of the Tapa Gaccha, Vrtti written with the assistance of Dharmasagara and Vanararsi, in samvat 1639 [1582), (14,252 slokas) (JRK 130 and 131 (8): BORI Cat. 17:1, 217). This cty was utilized in the preparation of Jambuddi. 1987-89. Presumably this is the same Hiravijaya Suri (1527-95) who was leader of the Tapa Gaccha, so culogized in the Hirasa ubhagya mahakavya of Devavimala. Punyasagara, disciple of Jinahamsa Gani / Suri of the Kharatara Gaccha, Vrtti (13 275 granthas) composed samvat 1645 [1588). He refers to Malayagiri's lost commentary (JRK 130). Santicandra Gani, pupil of Sakalacandra Gani, of Tapa Gaccha, lika called Prameyaratnamanjusa (18 000 granthas), composed in 1660 [1603]. It refers to commentaries by Malayagiri (which he says are lost) and Hiravijaya (JRK 130-31; BORI Cat. 17:1, 222-29). Another source however says he was a grand-disciple (para-sisya?) of Hiravijaya Suri of the Tapa Gaccha, and cites a MS of the cty dated samvat 1551 [?] (Jambuddi. 1987-89, Hindi preface p. 25). Printed. Jambuddi. 1890; 1920. 5 Brahma Muni, pupil of Parsvacandra, pupil of Sadhuratna, a prince of the Calukya dynasty, composed in Anhilvad, Vivrti or Tika, 15 000 granthas (JRK 131; BORI Cat. 17:1. 236 40. He also wrote a cty on the Susadha-caritra (see MahaNis.) and other works under the name Vinayadeva Suri (CGRM 106-07). Jivav[ijaya Gani), Tabba (Gujarati), 15 000 slokas (BORI Cat. 17:1, 229-30). Curni, about 1 870 granthas (JRK 130; BORI Cat. 17:1, 233-36). Vrtti (Jambuddi.1987, 52). Dharmasagara Gani, 16th cent. Cty printed Jambuddi.1976. Partial commentaries: Bharatacarita, life of Bharata, part of the third vaksaskara (sutras 68-70) of the Jambu dvipaprajnapti (BORI Cat. 17:1, 231-33). Editions: 1890 *Sri Jamvudvipa prajnapti sutra prarambhah/Ganadhara Sudharma Svami sankalita sutra, tadupari Sri santicandragani krta Samskrta tika, Sri Ramacandra Gani krta Samskstanuvada yuta ; Rsi Amolakhacand se samsodhita. Banaras : Jaina Prabhakar Press, Amolakhcand Jati, 1890.698 p. ; 16 x 31 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 16). [Univ. of Chicago Library catalogue] 1919 *Jambudvipa prajnapti sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919.624 p. ; 13 x 22 cm. 1 In the Jaisalmer Jaina Jnana Bhandara (established by Jinabhadrasuri) there is a manuscript of the Jambudvipa prajnapti of which Punyasagara established the recension before he wrote a commentary on it (Nandi. 1968, Introduction p. 94 (4th group)). This manuscript seems to have been used for Jambuddi. 1987.
Page #156
--------------------------------------------------------------------------
________________ Upangas 1920 Prameyaratnamanjusanamnyavrttya yutam Srimajjambudvipaprajnaptinamakopangam / Srisanticandraganiviracitaya [ / edited by Sagarananda]. Bombay: Nirnayasagara Press, Srivirasamvat 2446. Vikramasamvat 1976. Kraistasan 1920. 2 v. ; 12 x 27 cm. (Sresthi Devacandra Lalabhai Jainapustakoddhara ; granthamkah 52, 54). [CLIO 2, 1138. Emeneau $3933. Roth 1983, 222; DLJP list] BORI copy title-page reads: "Srimajjambudvipaprajnaptih / Srimacchanticandravihitavrttiyutam. Prathamasamskare. Pratayah 1000." v. 1: 382 [ic. 764] p.-v. 2: 382-545 [ie. 764-1090] p. 1976 1953-54 Suttagame/carimatitthayara-pancamaganahara-Suhammayariyaviraie ; [sutthuruvena] Pupphabhikkhuna sampadio. 1.avrtti. Gudagamva-chavani, Purvapanjaba: Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354. 2 v.; 19 cm. Jambuddivapannatti v.2 [535]-672. BORI ANU BL1310.S8 1954 2 v. *Jambuddiva-pannatti: Jambudvipa-prajnaptih / Sri Jainasasanasaudhastambhayamanamahopadhyaya Sri Dharmasagaraganivaraviracitavivaranayuta; samsodhakah Labhasagaraganih. Kapadavanaja, Ji. Kheda: Agamoddharaka-granthamala ; Surata: Praptisthanam, Sri-Jainananda-pustakalaya, Vira sam. 2502 [1976]. Vikrama sam. 2033 [1976]. Agamoddharaka sam. 21; Manikya sam. 2. 12, 200, 340 p. ; 26 cm. Agamoddharakagranthamalayah: ratnam 57). Contents: Prakasakiya-nivedana 1.-Visayanukramah 2-4.-Suddhi-patrakam 9-12.-- [Text] 1-200.-Text. (Dvitiya vibhagah) 1-340. Edited from MSS preserved in the Jainananda-Pustakalaya, Srinemivijnana Kasturasuri Jnanamandira, Surat and Mithabhai Gulalacanda Jaina Upasraya, Sri Abhayadevasurijnanamandira, Kaparabanj, Gujarat. No variants given. "Pratiyam 500." ANU BL1312.6.J35 1976 1977-80 Sri-Jambudvipaprajnaptisutram / Ghasilalaji-Maharaja-viracitaya prakasikakhyaya vyakhyaya samalankrtam Hindi-Gurjara-bhasa'nuvadasahitam; niyojakah Srikanhaiyalalaji-Maharaja. Ahmadabada: A[khila]. Bha[ratiya]. Sve[tambara]. Stha[nakavasi] Jainasastroddharasamiti, Vira samvat 2503-04. Vikrama samvat 2034. Isavisan 1977-80. 3 v. ; 25 cm. v.1: Vira samvat 2506. Vikrama samvat 2036. Isavisan 1980. 4, 980 p. ; 5 leaves of plates. v. 2: Vira samvat 2503. Vikrama samvat 2034. Isavisan 1977. 5, 792 p. ; 5 leaves of plates. v. 3: Vira samvat 2504. Vikrama samvat 2034. Isavisan 1978. 4, 554 p. ; 5 leaves of plates. "Prati 1200." 136 RW 1986 *[First printing of edition reprinted 1994.] 1987-89 Uvangasuttani / sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana: Jaina Visva Bharati, Vikrama samvat 2044-45. I[svi san]. 1987-89. 2 v. ; 25 cm. Jambuddivapannatti v.2 [357]-588. Forms v.4 (parts 1 and 2) of a complete edition of the Jaina Agama. "Original text critically edited" on the basis of nine MSS-three of the text alone from Jaisalmer (samvat dates: 14th cent., 1375 [1318], 1646 [1589]); one MS (text only) from the Sricanda Gadhaiya Sangrahalaya, Saradarasahara; two from the Jain Visva Bharati library Ladanum (one containing only the text is undated, one with Vrtti [of Hiravijaya] dated samvat 1913 [1856); one MS of Hiravijaya's cty from the "Order's library, Ladnum" dated samvat 1919 [1862]; two MSS from the Sricanda Gadhaiya Sangrahalaya, Saradarasahara one with Punyasagara's Vrtti, samvat 1575 [1518] the other with Santicandra's, samvat 1551 [1494]-described on p. 24-25 = Editorial p. 51-53 (1st group). No printed editions are cited. ANU BL1312.5 1987
Page #157
--------------------------------------------------------------------------
________________ 2.5 Jambuddivapannatti 1994 Jambudvipaprajnaptisutra : Sthavirapranita sastha Upanga : mulapatha, Hindi anuvada, vivecana, parisishta yukta/adyasamyojaka tatha pradhana sampadaka Misrimalaji Maharaja *Madhukara'; anuvadaka-sampadaka Chaganalalasastri. 2. samskarana. Byavara, Rajasthana : Sri Agama Prakasana-Samiti, Viranirvana samvat 2520 [1994]. 59, 417 p. ; 25 cm. (Jinagama-granthamalagranthanka 26). Contents: Prakasakiya [7]. [Donor details] 8-10.-Sampadakiya/Devendra Muni 1153.--Anukramanika (54)-59.-Jambuddivapannattisuttam [1]-398.-Parisista 1. Gathaom ke aksaranukrami sanketa [399]-401.-2. Sthalanukrama (402)-407.-3. Vyaktinamanukrama [408]-410.-Anadhyayakala [[Nandi.1966c, 7-91 se uddhtta] ANU NBC 1 796 109 Translations: Gujarati 1977-80 Ghasilala (Jambuddi.1977-80) Hindi 1919 Amolaka Rsi (Jambuddi.1918) 1977-80 Ghasilala (Jambuddi.1977-80) 1986 [=1994] Chaganalala Sastri (Jambuddi.1986 [=1994) Studies: Alsdorf, Ludwig. 1947. Further contributions to the history of Jain cosmography and mythology. NIA 9 (1947) 105-28. Exposition of the different strata in evidence in Jambuddivapannatti V. Reprinted in his Kleine Schriften. Wiesbaden: Franz Steiner, 1974. p. 136-59. Kohl, Josef Friedrich. 1937a. Die Suryaprajnapti und ihr textgeschichtliches Verhaltnis zur Jambudvipa prajnapti nebst einem Spezimen. (Teildruck). Bonn, 1937. xlii, 18 p. ; 24 cm. Bonn, Phil. Diss. 1937. A portion only of the dissertation. ANU PAMPHLET PK5003.A8K6 Kohl, Josef Friedrich. 1937b. Die Suryaprajnapti: Versuch einer Textgeschichte. Stuttgart: Kohlhammer, 1937. xliv, 112 p. (Bonner Orientalistischen Studien ; Heft 20). Review.Walther Schubring. Die Suryaprajnapti OLZ41 (1938) 562-64. Reprinted Kleine Schriften 455-56. Review. Ludwig Alsdorf DLZ 60 (1939) 729-32 (Alsdorf Kleine Schriften 1974, xiv). Indexes: 1987-89 (Jambuddi.1987-89): Pannav., Jambuddi., SuraP., CandaP., and Niraya. indexed together in Uvangasuttani part 2 (ie. v.4, pt.2): Parisista 3. [sic] [Saddasuci) (807)-1093.--Corrections to] Sabdakosa (1097)-1100. 1994 (Jambuddi.1994): Parisista 1. Gathaom ke aksaranukrami sanketa (399)-401.-2. Sthalanu krama (402) 407.-3. Vyaktinamanukrama [408] 410. 137
Page #158
--------------------------------------------------------------------------
________________ 138
Page #159
--------------------------------------------------------------------------
________________ 2.6 SORAPANNATTI (Sura P.) 2.7 CANDAPANNATTI (Canda P.) Title: Suryaprajnapti (Skt) and Candraprajnapti (Skt). Content: The SuraP. contains a systematic presentation of the astronomical views of the Jainas, it deals with both the sun and the moon. The CandP. being completely identical in all available manuscripts with the SuraP. it would seem that the original CandP. has been worked into the SuraP. (Winternitz 1933:2, 456-57; Schubring 1935 $48.5). References: BORI Cat. 17:1, 241-44; JSBI 2, 105-10; Schubring 1935 848.5. Exegesis: Bhadrabahu, Niryukti on Surapannatti only, mentioned as lost by Malayagiri in his commentary on this text (gatha 5).! A gatha from it is quoted by Devabhadra in his commentary on Sricandra's Sangrahaniratna, composed in the 13th cent. (JRK 452). Malayagiri, Tikaon Surapannatti, 9 000 granthas (JRK 452). Tika on Candapannatti 9 500 granthas (JRK 118). Printed. SuraP.1919. Editions: 1918 Suryaprajnapti sutra / Amolaka Rsiji Maharaja ksta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918. 400 p. ; 13 x 23 cm. Contents: (Donor details). Surya Prajnapti sutra ki visayanukramanika 3-5.-Surya Prajnapti sutra ki prastavana. 1-2. [Publisher and donor announcements 3-6). Saptamaupanga-Suryaprajnapti sutra 1-400. "Prata 1000." LD 11 900 1919 Srimanmalayagiryacaryavihitavivaranayutam Srisuryaprajnaptyupangam. 4, [1], 297 [ie. 8, [2], 594) p. ; 12 x 26 cm. Mehesana: Agamodayasamiti, Virasamvat 2445. Vikramasamvat 1975. Kraista 1919. [Agamodaya Samiti series, no. 24). Contents: (Donor details 1a-4a.-Prabhrtaprabhfta-visayanukramayutah Prabhstavisayanukramah 46-50.- Text] 1a-297b. Edited by S. V. Surchand (Kohl 1937a, viii n3). LD 16 111 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie ; [sutthuruvena] Pupphabhikkhuna sampadio. 1. avrtti. Gudagaiva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354.2 v. ; 19 cm. Candapannatti v. 2:[673)-754. ANU BL1310.58 1954 2 v. 1973 Sricandraprajnaptisutram/Ghasilalaji Maharaja-viracitaya-Candrajnaptiprakasikakhyaya vyakhyaya samalankrtam ; niyojakah Kanhaiyalala. 1. avsttih. Rajakota, Saurastra : Sri Askhila). Bha rata. Svestambara Stha nakavasi). Jainasastroddhara Samiti, Vira samvat 2499: Vikrama samvat 2029 : Isvi san 1973. 8, 715 p. ; 5 leaves of ports. ; 25 cm. "Prati 1200." (t.p) "Prati 1000" (reverse of t.p.). Contains only mula, Sanskrit chaya and Sanskrit 'vyakhya', ie. no translations. Reprint 1995. ANU NBC 2 118 234 1981-82 Sri-Surya prajnaptisutram / Ghasilalaji-Maharaja viracitaya Prameyabodhinyakhyaya vyakhyaya samalankrta Hindi-Gurjara-bhasa'nuvadasahitam; niyojakah Srikanhaiyalalaji 1 Asya niryuktir abhut purvam sribhadrabahusuriksta / kalidosat sa nesad vyacakse kevalam sutram // (SuraP. 1987-89:2, 35 n.2 = 65 n.1 (Ist group)). 2 He mentions the views of earlier teachers in his commentary: tadevam yatha purvacaryair idam eva purvasutram avalambya parvavisayam (?) vyakhyanam kytam tatha maya vineyajananugrahuya svamatyanusarenopadarsitam //(SuraP.1987-89:2, 35n3 = 65n2 (1st group)).
Page #160
--------------------------------------------------------------------------
________________ Upangas Maharajah. Ahmadabada : A[khila). Bha[rata). Svestambara Stha[nakavasi). Jainasastroddhara Samiti, Vira samvat 2508. Vikrama samvat 2038 : Isvi san 1981-82. 2 v. ; 25 cm. v. 1: 4, 1064 p. ; 5 leaves of ports.--v. 2: 1982. 1, 1100. "Prata 1200." RW 1987-89 Uvangasuttani/ sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2044-45. I[svi san). 1987-89.2 v. ; 25 cm. Candapannatti. Surapannatti v.2, [589]-712. "Original text critically edited" (English title-page). SuraP. based on three MSS of the text, dated samvat 1570, samvat 1673 and 17th cent. samvat) plus one with the tika dated samvat 1574, all from the L. D. Institute, Ahmedabad, (described on p. 25 (1st group = p. 53-54). CandaP. based on one MS from the L. D. Institute dated samvat 1570, one from the "Order's MS Library, Ladnun" dated 1762 and one with Tabba from "Jaina Visva Bharati library" (described on p. 25-26 = 53-4 (1st group)). Forms v.4 (parts 1 and 2) of a complete edition of the Jaina Agama. ANU BL1312.5 1987 1989 *Suryaprajnapti-Candraprajnapti : Srutastha virapranita-Upargasutradvaya : mulapatha, prastavana tatha parisista yukta / sampadaka Kanhaiyalalaji "Kamala'; mukhya sampadaka Sobhacandra Bharilla. Byavara, Rajasthana : Sri Agama Prakasana-Samiti, (1989). 1. samskarana. 48, 248 p. ; 25 cm. (Jinagama-granthamala ; granthanka 29). Reprint. 1995. 1995a Suryaprajnapti-Candraprajnapti : Srutasthavirapranita-Upangasutradvaya : mulapatha, prastavana tatha parisista yukta/ sampadaka Kanhaiyalalaji 'Kamala'; mukhya sampadaka Sobhacandra Bharilla. Byavara, Rajasthana : Sri Agama Prakasana-Samiti, 2522 [1995]. 2. samskarana. 48, 248 p. ; 25 cm. (Jinagama-granthamala; granthanka 29). Contents: Prakasakiya (3).-Sampadakiya : Jyotisaganarajaprajnapti arthat Candraprajnapti aura Suryaprajnapti/Muni Kanhaiyalala "Kamala' 7-21.-Prastavana / Rudradeva Tripathi 22-41.-Visayanukrama 42-48.- Text of SuraP. and CandaP.][1]209.-Parisista [1.] Sri Surya-Candraprajnapti sutra ka ganita vibhaga [210)-238.-2. Suryaprajnaptisutra sutra 20 va 24. [239]-241.-Anadhyayakala [[Nandi.1966c, 7-9 se uddhrta) [242]-244. First printing 1989. RW Reprint of CandaP. 1973. Vira samvat 2552: Vikrama samvat 2052: Isvisan 1997.7,715 p.; 25 cm. RW 1995b Translations: Hindi: 1918 Amolaka Rsi (SuraP. 1918) Studies: Kapadia, Hiralal Rasikdas, (A note on CandaP.) Indian historical quarterly, 8 (2) 381-82. [BORI Cat. 17:1, 242] Kohl, Josef Friedrich. 1937a. Die Suryaprajnapti und ihr textgeschichtliches Verhaltnis zur Jambudvipaprajnapti nebst einem Spezimen. (Teildruck). Bonn, 1937. xlii, 18 p. ; 24 cm. Bonn, Phil. Diss. 1937. A portion only of the dissertation. ANU PAMPHLET PK5003.A8K6 . 1937b. Die Suryaprajnapti: Versuch einer Textgeschichte. Stuttgart : Kohlhammer, 1937. xliv, 112 p. (Bonner Orientalistischen Studien; Heft 20). Review.Walther Schubring. Die Suryaprajnapti OLZ41 (1938) 562-64. Reprinted Kleine Schriften 455-56. Review. Ludwig Alsdorf DLZ 60 (1939) 729-32. [Alsdorf Kleine Schriften 1974, xiv] 140
Page #161
--------------------------------------------------------------------------
________________ 2.6 Surapannatti and Candapannatti Leumann, Ernst. 1883. * [In Verhandlungen, Transactions, Actes of the Oriental Congress, 6, Leiden 1883, 3:2, 490 ff.] [Winternitz 1933:2, 457nl] Sham Shastri, R. Journal of the Mythic Society 15, 138; 16, 201; 18, 32. "gives a brief translation of the Sutra at places mentioned above." [JRK 452] Thibaut, G. 1880. *On the Suryaprajnapti, Journal of the Asiatic Society of Bengal 49 (1880) 107-27, 181-206. Barthes. Oeuvres 1, 394n1; Guerinot 1906 $236] Weber, Albrecht. 1886. Ueber den auf der Kon. Bibl. zu Berlin befindlichen Codex der Suryaprajnapti (ms.or.oct. 155), Indische Studien 10 (1868) 254-316. (Reprint. Hildesheim : Georg Olms. 1973.] "Gelesen in der Berliner Academie der Wissenschaften 22. Nov. 1866." "Etude sur un manuscrit de la bibliotheque royale de Berlin contenant, non pas le texte meme de la Suryaprajnapti, mais le commentaire sanskrit de Malayagiri sur cet ouvrage. / Generalites sur la Suryaprajnapti. C'est une oeuvre astronomique de fantaisie plutot que d'observation./ Analyse detaillee des 20 livres que constituent l'ouvrage, et particulierement des livres I (8 chapitres), II (3 ch.) et X (22 ch.)" (Guerinot 1906 $235). Indexes: 1987-89 (SuraP. 1987-89 and CandaP. 1987-89): Pannav., Jambuddi., SuraP., CandaP., and Niraya. indexed together in Uvangasuttani part 2 (ie. v.4, pt.2): Parisista 3. (sic) (Saddasuci] [8071- 1093.-[Corrections to Sabdakosa (1097)-1100. 141
Page #162
--------------------------------------------------------------------------
________________ 142
Page #163
--------------------------------------------------------------------------
________________ (Niraya Su.) Content: Accounts of lives showing the relationship between actions and their outcomes, in some cases breaches of monastic discipline and their result. Five sections: Nirayavaliyao (Niraya); Kappiya or Kappavadimsiyao (Kappi.); Pupphiyao (Pu.); Pupphaculao (PuCu.); Vanhidasao (VaD).1 Reference: Winternitz 1933:2, 457-58; JRK 213; BORI Cat. 17:1, 245-57; Schubring 1935 SS48.8; JSBI 2, 129-38. Exegesis. 1 2 3 4 Editions:2 1885 2.8-12 NIRAYAVALIYASUYAKKHANDHA 1918 1922 Sricandra, pupil of Dhanesvara, pupil of Silabhadra, Tika, composed in samvat 1228 [1171], 605, 650, 737 or 637 granthas (JRK 213). Printed. NirayaSu. 1885; 1922; 1934; 1938. Translated into Gujarati NirayaSu.1933 or 1934. Tabba, 1100 granthas, (BORI Cat. 17:1, 252-53). Is this the same as the tabba by Dharmasi = Dharmasimha cited in NirayaSu. 1987-89 (p. 36)? Paryaya, (BORI Cat. 17:1, 254), attributed to Candrakirti in one prasasti from Khambhat (samvat 1212) but there may be different works with the same name (Punyavijaya, Prastavana Nandi. 1966b, 10-12). The BORI manuscript contains a short text entirely extracted from Sricandra's work listed above. Balavabodha, (BORI Cat. 17:1, 254-56). Nirayavaliya sutra prarambhah : bhaga 19 Kappiya, 20 Kappavidamsiya 21 Pupphiya, 22 Pupphacula, 23 Banhidasa / Sri Ganadhara Sudharma Svami sankalita sutra, tadupari Candra Suri krta Samskrta tika ; Sadaranga krta bhasa tika yuta; Pandita Visvanatha ji se samsodhita. 1. daphe. Banarasa : Jaina Prabhakara Presa, samvat 1941. San 1885 Isavi. 85 [ie. 170] p. ; 13 x 31 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha; 19-23). "500 Jainabuk Susaiti se, 500 Raya Dhanapatisimha Ba[hadur se]." "1000 pustakai" LD 13 717 Niriyavalikadi panca sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918. 180 p. ; 13 x 23 cm. "Prata 1000." ANU IN PROCESS March 1997 Srinir[a]yavalikasutram/ Sricandrasuriviracitavrttiyutam; Danavijayaganibhih samsodhitam. Amadavada (rajanagara)madhye [Ahmedabad]: Rajanagarastha Srivirasamajah, Virasamvat 2448. Vikramasamvat 1979. San 1922. 42 [ie. 84] p.; 12 x 26 cm. (Srivirasamajagrantharatnam; 2). Printed: "Yuniyanaprintingapre samadhye." Although this edition says nothing about its sources, it does give a dozen or so variants for both the mula and the cty. In one instance the textual notes on the mula cite sources 'a, ka, ca' (34b). Similarly: ... iti va pathah (1b); pra[tyantare] (5b, 26a, 27a, 31a, 38a); ... bahusvadarsesu drsyate (37a). Deleu adds that "this edition... is, even more than the other Agamodaya-Samiti editions uncritical and full of inaccuracies" (1969, 78). ANU PAMPHLET BL1312.6.N57 1922 The BORI copy has an identical title-page except for the publication statement: 1 Sanskrit forms would be: Nirayavali, Kalpavatamsikah, Puspikah, Puspaculikah, Vrsnidasah. 2 An edition by Atmaramaji was listed in Nandi. 1966c (19 (1st group)). I have not, however, traced any other details. This may have been a first edition of what is listed below as *NirayaSu.1994.
Page #164
--------------------------------------------------------------------------
________________ Upangas 1932 "Prakasayitri Sriagamodayasamitih. Pratayah 750." This explains why some cite it as and Agamodaya Samiti edition and some do not. BORI The Nirayavaliyao = Nirayavaliyao: the last five Upangas of the Jain Canon / edited with introduction, glossary, notes and appendices by P. L. Vaidya. Poona : Ganesh Printing Works, 1932. xv, 191 p. ; 19 cm. Contents: Introduction [v]-xiv.-Suddhipatram (xv).-Nirayavaliyao [1]-76.-1. parisistam. Varmakadivistarah [77]-93.-2. Mahabalajanmadivarnanam [95)-111.Sabdakosah (113)-168.-Notes (169)-191. Prepared as a textbook for courses at Bombay University (Introduction, p.v). Used NirayaSu.1885; 1922 and Niraya. partial edition.1879, two MSS of the text, six of the commentary and one avacuri in Old Marwari, all from the Bhandarkar Institute, Pune. A first attempt at a critical edition, with an (uncritical) treatment of the java-abbreviations (Appendix I) and the text of the Mahabala episode of the Viyahapannatti 11,11 (Appendix II) (Deleu, NirayaSu. 1969, 78). ANU MICROFILM BL1312.6.N574E6 1932 1933 or 1934 Sri Parvacaryapranita Nirayavalika sutra : mula ane mulana tatha tikana arthasahita. Bhavanagara : Sri Jainadharma Prasaraka Sabha, Vira samvat 2460 [1934). Vikrama samvat 1990 [1933]. 9, 121 [ie. 18, 242] p. ; 12 x 27 cm. Contents: Anukramanika lb.-Prastavana (Gujarati]/Kumvaraji Anandaji 2a-9b.-Sri Nirayavalika sutram : mula tatha mula ane tikanum [Gujarati] bhasantara la-121b (does not give the text of the cty, the text however seems to follow NirayaSu.1922). LD 13 628 1934 The Niravaliyao, the last five Upangas of the Jain canon = Niggam thapavayanesu (sic), carimapancovangabhuyao Nirayavaliyao: edited with introduction, translation, notes, glossary appendices and critical foot-notes / by A[mritlal]. S[avchand). Gopani and V. J. Chokshi. Ahmedabad : Gurjar Granth Ratna Karyalaya, 1934. xvi, 152, 140, 39, 55 p.; 16 cm. (Prakrta granthamala ; no. 4). Contents: Foreword / K. V. Abhyankar v-vi.--Introduction [vii]-xvi.--Nirayavaliyo [11-152.- Translation[1]-140.-Sricandra's ctyl (1-39.--Glossary [1-55. Published in two different?] versions, "cloth" and "with Sanskrit Tika" (Listing of Gurjar Grantharatna Karyalaya's "Prakstagranthamala' on last page of Antag. 1932). LD 2669 1938 Srinirayavalika sutram / Sricandrasuriviracitavrttisahitam / [edited by Vijayaniti Suri). Ahmadavada : Jaina pustakalaya, I. sa. 1938. Samvat 1994.42 [ie. 84 p. ; 12 x 25 cm. Four pages of plates of Vijayanitisuri and Sampadvijayaji and a donor. "An almost identical reprint of the Agamodaya-Samiti [1922] edition (Dana vijaya)." "Printing errors are corrected once in a while (sihasanamsi 37a6 instead of sihanasanamsi), but wrong readings remained (Jambu37a7 instead of Goyama); also new mistakes have crept into the text (lesehi 27b9 instead of kusehi)" (Deleu NirayaSu.1969, 78). "Pratayah 1000." LD Pa. 8817 and Pa. 8818 1948 Sri Nirayavalikasutram : Hindigurjarabhasanuvadasahitam/Ghasrlalaji Maharaja-viracita Sundarabodhinitikasamalankstam ; niyojakau Munisri Samiramallaji Maharajah; Munisri Kanhaiyalalaji Maharajas ca. Rajakota, Saurastra : Sri Svestambara). Stha[nakavasi). Jainasastroddharakasamiti, Vira samvat 2494 [1948). 1 plate of portraits : 20,455 p. ; 25 cm. Reprint. 1960. ANU PK5003.A53N58 1948 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie ; (sutthuruvena) Pupphabhikkhuna sampadio. 1. avstti. Gudagamva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354.2 v. ; 19 cm. Nirayavaliyao v. 2, (755)-772.-Pupphiyo [773]-788.--Pupphaculiyao (789)-791.Vanhidasao (792)-796. ANU BL1310.58 1954 2 v. 144
Page #165
--------------------------------------------------------------------------
________________ 1960 1969 1975 1978 1985 2.8-12 Nirayavaliyasuyakkhandha Sri Nirayavalikasutram = Niriyavalikasutram : Hindigurjarabhasanuvadasahitam/Ghasilalaji Maharaja-viracita-Sundarabodhinitikasamalankrtam; niyojakah Srikanhaiyalalaja Maharajah. Rajakota, Saurastra: A[khila] Bha[rata]. Sve[tambara] Stha[nakavasi]. Jainasastroddhara-Samiti, Vira samvat 2486. Isvisan 1960. Vikramasamvat 2013. 2, 8, 44 [=list of donors], 374 p. ; 25 cm. Reprint of Niraya. 1948. RW Jozef Deleu. Nirayavaliyasuyakkhandha: Uvanga's 8-12 van de jaina canon, Orientalia Gandensia 4 (1969) [77]-150. Contents: Inleiding [including key to the java passages] [77]-95.-Nirayavaliyasuyakkhandha [original text with notes] 96-143.-Varianten 144-45.- Woordenlijst 146.-Eigennamen 147-48.-Summary. 149-50. Critical edition of the text based solely on printed editions (NirayaSu.1885; 1922: 1932; 1953-54; Niraya.partial edition. 1879). Introduction and notes in Dutch, list of sources for java abbreviations, two pages of variants, an index of unusual words and one of proper names. Translation. 1996. Nirayavaliyasuyakkhandha: Uvangas 8-12 of the Jain canon : introduction, text-edition and notes: translated from the Dutch by / J. W. de Jong and Royce Wiles. Tokyo: The Chuo Academic Research Institute, 1996. 86 p.; 30 cm. (Philologica Asiatica : Monograph series; 10). Contents: Preface 7.-Bibliography 9-15.-List of alterations 16-18.-Abbreviations 18. Introduction [19]-36.-Nirayavaliya-suyakkhandha [37]-81.-Word list [83].-- Proper names [84]. Summary [85]-86. Review: Nalini Balbir 13-14 (1995-96) 546-47. ela Sri Nirayavalika-sutra : Vasanta tika samalankrta / vivecaka Munisri Bhagavatilala ji Maharaja 'Nirmala.' Udayapura, Rajasthana: Sri Varddhamana Jaina Jnanapitha, Virabda 2500 [1975]. 18, 288 p. ; 1 leaf of plates. ; ill. 22 cm. (Varddhamana Jaina Jnanapitha ; pushpa nam. 8). No mention of MSS in the introductory essays, text seems to be based on Vaidya's (1932) (Intro. p. 14-15). The earlier Hindi translations of Amolaka Rsi (1918) and Phulacandra (ie. Nirayasu. Hindi translation.1959) are mentioned in a footnote (p. 15) but it is not clear whether they have been used by Muni Bhagavatilala. ANU PK5003.A53N58 1975 *Sri Agama-sudha-sindhu/sampadakah samsodhakas ca Jinendravijaya Gani. LakhabavalaSantipuri, Saurastra. Srijambudvipaprajnapti-Sricandraprajnapti-Srisuryaprajnapti Srimadupangapancatmaka-Srinirayavalikakhyopangastakatmakah 7. vibhagah. 26, 504 p.: (Sri Harsapuspamrta Jaina granthamala ; 74). [Universitat Tubingen library catalogue] Nirayavalikasutra: Kappiya, Kappavadimsiya, Pupphiya, Pupphacaliya, Vanhidasa / anuvadaka-sampadaka Devakumara Sastri; mukhya sampadaka Sobhacandra Bharilla. Byavara, Rajasthana: Sri Agamaprakasana Samiti, Viranirvana samvat 2511 [1985]. 31, 144 p. ; 26 cm. (Jinagama-granthamala ; granthanka 21). ANU BL1312.6.N573 1985 1987-89 Uvangasuttani / sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana: Jaina Visva Bharati, Vikrama samvat 2044-45. I[svi san]. 1987-89. 2 v. ; 25 cm. "Original text critically edited" (English title-page). (1) 'Ka.' (photoprint) of a 25 folio palmleaf MS in the Jaisalmer bhandara (Jaisalmer catalogue of Punyavijaya no. 32(5), the text preceding is dated samvat 1412); (2) 'Kha.' an undated MS in the Sricanda Ganesadasa Gadhaiya Pustakalaya, Saradarasahara, estimated to be from the 16th cent. samvat; (3) 'Ga.' MS of a tabba / tabo (p. 26, 55) by Dharmsi = Dharmasimha (p. 36), Jain Visvabharati manuscript library, Ladanum, dated 1833; (4) 'Vr.' a MS of the cty from Sricanda Ganesadasa Gadhaiya Pustakalaya, Saradarasahara, dated samvat 1575 [1518]; (5) 'MuVr.' the text of the cty as printed in NirayaSu. 1934. (Described on p. 26 = 145
Page #166
--------------------------------------------------------------------------
________________ Upangas 54-55, Uvangasuttani, khanda 2, 1st group). Forms v. 4 (parts 1 and 2) of a complete edition of the Jaina Agama. Nirayavaliyao. Kappavadimsiyao. Pupphiyao. Pupphaculiyao. Vanhidasao. [713]-785. ANU BL1312.5 1987 1994a *Niryavalika sutram : Kappiya, Kappavandisiya, Pupphiya, Pupphaculiya, Vanhidasa = Neryavalika sutra : Kappia, Kappavadinsia, Pupphia, Pupphachulia, Vahnidasa / tikakara Atmarama ; mukhya sampadaka Svarna Kanta ; sampadaka-mandala Smrti ... [et al.] ; prabandha sampadaka Purusottama Jaina, Ravindra Jaina. Sangrura, Panjaba : Paccisavim Mahavira Nirvana Satabdi Samyojika Samiti, 1994. 54, 372,20 p. ; 25 cm. [Univ.of California library catalogue] Includes Prakrit text with Hindi-Sanskrit commentary and translation. 1994b 1995 Reprint of NirayaSu.1985. Contents: Dvitiya-samskarana-prakasana ke artha sahayogi ... [6-7).-Prakasakiya [8]-- Adi-vacana / Muni Misrimala "Madhukara" (Yuvacarya) 9-12.-Nirayavalika : eka samiknatmaka adhyayana / Devendramuni Sastri, Madanaganja, 6.11.83 [13]-33. Visayanukrama 35-38.--Nirayavaliyao [text with translation] 1-113.-Parisista 1. Mahabalacaritram Viy.XI.11] [114]-130.-2. Drdhapratijna :(sambaddha amsa) [from RayPa.] [131]-135.-Vyaktinama-suci [136]-37.-Anadhyayakala [[Nandi.1966c, 7 9] se uddhita] [138]-140.-Donor list [141]-144. 45 Agamasuttani/samsohaya-sampayaga Muni Diparatnasagara. Badodara: Agama Sruta Prakasana, 1996. 2052 (1995). 45 v. ; 22 cm. 19. Nirayavaliyanam. 1-4, 8,5-8 p. ANU NBC 2 118 409 Translation of Jozef Deleu's introduction etc., see NirayaSu.1969 above. Nirayavalikadi-sutra : Kappavadimsiya, Pupphiya, Pupphaculiya, Vanhidasa: mula-matra gutaka / sampadaka Kanhaiyalalaji Ma. 'Kamala'; saha sampadaka Rupendrakumara Pagariya. Amadabada : Agama Anuyoga Trasta, 1996. [2], 8, 172 p. ; 15 cm. Contents: Prakasakiya (1-2).-Prak-kathana/ Rupendrakumara Pagariya 1-8.Nirayavaliyao 1-172. Rupendrakumara Pagariya has "edited" the text at the instigation of Muni Kanhaiyalala. Use of NirayaSu.1985 and NirayaSu.1987-89 acknowledged (Prakasakiya [2]). RW 1996 1996 Partial editions: Nirayavaliya 1879 Nirayavaliyasuttam, een Upanga der Jaina's : met inleiding, aanteekeningen en glossaar/ van S. Warren. Amsterdam : Koninklijke Akademie van Wetenschappen te Amsterdam, 1879. 4, 36 sie. 33), 24 p. ; 30 cm. (Verhandelingen der Koninklijke Akademie van Wetenschappen, Afdeling Letterkunde ; 12. 2). S. J. Warren's edition of Uvanga 8, the Nirayavaliyao, appeared in the same year as Hermann Jacobi's edition of the Kalpasutra and so was one of the earliest Jaina texts printed in Europe. Warren used four MSS, two from the 'koninklijke bibliotheek te Berlin (A,B) and two from Jacobi's collection (C, D): C being taken as the base and variants from the others added (Inleiding p.1). He seems not to have used Sricandra's cty, although, as Jacobi remarks in his review (p. 182), two MSS of it were known to be in the same Berlin library. Review. Hermann Jacobi ZDMG 34 (1880) 178-83. In his review (p. 178-79), Jacobi draws attention to the numerous abbreviations in the text: (i) those with the words vannao, navaram; (ii) those with references indicating other texts, as in jaha Citte, jaha Mehassa; (iii) those citing an initial word, e.g. mahata; (iv) those using java; (v) finally, those using a key-word, e.g. Punnabhadda-ceie. He further states that because these abbreviated passages occur in their full forms in the earlier 146
Page #167
--------------------------------------------------------------------------
________________ Translations: English: 1934 Gopani and Chokshi (NirayaSu.1934) Gujarati: 1933 or 1934 (NirayaSu.1946) 1948 Hindi: 1918 1948 1959 1975 1985 1994 Angas and Upangas the Nirayavaliya was not amongst the first written down in the redaction of the Siddhanta by Devarddhiganin, so it is naturally full of references to earlier sutras. But most of the review deals with the need to standardize the orthography of Jaina-Prakrit MSS rather than to present the orthography found in the MSS (p. 180182). Jacobi also adds a number of corrections. Warren's edition is mentioned by Vaidya (1932) and Deleu (1969) as a source for their editions of this text and it is cited in Pischel's grammar of Prakrit languages (1900). ANU LARGE PAMPHLET PK5003.A53N58 1879 Ghasilala (Nirayasu.1948) Indexes: 1932 1934 1969 Amolaka Rsi (NirayaSu.1919) Ghasilala (Nirayasu.1948) 2.8-12 Nirayavaliyasuyakkhandha Srinirayavalika-pancaka-sutra-Hindi/anuvadaka Srivadilala Motilala Saha. 1. samskarana. Gudagamva-Kenta: Srisutragamaprakasasamiti, Srimahavira samvat 2487. Vikramabda 2016. Kraista san 1959. 72 p.; 18 cm. Contents: Prakasakiya [2].-Bhumika [3]-10.-Nirdarsana / Durgaprasada Jain [11]15. Visayanukrama [16].-Niryavalika [1]-58.-Parisista [Notes on Mahasilakantaka sangrama, Gunasilaka 'udyana' etc.] 58-71. Translation based on Suttagame text (1953-54). "1000 [copies]." Bhagavatilala (NirayaSu.1975) Devakumara Sastri (Nirayasu. 1985) Atmarama (NirayaSu.1994a) Studies: Deleu, Jozef. 1969. See NirayaSu. 1969 [translated into English 1996]. Dixit, K. K. 1978. The five Anga texts of the form of a story-collection [Naya., Uvas., Antag., Anuttaro., Viva.] In, Early Jainism. Ahmedabad: L. D. Institute of Indology, 1978. 8, 99 p. ; 25 cm. (LD series; 64), p.[62]-75. The comments include the Nirayavaliyasuyakkhandha stories. LD kha. 6221 147 ANU BL1351.2 .D53 P. L. Vaidya (NirayaSu.1932) A. S. Gopani and V. J. Chokshi (NirayaSu. 1932): Glossary p. [1]-55 (fourth group). Jozef. Deleu (NirayaSu. 1969 [ = 1996] 1987-89 (NirayaSu.1987-89): Pannav., Jambuddi., SuraP., CandaP., and NirayaSu. indexed together in Uvangasuttani part 2 (ie. v.4, pt.2): Parisista 3. [sic] [Saddasuci] [807]-1093.-[Corrections to] Sabdakosa [1097]-1100.
Page #168
--------------------------------------------------------------------------
________________ Upangas 148
Page #169
--------------------------------------------------------------------------
________________ 3 PAINNAS PRAKIRNAKAS (Skt)' The group of miscellaneous texts. In spite of occasional earlier editions, the publication by Punyavijaya and Amrtlal Bhojak of two volumes of a collected edition from 1984 onwards marked a major step forward in the availability of many of these texts, some of which had not been published until then. The full bibliographic description and analysis of this important edition is given first below, and abbreviated reference only is made to it in the subsequent bibliographies, ie. it is referred to as Painnayasuttaim JAS 17 (Part II). References: Schubring $50; BORI Cat. 17:1, 257-390; Winternitz 1933:2, 458-61. Studies: Caillat, Colette. 1977. *Fasting unto death according to Ayaranga-sutta and to some Painnayas. In, Mahavira and his teachings / editorial board A. N. Upadhye, Nathmal Tatia (et all. Bombay: Bhagavan Mahavira 2500th Nirvana Mahotsava Samiti, 1977. iv, 462 p. ; 25 cm.; p. 113-17. ANU BL1371.M3 Kamptz. Kurt von. 1929. Uber die vom Sterbefasten handelnden alteren Painna des Jaina-Kanons. Diss. Hamburg 1929. 39 p. Hamburg, Phil. Diss. 1929 [1930). (Schubring 1935 $50; Janert 1961, 65) Review Charlotte Krause. ZII 7 (1929) 271-73. "[A] masterly dissertation" (Colette Caillat. Interpolations in a Jain pamphlet or, the emergence of one more Aturapratyakhyana. WZKS 36 (1992) 35 44). *Prakirnaka sahitya : manana aura mimamsa / sampadaka Sagaramala Jaina, Suresa Sisodiya. Samskarana 1. Udayapura, Rajasthana : Agama, Ahimsa-Samata evam Praksta Samsthana, 1995. 8, 262 p., [3] folded pages ; 22 cm. (Agama Samsthana granthamala ; 14). [DK-5758. DK listing Recent Sanskrit, Prakrit and Pali publications from India, CIR -1721 / 1997-98, item 33] "In Prakrit; translation in Hindi; 3 articles in English. Study, with text, of the Jaina Painnaga (Prakirnaka) literature" (DK listing). General editions: 1984 <1987> Painnayasuttaim: Vivihatherabhadanta viraiyaim / sampadakau Punyavijayo Munih. Mohanalalatmajah Pandita-Amstalala-Bhojakas ca. 1. samskarana. Bambai: Sri Mahavira Jaina Vidyalaya, Vira sam. 2510_<2513> [1984 <1987>). <2> v. ; 25 cm. (Jaina-Agamagranthamala; no. 17). Part 1. Vir. sam. 2510 [1984], 136, 20, 530 p. Part 2. Vir. sam. 2513 [1987], 52, 372 p. Contents v. 1: Prastavana (Gujarati]p. 20-68 = Introduction p. 75-136/Amritlal Mohanlal Bhojak. -- 'Sudhipattayaviseso'p. 69-70, [continued on pages 525-30 and in part 2 below, p. 24-25)-- Cattarimangallasuttam - 1. Devindatthao-Siriisivaliyatheravario 3-34. - 2. Tandulaveyaliyapainnayam 35-62. 3. Candavejjhayam painnayam 63-89. 4. Ganivijjapainnayam 90-98. -5. Maranavibhattipainnayam - Maranasamahi'avaranamam 99-159. 6. Aurapaccakkhanam (1) 160-63. - 7. Mahapaccakkhanapainnayam 164-79. Isibhasiyanam sangahani 178. Isibhasitaatthahigarasangahani 180. IIIIII 1 I have not had time to check the multiple titles "Arahana-"etc. individually in each of the editions available at the ANU, so the list here is provisional. Minor Prakirakas have not yet been explored, neither in BORI Cat, CLIO nor JRK. I cannot be sure of the contents of *Vividh Payannavacuri. Jamnagar, 1912 (Schubring 1935 $50). The Library of Congress catalogue entry says Part 3 was published in 1989, but I have not been able to confirm that.
Page #170
--------------------------------------------------------------------------
________________ Painnas / Prakirnakas -8. Isibhasiyaim-Siripatteyabuddhabhasiyaim 181-256. -9. Divasagarapannattisangahanigahao 257-79. - 10. Samtharagapainnayam 280-91. - 11. Viratthao 292-97. - 12. Kusalamubandhiajjhayanam-'Causaranapainnayam'avaranamayam Sirivirabhaddayariyaviraiyam ca 298-304. - 13. Aurapaccakkhanam [2] 305-308. -- 14. Causaranapainnayam 309-11. - 15. Bhattaparinnapainnayam - Sirivirabhaddayariyaviraiyam 312-28. - 16. Aurapaccakkhanapainnayam - Sirivirabhaddayariyaviraiyam 329-36. - 17. Gacchayarapainnayam 337-49. - 18. Saravalipainnayam 350-60. - 19. Joisakaramdagam Painnayam-therabhadantasiripalittayariyaviraiyam 361-408. - 20. Titthogalipainnayam 408-523. The English introduction (p. 91-134) contains varied summaries and comments on each of the texts in this volume. Contents v.2: Prastavana p. 13-21 = Introduction p. 27-38 / Amritlal Mohanlal Bhojak. (Suddhipattayam p. 22-23.) - 1. Painayariyaviriya Arahanapadaya = Pracinacaryaviracita Aradhanapataka 1-84. - 2. Sirivirabhaddayariyaviraiya Arahanapadaya = Srivirabhadracaryaviracita Aradhanapataka 85-168. - 3. Arahanasara'avaranama Pajjamtarahana = 'Aradhanasara 'aparanamni Paryantaradhana 169-92. -4. Arahanapanagam = Aradhanapancakam 193-223. - 5. Siriabhayadevasuripaniyam Arahanapayaranam = Sriabhayadevasuripranitam aradhanaprakaranam 224-31. -6. Jinaseharasavayam pai Sulasasavayakaraviya Arahana = Jinasekharasravakam prati Sulasasravakakarapita' radhana 232-39. - 7. Nandanamunyaradhita Aradhana 240-43. -8. Arahanakulayam = Aradhanakulakam 244. - 9. Micchadukkadakulayam [1] = Mithyaduhkrtakulakam [1]. 245-46. - 10. Micchaukkadakulayam [2] = Mithyaduhkstakulakam [2]. 247-48. - 11. Aloyanakulayam = Alocanakulakam 249-50. - 12. Appavisohikulayam = Atmavisodhikulakam 251-53. ANU BL1312.8 1984 v.1, v.2 150
Page #171
--------------------------------------------------------------------------
________________ 3.1 Arahanapadaya (ArahPad) / Painayariya "cf. Jaina hitaisi 14:76-77" ("Aradhanapataka II' JRK 33). BORI Cat. 17:1, 257-390. 1984<<1987> Arahanapadaga, Painnayasuttaim JAS 17 (Part II), p. 1-84. Edited by Punyavijayaji on the basis of one palm leaf and five paper manuscripts, the oldest being c. 14th cent. Vikram (A. M. Bhojak, v. 2 Introduction 31-32). 3.2 Arahanapadaya (ArahPad(V) / Virabhadra 990 gathas, composed samvat 1078, "cf. Jaina hitaisi 14:76-77" ("Aradhanapataka I' JRK 32-33). 1984 <1987> Arahanapadaga, Painnayasuttaim JAS 17 (Part II), p. 85-168. Edition based on three paper manuscripts, the oldest dated Vikram 1464 (English Intro duction, 33). 3.3 Arahanasara (= Pajjantarahana) / author Somasuri? Over 70 gathas (JRK 32a VII'). Exegesis: 3.1 Vinayavijaya Gani, Tika (JRK 32a VII'). Vinayasundara Gani, Tika (JRK 32a 'VII'). 3.3 Balavabodha (BORI Cat. 17:1, 360). Editions: 1905 *Payanna sangraha : bhaga 1 lo. Amadavada : Sa. Balabhai Kakalabhai, samvat 1962[1905). f. 77, 12; 13 x 23 cm. Contents: Bhattap., f.1-25b.-Caus., 26a-35b.--Mahapace., 36a-55b.- Aurapacc., 56a67b.- Aradhanaprakarana of Somasuri, 68a-77b.-Atmabhavana (Gujarati) of Buddhisagara 1-6b.- Paramanananda pacisi (25 Sanskrit slokas) 7a-12b. [Schubring 1935 950; JRK 25] 1984 <1987> Arahanasara / Pajjantarahana, Painnayasuttaim JAS 17 (Part II), p. 169-92. Edition based on three paper manuscripts, the oldest dated Vikram 1464. [English Introduction 33] Aurapaccakkhana (Aura Pacc.) I, II Aura-paccakkhana, 'the sick one's refusal' (of the pleasures of life), (Winternitz 1933:2, 459). 84 gathas (Aturaprakhyakhyanaprakirnaka' JRK 25); 100 granthas (Schubring 1944. 25-26). 3.4 Title: Aturapratyakhyana (Skt). Exegesis: 4.1 Gunaratna Suri, Vivarana/Avacuri (JRK 25-26; Schubring 1944, 21). Dharmaghosa Suri, Avacuri = next? (JRK 25-26). Bhuvanatunga, pupil of Mahendra Suri, pupil of Dharmaghosa Suri, Avacuri 420 granthas, 850 slokas (JRK 25-26; BORI Cat. 17:1, 276). Mahendra, pupil of Dharmaghosa Avacuri (= above?) (JRK 25-26). Somasundara Suri, of Tapa Gaccha? Tika based on Bhuvantunga's Avacuri (JRK 25-26). Hemacandra Gani, Tika, 700 granthas (JRK 25-26). Avacuri (JRK 25-26). Tabba (BORI Cat. 17:1, 276). 4.9 Aksarartha, (BORI Cat. 17:1, 279) Editions: 1886 *Atha Dasapayanna mula sutra prarambhah / Ganadhara Sudharma Svami sankalitamula sutra ; Tandulavayali 24, Devinddastava 25, Ganivijja 26, Causarana 27, Santhara 28, Aurapaccarakana 29, Bhattaparijnana 30, Candravijja 31, Mahapaccarakana 32, Maranavibhatti 151
Page #172
--------------------------------------------------------------------------
________________ Painnas/Prakirnakas 1900 1902 1905 1907 1927 33; Pratapaji karake samsondhita [sic]. Banarasa : Jaina Prabhakara Presa, Samvat 1942. [Isavi] 1886. 73 [i.c. 146] p.; 13 x 32 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 24-33). [Univ. of Chicago Library catalogue] "Edition collective des dix painnas, avec commentaire et gloses" (Guerinot 1906 $239). "[E]asily the worst text ever printed in India-so hopelessly faulty that large portions remain wholly unintelligible" (Alsdorf 1966 Utt. study 207n1). "[L]e text ... est tres corrompu, pratiquement incomprehensible sans le secours des manuscrits ou d'autres editions. Consulte a la lumiere de ces derniers, il fournit des indications utiles, confirme telle tradition ou telle interpretation" (Caillat, Cand. 1971, 19). *[Causarana and Aurapaccakkhana with other texts.] Ahmedabad, samvat 1957 [1900]. [Schubring 1935 $75] 1960z *Causarana tatha Aurapaccakkhana Payannanum. Ahmadabad, 1902. [Guerinot 1909 SS1027] "Texte des deux premiers prakirnakas, avec une glose verbale en sanskrit, une traduction en guzerati et un commentaire egalement en guzerati. / A la suite, le Gunasthanakramaroha de Ratnasekhara et le Tattvarthasutra d'Umasvati." 1923 or 1924 Sri Causarana, Aura paccakkhana, Bhaktaparijna Santharaga: cara payannano sangraha. Bhavanagara: Sri Jainadharmaprasaraka Sabha, Samvat 1980 [1923], Vira samvat 2450 [1924]. avrtti 2. 23 p.; 12 x 27 cm. Payanna sangraha: bhaga 1 lo. Amadavada: Sa. Balabhai Kakalabhai, samvat 1962 [1905]. f. 77, 12; 13 x 23 cm. [Schubring 1935 SS50; JRK 25] Contents: Bhattap., f.1-25b.-Caus., 26a-35b.-Mahapacc., 36a-55b.-Aurapacc., 56a67b. Aradhanaprakarana of Somasuri, 68a-77b.-Atmabhavana (Gujarati) of Buddhisagara 1-6b.-Paramanananda pacisi (25 Sanskrit slokas) 7a-12b. ANU BL1312.84.G8 1906 [sic] *Sri Causarana, Aurapaccakkhana, Bhaktaparijna, Santharaga : cara payannano sangraha. Bhavnagar: Jaina-dharma-prasaraka Sabha, samvat 1966 [1907]. 23 [ie. 46] p. [Winternitz 1933:2, 461n3; Schubring 1935 $50; JRK 25] Reprinted 1923 or 1924. Contents: [Gujarati] Prastavana attributes all these texts to Virabhadra. Causarana la4a.-Aura paccakkhana 4b-8b.-Bhattaparinna 9a-17a.-Santharaga 17b-23b. Reprint of 1907 editon. Printed: Bhavanagara: Ananda Printinga Presa. A number of variant readings are given for each text, no clear indication of sources. ANU PAMPHLET BL1312.83 1944 [sic] Srutasthavirasutritam Catuhsaranadimaranasamadhyantam Prakimnakadasakam chayayutam. Bomday [sic] Shree Agamoday Samiti, Vira sam. 2453. Vikrama sam. 1983. San 1927. [Agamodaya Samiti; 46]. Contents: CauSar. 1a-5a.-AuraPacc. 5a-10a.-MahaPacc. 10b-19a.-BhattaP. 19b31a. Tand. 31b-53a.-Samth. 53b-61a.-Gaccha. 61b-70b.-Gani Vi. 70b-75b.DevTha. 76a-96a.-Marana Vi. 96a-142b. BORI 3886/X.B. Jaina texts [Causarana payanna : artha sahita]. [1960s?] 208 p. ; 17 cm. Contents: Causarana payanna : [Gujarati] artha sahita 1-19.-Aura paccakkhana payanna: [Gujarati] artha sahita 20-42.-Sri Vajrapajjara stotram 43-44.-Sri Atmabhavana 44-53.-[a number of aradhanas and small stavanas in Gujarati (translated?) and other collections of stavanas, and minor texts 176-208, includes Sri Panca pratikramana sutra p. 135 onwards. Title-page missing, title is that of first work in book, purchased by ANU Library in 1973, estimated date of publication only. ANU BL1310.5.C38 1900z 1984-1987> Aurapaccakkhana I, II, Painnayasuttaim JAS 17 (Part I), p. 160-63, 305-308. [I] edition prepared by Punyavijayaji based on two manuscripts, one being Jaisalmer No. 152
Page #173
--------------------------------------------------------------------------
________________ 1326 (47) and one from the Jain Atmananda Sabha (English Introduction 84]; [II] edition prepared from some manuscript belonging to any one of the many Bhandaras in Jeslamer" by Punyavijaya (who died before this volume could be finalized], 34 gathas (English Introduction, p. 86. See also p. 102-103, 119). Translation, Gujarati: 1902 (AuraPacc. 1902) 3.5 Aurapaccakkhana (Aura Pacc.)/Virabhadra, 11th cent Vikram Not listed JRK? = NCC 2, 44a? Prose and verse (Bhojak 1984 edition, English Introduction p.121] 1984 <1987> Aurapaccakkhana III, Painnayasuttaim JAS 17 (Part I), p. 329-36. Edition based on seven manuscripts (the oldest being from the 13th cent. Vikram (English Introduction 86. See also p. 102-3, 121). Bhattaparinna (BhattaP.) / Virabhadra, 11th cent. Vikram ***The dispensing with food' in 172 Prakrit stanzas" (Winternitz 1933:2, 459). Title: Bhaktaparijna (Skt). Exegesis: Gunaratna Suri, Avacuri (JRK 287; Schubring 1944, 21). 3.6 Editions 1886 *Atha Dasapayanna mula sutra prarambhah / Ganadhara Sudharma Svami sankalitamula sutra ; Tandulavayali 24, Devinddastava 25, Ganivija 26, Causarana 27, Santhara 28, Aurapaccarakana 29, Bhattaparijnana 30, Candravijja 31, Mahapaccarakana 32, Maranavibhatti 33 ; Pratapaji karake samsondhita (sic). Banarasa : Jaina Prabhakara Presa, Samvat 1942. Isavi] 1886. 73 i.e. 146] p. ; 13 x 32 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 24-33). (Univ. of Chicago Library catalogue "Edition collective des dix painnas, avec commentaire et gloses" (Guerinot 1906 $239). "Easily the worst text ever printed in India--so hopelessly faulty that large portions remain wholly unintelligible" (Alsdorf 1966 Utt. study 207nl). "Lle text ... est tres corrompu, pratiquement incomprehensible sans le secours des manuscrits ou d'autres editions. Consulte a la lumiere de ces derniers, il fournit des indications utiles, confirme telle tradition ou telle interpretation" (Caillat, Cand. 1971, 19). 1905 Payanna sangraha : bhaga I lo. Amadavada : Sa. Balabhai Kakalabhai, samvat 1962[1905). f. 77, 12; 13 x 23 cm. Contents: Bhattap., 1.1-25b.--Caus., 26a-35b.--Mahapacc., 36a-55b.-Aurapacc., 56a67b.-Aradhana prakarana of Somasuri, 68a-77b.-Atmabhavana (Gujarati) of Buddhisagara 1-6b.-Paramanananda pacisi (25 Sanskrit slokas) 7a-12b. [Schubring 1935 $50; JRK 25] ANU BL1312.84.G8 1906 [sic] 1907 *Sri Causarana, Aurapaccakkhana, Bhaktaparijna, Santharaga : cara payannano sangraha. Bhavnagar : Jaina-dharma-prasaraka Sabha, samvat 1966 (1907). 23 [ie. 46] p. [Winternitz 1933:2, 461n3; Schubring 1935 $50; JRK 25) Reprinted 1923 or 1924. 1923 or 1924 Sri Causarana, Aura paccakkhana, Bhaktaparijna Santharaga: cara payannano sangraha. Bhavanagara : Sri Jainadharmaprasaraka Sabha, Samvat 1980 [1923), Vira samvat 2450 [1924]. avrtti 2. 23 p. ; 12 x 27 cm. Contents: (Gujarati) Prastavana attributes all these texts to Virabhadra.--Causarana la4a.-Aura paccakkhana 4b-8.-Bhattaparinna 9a-179.-Santharaga 176-23b. Reprint of 1907 editon. Printed: Bhavanagara : Ananda Printinga Presa. A number of variant readings are given for each text, no clear indication of sources. ANU PAMPHLET BL1312.83 1944 [sic] 153
Page #174
--------------------------------------------------------------------------
________________ Painnas/Prakirnakas 1927 3.7 1984-1987> Bhattaparinna, Painnayasuttaim JAS 17 (Part I), p. 312-28. Srutasthavirasutritam Catuhsaranadimaranasamadhyantam Prakirnakadasakam chayayutam. Bomday [sic] Shree Agamoday Samiti, Vira sam. 2453. Vikrama sam. 1983. San 1927. [Agamodaya Samiti; 46]. Contents: Causar. 1a-5a.-AuraPacc. 5a-10a.-Maha Pacc. 10b-19a.-BhattaP. 19b31a. Tand. 31b-53a. Samth. 53b-61a.-Gaccha. 61b-70b.-Gani Vi. 70b-75b.DevTha. 76a-96a.-Marana Vi. 96a-142b. 1941 1971 Title: Candravedhyaka (Skt). Editions: 1886 BORI 3886/X.B. Jaina texts Edition based on six manuscripts, [the oldest being from the 13th cent. Vikram] [English Introduction, p. 86] Candavejjhaya (Cand.) "Deals in 174 verses with teachers and pupils, and with discipline in general" (Winternitz 1933:2, 459). *Atha Dasapayanna mula sutra prarambhah / Ganadhara Sudharma Svami sankalitamula sutra; Tandulavayali 24, Devinddastava 25, Ganivijja 26, Causarana 27, Santhara 28, Aurapaccarakana 29, Bhattaparijnana 30, Candravijja 31, Mahapaccarakana 32, Maranavibhatti 33; Pratapaji karake samsondhita [sic]. Banarasa : Jaina Prabhakara Presa, Samvat 1942. [Isavi] 1886. 73 [i.c. 146] p.; 13 x 32 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 24-33). [Univ. of Chicago Library catalogue] "Edition collective des dix painnas, avec commentaire et gloses" (Guerinot 1906 SS239). "[E]asily the worst text ever printed in India-so hopelessly faulty that large portions remain wholly unintelligible" (Alsdorf 1966 Utt. study 207n1). "[L]e text... est tres corrompu, pratiquement incomprehensible sans le secours des manuscrits ou d'autres editions. Consulte a la lumiere de ces derniers, il fournit des indications utiles, confirme telle tradition ou telle interpretation" (Caillat, Cand. 1971, 19). *Siri Candavijjhaya [Candagavijjham] Painnayam, ... / Caturavijaya-krta-chaya-bhusitam. Patana: Sri Kesarbai Jnanamandira, Vira samvat 2467 [1941]. 2, f. 1-14. (Vijaya-kamalasurisvaraji Jaina granthamala ; 4). [Caillat 1971, 19] "Edition claire, soignee, correcte, munie d'une chaya, elle est tres utile pour une lecture rapide. Elle peut neanmoins etre amelioree sur certains points de detail. On ignore malheureusement sur quelle tradition manuscrite elle se fonde; elle en signale, sporadiquement et malcommodement, quelques variantes ..." (Caillat, Cand. 1971, 19). Candavejjhaya: introduction, edition critique, traduction, commentaire/par Colette Caillat. Paris: Institut de Civilisation Indienne, 1971. 159 p. ; 25 cm. (Publications de l'Institut de civilisation indienne. Serie in-80 ; fasc. 34). Contents: Avant-propos [1]-2.-Abbreviations [3].-Bibliographie [5]-14.-Introduction. (Manuscrits, Editions. Langue. Metre. Style.) 15-57.-Text with variants 1-77.Translation. [79]-98.-Commentaire [99]-151.-Index [153]-154.-Addenda (readings from a further manuscript from Cambay). [153]-159. Text based on six manuscripts from the Staatsbibliothek Berlin, five manuscripts in Ahmedabad (four at the LD Institute), and two Indian editions (Cand.1886; 1941). Bhojak notes a number of places where his readings differ from Caillat's (Cand. 1984-1987> English Introduction 96-97). Review *A. N. Upadhye JOI(B) 22 (1972) 232-33. [Bibliography of the works of Dr. A. N. Upadhye. Sholapur : Jaina Samskrit Samrakshaka Sangha, 1977. p. 89 item 72] PK5003.A54C3 1971 1984-1987> Candavejjhaya, Painnayasuttaim JAS 17 (Part I), p. 63-89. Edition based on five manuscripts [the earliest being from the 13th cent. Vikram], the editions of 1941 and 1971 have also been used (English Introduction p. 83). 154
Page #175
--------------------------------------------------------------------------
________________ 1991 Translation: French: 1971 Studies: Caillat, Colette. 1972. Stylistic notes on Candagavejjhaya. In, India maior: congratulatory volume presented to J. Gonda. Leiden, 1972. p. 85-90. "(Painna of him) who hits the apple of the eye (taken as the target)" (p. 86). The Cand. taken as a sort of compendium of current aphorisms concerning Jaina discipline. 3.8 Caillat, Colette. 1992. Interpolations in a Jain pamphlet or, the emergence of one more Aturapratyakhyana. WZKS 36 (1992) 35-44. Examines the verses 'interpolated' after Candavejjhaya 169 (see edition of JAS 1984<1987>). *Candavejjhayam Painnayam: Candravedhyaka-prakinaka / [Hindi] anuvadaka Suresa Sisodiya; bhumika Sagaramala Jaina, Suresa Sisodiya. 1. samskarana. Udayapura : Agama Ahimsa-Samata evam Prakrta Samsthana, 1991. 39, 68 p. ; 23 cm. (Agama Samsthana granthamala; 6). [DKS-4392. DK Agencies, Recent Sanskrit, Prakrit and Pali publications from India, CIR-1378/1994-95, item 73] Exegesis: 8.1 8.2 8.3 8.4 8.5 8.6 8.7 8.8 8.9 Caillat (Cand.1971) Title: Catuhsarana (Skt). Editions: 1886 1900 Causarana (Kusalanubandhi) (CauSar.)/Virabhadra "The Causar. deals in 63 verses with the prayers by means of which one may take the 'fourfold refuge,' namely, that of the saints (Arhat), the perfected (Siddha), the living pious (Sadhu) and of religion (Dharma)" (Winternitz 1933:2, 459). Also known as Kusalanubandhyadhyayana. 63 gathas, ascribed to Virabhadra. (JRK 116). Gunaratna Suri, Avacuri (JRK 117). Bhuvanatunga, pupil of Mahendrasimha, pupil of Dharmaghosa Suri of the Ancala Gaccha, Avacuri (JRK 117). Somasundara Suri, (1374-1443) Avacuri (JRK 117; CauSar.1974). Vinayaraja Gani, Vrtti, (JRK 117). Vijayasena Suri, Curni, 500 granthas (JRK 117). Parsvacandra Suri, pupil of Sadhuratna, Vartika, composed sam 1597 [1540] (JRK 117). Tika (JRK 117). Tabba (BORI Cat. 17:1, 280). Catuhsaranavisamapadavivarana (BORI Cat. 17:1, 271-72). *Atha Dasapayanna mula sutra prarambhah / Ganadhara Sudharma Svami sankalitamula sutra; Tandulavayali 24, Devinddastava 25, Ganivijja 26, Causarana 27, Santhara 28, Aurapaccarakana 29, Bhattaparijnana 30, Candravijja 31, Mahapaccarakana 32, Maranavibhatti 33; Pratapaji karake samsondhita [sic]. Banarasa : Jaina Prabhakara Presa, Samvat 1942. [Isavi] 1886. 73 [i.e. 146] p.; 13 x 32 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 24-33). [Univ. of Chicago Library catalogue] "Edition collective des dix painnas, avec commentaire et gloses" (Guerinot 1906 SS239). "[E]asily the worst text ever printed in India-so hopelessly faulty that large portions remain wholly unintelligible" (Alsdorf 1966 Utt. study 207n1). "[L]e text... est tres corrompu, pratiquement incomprehensible sans le secours des manuscrits ou d'autres editions. Consulte a la lumiere de ces derniers, il fournit des indications utiles, confirme telle tradition ou telle interpretation" (Caillat, Cand.1971, 19). *[Causarana and Aurapaccakkhana with other texts.] Ahmedabad: samvat 1957 [1900]. [Schubring 1935 SS50] 155
Page #176
--------------------------------------------------------------------------
________________ Painnas / Prakirnakas 1902 *Causarana tatha Aurapaccakkhana Payannanum. Ahmadabad, 1902. [Guerinot 1909 91027] "Texte des deux premiers prakirnakas, avec une glose verbale en sanskrit, une traduction en guzerati et un commentaire egalement en guzerati. / A la suite, le Gunasthanakramaroha de Ratnasekhara et le Tattvarthasutra d'Umasvati." 1905 Payanna sangraha : bhaga I lo. Amadavada : Sa. Balabhai Kakalabhar, samvat 1962 [1905). f. 77, 12; 13 x 23 cm. Contents: Bhattap., f.1-25b.--Caus., 26a-35b.--Mahapacc., 36a-55b.-Aurapacc., 56a67b.- Aradhanaprakarana of Somasuri, 68a-77b.-Atmabhavana (Gujarati) of Buddhisagara 1-6b.-Paramanananda pacisi (25 Sanskrit slokas) 7a-12. [Schubring 1935 $50; JRK 25] ANU BL1312.84.68 1906 [sic] 1907 *Sri Causarana, Aurapaccakkhana, Bhaktaparijna, Santharaga : cara payannano sangraha. Bhavnagar : Jaina-dharma-prasaraka Sabha, samvat 1966 [1907). 23 [ie. 46 p. [Winternitz 1933:2, 461n.3; Schubring 1935 $50; JRK 25] Reprinted 1923 or 1924. 1922 Pratnapurvadharanirmitam Sritandulavaicarikam SrimadvijayavimalaganidTbdhavrttiyutam, savacurikam ca Catuhsaranam [ / edited by Anandasagara). Bombay: Sheth Devchand Lalbhai Jain Pustakoddhar Fund, Virasamvat 2448. Vikramasamvat 1978. Kraista 1922.78 fie. 156) p. ; 12 x 27 cm. (Sresthi-Devacandra-Lalabhai-Jaina pustakoddhare granthanka; 59). [DLJP list] Contents: Srutasthaviradrbdham Tandulavaicarikaprakirnam la-57a.-Catuhsarana with Avacuri] 576-78a.-Visayanukramanika 776-78a. "Prati 1000." BORI 2768 and 38 208 1923 or 1924 Sri Causarana, Aura paccakkhana, Bhaktaparijna Santharaga : cara payannano sangraha. Bhavanagara : Sri Jainadharmaprasaraka Sabha, Samvat 1980 [1923), Vira samvat 2450 [1924). avstti 2.23 p. ; 12 x 27 cm. Contents: (Gujarati Prastavana attributes all these texts to Virabhadra.--Causarana la4a.-Aura paccakkhana 4b-8b.-Bhattaparinna 9a-17a.-Santharaga 17b-23b. Reprint of 1907 edition. Printed: Bhavanagara : Ananda Printinga Presa. A number of variant readings are given for each text, no clear indication of sources. ANU PAMPHLET BL1312.83 1944 [sic] 1927 Srutasthavirasutritam Catuhsaranadimaranasamadhyantam Prakirakadasakam chayayutam. Bomday (sic) : Shree Agamoday Samiti, Vira sam. 2453. Vikrama sam. 1983. San 1927. [Agamodaya Samiti ; 46). Contents: Causar. la-5a.- AuraPacc. 5a-10a.--MahaPacc. 10b-19a.-BhattaP. 19b31a.-Tand. 31b-53a. Samth. 53-61a.-Gaccha. 616-70b.--Gani Vi. 70b-75b.Dev Tha. 76a-96a.-Marana Vi. 96a-142b. BORI 3886 / X.B. Jaina texts 1960Z (Causarana payanna : artha sahita). [1960s?] 208 p. ; 17 cm. Contents: Causarana payanna : [Gujarati] artha sahita 1-19.-Aura paccakkhana payannaT: (Gujarati) artha sahita 20-42.-Sri Vajrapajjara stotram 43-44.-Sri Atmabhavana 44-53.- a number of aradhanas and small stavanas in Gujarati (translated?) and other collections of stavanas, and minor texts 176-208, includes Sri Panca pratikramana sutra p. 135 onwards.Title-page missing, title is that of first work in book, purchased by ANU Library in 1973, estimated date of publication only. ANU BL1310.5.C38 1900Z 1974 Norman, K. R. 1974. Causarana-painnaya : an edition and translation. Adyar Library bulletin 38 (1974) 44-59. Reprint. Collected papers 1, 187-99. Contents: [Introduction] 44 46.-Text 46-50.-Translation 50-56.-Notes on the text 56-57.Edition based on four MSS-(1) A. MS Add 1774 and (2) B. MS Add 1816 both from Cambridge University Library, the former with anonymous avacuri, probably by Somasundara Suri (1374-1443); (3) C. Add MS 26464 British Museum; (4) D. MS 3391 156
Page #177
--------------------------------------------------------------------------
________________ India Office Library with the same anonymous cty as (1) above--and Causar.1927, 1-5a. 1984> <1987> Causarana, Painnayasuttaim JAS 17 (Part I), p. 309-11. Edition seems to be taken from the palm leaf manuscript belonging to the Jinabhadrasuri Jaina Jnana Bhandara, Jesalmer and bearing the serial number 151 ... folios 29-33" (A. M. Bhojak, English Introduction p. 86). Translations: English: 1974 K. R. Norman (Causar.1974) Gujarats: 1902 (Causar.1902) Kusalanubandhiajjhayana. See also Causarana 1984><1987>Kusalanubandhiajjhayana. Painnayasuttaim JAS 17 (Part I), p. 298-304.Edition based on six manuscripts [the oldest being from the 16th cent. Vikram] (English Introduction 86, see also p. 119). 3.9 Devindatthaya (Dev Tha.) "The Dev Tha.) in 300 verses contains a classification ... of gods according to their groups, residences, etc." (Winternitz 1933:2, 460). Five gathas [of this text] (258-62) are available in the printed text" (of the Suryaprajnaptisutra published by the Agamodaya Samiti, Surat 1919).--"This or that gatha of this Prakirnaka is found in the Jyotiskarandaka, Suryaprajnapti and Avasyakaniryukti." [1984<<1987> JAS 17, English introduction p. 82] Title: Devendrastava (Skt). Editions: 1886 *Atha Dasapayanna mula sutra prarambhah / Ganadhara Sudharma Svami sankalitamula sutra : Tandulavayali 24, Devinddastava 25, Ganivija 26, Causarana 27, Santhara 28, Aurapaccarakana 29, Bhattaparijnana 30, Candravijja 31, Mahapaccarakana 32, Maranavibhatti 33 ; Pratapaji karake samsondhita (sic). Banarasa : Jaina Prabhakara Presa, Samvat 1942. [Isavi] 1886. 73 [i.e. 146] p. ; 13 x 32 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 24-33). [Univ. of Chicago Library catalogue] "Edition collective des dix painnas, avec commentaire et gloses" (Guerinot 1906 $239). "[E]asily the worst text ever printed in India-so hopelessly faulty that large portions remain wholly unintelligible" (Alsdorf 1966 Utt. study 207nl)."[L]e text ... est tres corrompu, pratiquement incomprehensible sans le secours des manuscrits ou d'autres editions. Consulte a la lumiere de ces derniers, il fournit des indications utiles, confirme telle tradition ou telle interpretation" (Caillat, Cand. 1971, 19). 1927 Srutasthavira sutritam Catuhsaranadimaranasamadhyantam Prakirnakadasakam chayayutam. Bomday (sic) : Shree Agamoday Samiti, Vira sam. 2453. Vikrama sam. 1983. San 1927. (Agamodaya Samiti, 46). Contents: Causar. la-5a-AuraPacc. 5a-10a.-MahaPacc. 106-19a.-BhattaP. 19b31a-Tand. 31b-53a.-Samth. 53-61a. Gaccha. 616-70b.--Gani Vi. 705-75b. Dev Tha. 76a-96a.-Marana Vi. 96a-142b. BORI 3886/X.B. Jaina texts 1984-<1987> Devindatthaya, Painnayasuttaim JAS 17 (Part 1), p. 3-34. Edition based on seven manuscripts (English introduction page 82] 1988 Devindatthao =Devendrastava: Muni Punyavijayaji dvara sampadita mulapaha/anuvadaka aura vyakaramatmaka-vislesana Subhasa Kothari, anuvada sahayoga Suresa Sisodiya. 1. samskarana. Udayapura : Agama-Ahimsa-Samata evam Praksta Samsthana, 1988. lxxi, 151 p. ; 22 cm. (Agama Samsthana granthamala ; 1). Contents: Bhumika /Sagarmala Jaina, Subhasa Kothari [Includes a number of passages treating similar topics extracted from other works and printed parallel to the text of the Devindatthao) ix-lxxi.- [Text from DevTha.1984_<1987>, plus variants, but without the 157
Page #178
--------------------------------------------------------------------------
________________ Painnas / Prakirnakas explanation of the abbreviations. Parallel Hindi translation.] 1-75.-Vyakaranika vislesana 80-151.-Suddhi-patra of three pages tipped into end of book. ANU NEW BOOKS COLLECTION 1 860 290 Studies: Singh, Lalit Kumar. 1992-93. The date of the Devendrastava : an art-historical approach. Sambodhi 18 (1992-93) 74-76. Centres on gatha 93 and associates it with the lion capital of Sarnath erected by Asoka, using this link to date the DevTha. before the 1st cent. CE. 3.10 Gacchayara (Gaccha.) "[Gaccha.] 'school rules' ... rules of life for teachers, monks and nuns ... an extract from the Cheya-suttas (Maha Nis., 5th adhyayana) and (Vava.]" (Winternitz 1933:2, 460; BORI Cat. 17:2, 30, 37). Exegesis: 10.1 Vijayavimala Gani =Vanararsi, pupil of Anandavimala Suri, Tapa Gaccha, Vrtti composed sam. 1634, 5850 Slokas (JRK 101b; BORI Cat. 17:1, 336-45). Published Gaccha. 1923; 1979; 1987. Translated by Vijayarajendra Suri (1826-1900), of the Tristutika Gaccha, in samvat 1944 [1887). Published. Ahora, Rajasthana : Sri Bhupendera suri Sahitya-samiti, [year uncertain but probably within Vijayarajendra's lifetime]. 381 p.; "Crown 8". In some places Vijayarajendra has added his own comments to the translation. (Jayaprabhavijaya, Srimad Rajendrasuri smaraka-grantha, 1957.90, 487). 10.2 Harsakula, Vrtti, 1 600 granthas (JRK 102a). 10.3 Tika (probably = Vijayavimala's) (JRK 102a). Editions: 1923 Srimadanandavimalacaryantikachrimadvanararsivihita vrttiyutam Srimad Gacchacarapra kirakam. Mehesana : Agamodaya Samiti, Virasamvat 2450. Vikrama samvat 1980. Kraista san 1923. 42 p. ; 12 x 27 cm. (Agamodaya-Samiti series ; no. 36, 46). "Pratayah 1250." Each page gives line numbers. BORI 1632 and 2687 / X.B. Jaina text 1927 Srutasthavirasutritam Catuhsaranadimaranasamadhyantam Prakimmakadasakam chayayutam. Bomday [sic] : Shree Agamoday Samiti, Vira sam. 2453. Vikrama sam. 1983. San 1927. (Agamodaya Samiti: 46). Contents: Causar. la-5a.-AuraPacc. 5a-10a.--MahaPacc. 106-19a.-BhattaP. 195- 31a.--Tand. 316-53a-Samth. 53b-61a.-Gaccha. 616-70b. Gani Vi. 705-750.DevTha. 76a-96a.-Marana Vi. 96a-142b. Gaccha. "together with the commentary of Vijayavimala, alias Vanararsi" (JRK 101b). BORI 3886 / X.B. Jaina texts 1945 Purvacaryaviracita-Srigacchacarpayanna : Samskstachaya saha Gujarati vivecanayukta / samyojaka-jagatpujya Saudharmabrhattpogacchiya Bhattaraka Srimadvijayarajendra surisvaraji Maharaja ; samsodhaka-Sri gulabavijaya. Ahora, Maravara : Sribhupendrasuri Jainasahityasamiti, Sriviranirvana sam. 2471, Vikrama 2002 [1945). 12, 380 p. ; 25 cm. (Sribhupendrasuri Jainasahityasamiti granthanka 15). Gujarati text in Devanagari. Vijayarajendrasuri "svargavasa Vi. sam. 1963 Pausa sudi 7 Mu. Rajagarha" (Plate facing page 4 (1st group)). Author of the Sriabhidhanarajendrakosa. ANU BL1312.9.634 1947 [sic] *[Vijayavimala Gani. Gacchacaraprakirnakavrtti / edited by Danavijayagani ( = Acarya Sri Vijayadanasurisvaraji)). Ahmedabad: Sri Dayavimala granthamala, 1979). [1984 <1987> JAS 17, English introduction p. 87] 1979 1984<<1987> Gacchacara, Painnayasuttaim JAS 17 (Part I), p. 337-349. Edition based on four manuscripts (the oldest being from the 13th cent. Vikram] (English 158
Page #179
--------------------------------------------------------------------------
________________ 1987 1994 Hindi translation: Suresa Sisodhiya (Gaccha.1994) 3.11 Ganiviija (GaniVi.) Also called Ganitavidyaprakirnaka (JRK 103a), its 86 verses concern astrology (Winternitz 1933:2, 461). Title: Ganividya (Skt). Editions: 1886 1927 Introduction 87). Sri Gacchacara-Prakirnakam: pu. Panditapravarasri Vijayavimalagani-viracitavrtiyutam/ sampadakah samsodhakas ca Pujyacaryadevasrivijayajinendrasurisvarah; sahayakah Pujyacaryadevadi-sadupadesena vividhasanghah. Prathamavrttih. Lakhabavala, Santipuri, Saurastra: Sri Harsapuspamrta Jaina granthamala, Vira sam. 2513 [1987]. 16, 344 p. ; 13 x 26 cm. (Sri Harsapuspamrta Jaina granthamala; granthankah 172). "Pratayah 750." ANU NEW BOOKS COLLECTION 1 777 533 *Gacchayarapainnayam = Gacchacaraprakirnaka / Muni Punyavijayaji dvara sampadita mula-patha; anuvadaka Suresa Sisodhiya; bhumika Sagaramala Jaina, Suresa Sisodiya. Samskarana 1. Udayapura: Agama-Ahimsa-Samata evam Prakrta Samsthana, 1994. 36, 36 p. ; 22 cm. (Agama Samsthana granthamala; 11). [DKS-5223. DK Agencies Recent Sanskrit, Prakrit and Pali publications Ref. No. CIR-1585/1996-97, item 71] 1969 1994 *Atha Dasapayanna mula sutra prarambhah / Ganadhara Sudharma Svami sankalitamula sutra; Tandulavayali 24, Devinddastava 25, Ganivijja 26, Causarana 27, Santhara 28, Aurapaccarakana 29, Bhattaparijnana 30, Candravijja 31, Mahapaccarakana 32, Maranavibhatti 33; Pratapaji karake samsondhita [sic]. Banarasa : Jaina Prabhakara Presa, Samvat 1942. [Isavi] 1886. 73 [i.c. 146] p.; 13 x 32 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 24-33). [Univ. of Chicago Library catalogue] "Edition collective des dix painnas, avec commentaire et gloses" (Guerinot 1906 SS239). "[E]asily the worst text ever printed in India-so hopelessly faulty that large portions remain wholly unintelligible" (Alsdorf 1966 Utt. study 207n1). "[L]e text ... est tres corrompu, pratiquement incomprehensible sans le secours des manuscrits ou d'autres editions. Consulte a la lumiere de ces derniers, il fournit des indications utiles, confirme telle tradition ou telle interpretation" (Caillat, Cand.1971, 19). Srutasthavirasutritam Catuhsaranadimarannasamadhyantam Prakirnakadasakam chayayutam. Bomday [sic] Shree Agamoday Samiti, Vira sam. 2453. Vikrama sam. 1983. San 1927. [Agamodaya Samiti; 46]. Contents: Causar. la-5a.-AuraPacc. 5a-10a.-MahaPacc. 10b-19a.-BhattaP. 19b31a. Tand. 31b-53a.-Samth. 53b-61a.-Gaccha. 61b-70b.-GaniVi. 70b-75b.DevTha. 76a-96a.-Marana Vi. 96a-142b. BORI 3886/X.B. Jaina texts Schubring, Walther. Ganivijja. IIJ 11 (1969) 130-41. Text edition based on GaniVi.1886 ("very primitive print," p. 131) and GaniVi.1927. Review. Colette Caillat, Journal asiatique 260 (1972) 414-17. 1984-1987> Ganivijja, Painnayasuttaim JAS 17 (Part I), p. 93-98. Edition based on five manuscripts [the oldest being from the 13th cent. Vikram], but none of the printed editions (English Introduction p. 84. See also p. 97-102). *Ganivijjapainnayam = Ganividya-prakirnaka / Muni Punyavijayaji dvara sampadita mulapatha; anuvadaka Subhasa Kothari; bhumika Sagaramala Jaina, Subhasa Kothari Samskarana 1. Udayapura: Agama-Ahimsa-Samata evam Prakrta Samsthana, 1994. 6, 45, 28 p. ; 22 cm. (Agama Samsthana granthamala; 10). [DKS-5217. DK Agencies Recent Sanskrit, Prakrit and Pali publications Ref. No. CIR-1585/1996-97, item 72] Hindi translation: Subhasa Kothari (GaniVi.1994) 159
Page #180
--------------------------------------------------------------------------
________________ Painnas / Prakirnakas 3.12 Isibhasiyaim (IsiBhas.) 3 Editions: 1927 *Srimadbhih pratyeka buddhair bhasitani Rsibhasitasutrani. Ratlam: Rsabhadevaji Kesarimalaji Svetambara Samstha, 1927. 44 p. [IsiBhas. 1942, 490; JRK 59b; Tripathi 1981, 321] Printed. Indore : Jainabandhu Press (Tripathi 1981, 321). "So verzeichnet der Katalog (of Muni Punyavijaya's Collection, Pt. 1. Ahmedabad 19631 denn auch einen Druck aus Ratlam, nicht den hier zugrunde liegenden aus Indaur" (IsiBhas. 1969, 1). 1942 Isibhasiyaim: ein Jaina-Text der Fruhzeit/ von Walther Schubring. Gottingen: Vandenhoeck & Ruprecht, 1942. [489]-576p. ; 25 cm. (Nachrichten der Akademie der Wissenschaften in Gottingen, I., Philologisch-Historische Klasse ; Jahrgang 1942, Nr.6). Translated into English IsiBhas. 1974. ANU PAMPHLET PK5003.A414 1942 1952 Isibhasiyaim II : (Schluss-)Teil/ von Walther Schubring. Gottingen: Vandenhoeck & Ruprecht, 1952. (21)-52 p. ; 25 cm. (Nachrichten der Akademie der Wissenschaften in Gottingen, I., Philologisch-Historische Klasse ; Jahrgang 1952, Nr.2). Translated into English IsiBhas. 1974. ANU PAMPHLET PK5003.A414 1952 1963 Isi-bhasiyaim suttaim = The Isibhasiyaim arthat arhatarsi prokta Rsibhasitani sutrani : Bharatiya bhasaom mem prathamatah anuvadita ; Samskrtatikaya samullasitani HindiGujarati anuvada aura visama-sthalom para visada tippanom se alankyta/anuvadaka evam sampadaka Manoharamuni ; samsodhaka Narayan Rama Acarya. Bambai : Sudharma Jnanamandira, samvat 2020. 1963. 300 p. ; 25 cm. [Jaina-Agama series vol. 17 (1) Introduction p. 111] Contents: Sri Kisanalalaji Ma. ke jivana ki rangina rekhaem [1]-14.--"Isibhasiyaim" sutraparicaya / Muni Manohara "Sastri" [151-40.-12 plates of Patana MSS). Prakkathana (Gujarati] [41] 42.-Manohara Muniji : eka paricaya [43] 44.-Bhumika ki visayasuci. Granthavisayanukramasuci [1]-3.- Isi-bhasiyaim [1]-296.-Parisista 1. Isibhasiya padhama sangahini [297]-298.-2. Isibhasiyaim-atthahigarasangahini (299)-300. Introduction, Hindi and Gujarati translations and popular explanations. (IsiBhas. 1969, 1). "Pandit Manoharamuniji has independently examined the old manuscripts and recorded the variants. He seems to have taken great pains in carrying out this tedious work. This edition contains the text of the Isibhasiyaim, its Hindi and Gujarati translation, Sanskrit commentary and at places translation of the Sanskrit commentary" (1984<<1987> JAS 17:1. Introduction p. 111). BORI 19 965 Univ. of Poona Q31:2153/15133 / 76 452 Isibhasiyaim : Ausspruche der Weisen, aus dem Prakrit der Jainas ubersetzt von / Walter Schubring, nebst dem revidierten Text. Hamburg : Cram, de Gruyter, 1969. 51, 502-51 p. [revised pages of IsiBhas. 1942] : 28 cm. (Alt- und neu-indische Studien ; 14). Contents: Introduction) 1.-Ubersetzung und Kommentar 3-45.-Nachwort 46. Auswahl aus dem Wortbestand des Textes 49-51.-Revidierter Text der Ausgabe in den Nachrichten der Gesellschaft der Wissenschaften in Gottingen 1942, p. 502-51. Manuscript details are not repeated here. Review. Colette Caillat. Journal asiatique 260 (1972) 414, 417-22. ANU LARGE BOOK PK5003.A414 1969 1969 1974 Isibhasiyaim: a Jaina text of early period [sic] / edited by Walther Schubring. Ahmedabad: L. D. Institute of Indology, 1974. 12, 171, 3 p. ; 25 cm. A Niryukti, not now extant, is mentioned as Bhadrabahu's work by Rajasekhara in his Prabandhakosa (JRK 59b). For some comments on this text see Dundas (1992, 16-17). 160
Page #181
--------------------------------------------------------------------------
________________ Contents: Preface / Dalsukh Malvania [5].--Isibhasiyaim : a Jaina text of (an early period / by Walther Schubring (translated by Charlotte Krause] 1-12.-Isibhasiyaim = Isibhasiyaim (text in Roman script with Devanagari version on facing pages.] 1-101.Isibhasiyaim commentary / Walther Schubring. 102-30.-Rsibhasitatika [Sanskrit / Walther Schubring] [131]-159.-"Selection from the stock of the words of the text sie. index of notable words)" [161]-71.-Index of proper names. [172]. "Only the German material published in 1942 and 1951 [1952 above) is translated into English" (Preface [5]). ANU B162.5.175 1974 Review. *Bansidhar Bhatt. 1979. The Journal of religious studies (Patiala) 7.2 (1979) 163-68 (de Jong). 1984 <1987> Isibhasiyaim, Painnayasuttaim JAS 17 (Part 1), p. 182-256. Based on IsiBhas. 1974, compared with only one manuscript (from Ahmedabad, 16th cent.). Refers also to IsiBhas. 1963 [Introduction 84-85, 104-118. See also p. 104-118.] 1988 Isibhasiyaim suttaim: Rsibhasita sutra/ sampadaka eva[m] Hindi anuvadaka Mahopadhyaya Vinayasagara; Angreji anuvadaka Kalanatha Sastri, Dinesacandra Sarm. 1. samskarana. Jayapura : Prakrta Bharati Akadami; Mevanagara : Sri Jaina Sve. Nakora Parsvanatha Tirtha, 1988. xiv, 102, 96, 214 p. ; 25 cm. (Praksta Bharati puspa : 46). Includes: Rsibhasita : eka adhyayana/Sagaramala Jaina. 1-102.-Rishi-bhashit: a study (translation of the preceding). 1-96.-Text with Hindi and English translations. [1]-203. Text is based on IsiBhas. 1974 (p. xvi). ANU BL1314.2.15812 1988 Translations: German: Schubring (IsiBhas. 1969) Gujarati: 1963 Manoharamuni (IsiBhas.1963) Hindi: 1963 1988 Manoharamuni (IsiBhas. 1963) Vinayasagara (IsiBhas. 1988) Japanese: 1966 *[Japanese translation /Seiren Matsunami sa pupil of Schubring's with footnotes to individual words.) 81 p. Faculty of Arts (Literaturwissenschaftlichen Fakultat) of the University of Kyushu. [IsiBhas. 1969, 1] Studies: Dixit, K. K. 1978. Rsibhasita. In, Early Jainism. Ahmedabad : L. D. Institute of Indology, 1978. 8,99 p.; 25 cm. (LD series ; 64) p. [81]-85. ANU BL1351.2 .D53 Alsdorf, 1955. *["Im Westen hat Alsdorf sich S. N. Chatterji Jubilee Volume (1955), S. 21 auf eine Stelle in 45 bezogen."] Review. *Kirfel OLZ 1954, SP. 67f. (IsiBhas. 1969, 1). Jain, Sagaramala. 1988. Rsibhasita : eka adhyayana : 2400 varsa puratana grantha mem carcita Hindu, Bauddha va Jaina manisiyom ke kala tatha vicarom ka tulanatmaka vivecana / lekhaka Sagaramala Jaina ; sampadaka Vinayasagara. 1. samskarana. Jayapura : Prakrta Bharati Akademi, 1988. 24 cm. ; ii, 102 p. ; 25 cm. (Prakrta Bharati ; puspa 49). English translation below. BORI 62 279 - 1988. Rishibhashit, a study: a comparative study of the period and views of Vedic, Buddhist, and Jain thinkers detailed in a 2400 years old philosophical work/ by Sagarmal Jain ; editor, 161
Page #182
--------------------------------------------------------------------------
________________ Painnas/Prakirnakas BORI 62 278 Gopal, Lollanji. 1991. Asita-devala in Isibhasiyaim. In, Pam. Dalasukhabhai Malavaniya abhinandana grantha (1)= Pt. Dalsukh Bhai Malvania felicitation volume 1/ sampadaka Madhusudana Dhaki; Sagaramala Jaina. Varanasi: Parsvanatha Vidyasrama Sodha Samsthana, 1991.32, 284, 206 p. ; 25 cm. (Jaina Vidya ke Ayama; granthanka 3 = Aspects of Jainology; 3). p.[74]-87. ANU NEW BOOKS COLLECTION 1 861 971 Upasak, C. S. 1991. The Isibhasiyai and Pali Buddhist texts: a study. In, Pam. Dalasukhabhai Malavaniya abhinandana grantha (1) = Pt. Dalsukh Bhai Malvania felicitation volume 1 / sampadaka Madhusudana Dhaki; Sagaramala Jaina. Varanasi Parsvanatha Vidyasrama Sodha Samsthana, 1991. 32, 284, 206 p. ; 25 cm. (Jaina Vidya ke Ayama; granthanka 3 = Aspects of Jainology; 3). p. [68]-73. Indexes: 1974 1979 1994 Vinay Sagar; translated into English by Surendra Bothra. 1st ed. Jaipur : Prakrit Bharati Academy, 1988. ii, 96 p. ; 24 cm. (Prakrit Bharati Pushpa ; 54). English translation of preceding. 1995 1996 ANU NEW BOOKS COLLECTION 1 861 971 (IsiBhas.1974): "Selection from the stock of [the] words of the text [ie. index of notable words]" p. [161]-71.-Index of proper names. [172]. Taikyo Tanigawa, *A word-index to the Isibhasiyaim, Felicitation volume for Professors Shinjo Ito and Junsho Tanaka published by their friends and pupils at Koyasan University, 1979, p. 25-87. [Cited by Nalini Balbir, review of 1996 index below, BEI 13-14 (1995-96) 544.] Isibhasiyaim: pada index and reverse pada index / Moriichi Yamazaki and Yumi Ousaka. Tokyo: The Chuo Academic Research Institute, 1994. iii, 88 p. ; 30 cm. (Philologica Asiatica : Monograph Series; 2). Pada indexes based on IsiBhas. 1969. Index integrated into A Pada index and reverse pada index to early Jain Canons : Ayaranga, Suyagada, Uttarajjjhaya, Dasaveyaliya, and Isibhasiyaim/ by Moriichi Yamazaki and Yumi Ousaka. Tokyo: Kosei Publishing Co., 1995. 537 p. 23 cm. Review: BEI 11-12 (1993-94), 467-468 RW A Pada index and reverse pada index to early Jain Canons: Ayaranga, Suyagada, Uttarajjjhaya, Dasaveyaliya, and Isibhasiyaim / by Moriichi Yamazaki and Yumi Ousaka. Tokyo: Kosei Publishing Co., 1995. 537 p. 23 cm. Includes the separate index Isibhasiyaim: pada index and reverse pada index / Moriichi Yamazaki and Yumi Ousaka. Tokyo: The Chuo Academic Research Institute, 1994. iii, 88 p. ; 30 cm. (Philologica Asiatica: Monograph Series; 2). Index based on IsiBhas. 1969. Review: "[L]es editions de la Jaina-Agama-Series ne sont toujours pas prises en compte et aucune explication n'est fournie a ce fait ... On continue aussi a regretter qu'aucune indication abregee ne figure pour caracteriser le metre des pada. Toutefois, tel qu'il est, ce volume fait un instrument de travail extremement utile." Nalini Balbir BEI 13-14 (1995-96), 543. RW Isibhasiyaim: word index and reverse word index / Moriichi Yamazaki and Yumi Ousaka. Tokyo: The Chuo Academic Research Institute, 1996. i, 132 p.; 30 cm. (Philologica Asiatica : Monograph Series; 7). Word indexes based on IsiBhas. 1969. Review: Nalini Balbir BEI 13-14 (1995-96) 544-45. 162 RW
Page #183
--------------------------------------------------------------------------
________________ 3.13 Joisakarandaga (Joiska.) On astrology, 1830 granthas (JRK 150b). Ascribed to Padalipta by Punyavijaya (1984 <1987> JAS 17:1, English Introduction p. 122) on the basis of comments by Malayagiri (Punyavijaya 1961, Jain Agamadhara aura Prakta varmaya. Originally an address to the Akhila Bharatiya pracyavidyaparisad (Srinagar), Praksta aura Jainadharma vibhaga, 14-16 October 1961. Reprinted in Punyavijaya's collected articles, Jnananjali (Hindi section) p. 25). Exegesis: 13.1 Malayagiri, Tika, 3150 granthas (JRK 150b). Published Joiska.1928. 13.2 Vacaka Sivanandi, Vitti, MS in Jaisalmer, edition of this Tippanaka' prepared by Punyavijaya and to be published by Sri Mahavira Jaina Vidyalaya (1984 <1987> JAS 17:1, 88n.1). Editions: 1928 *srimalayagiryacaryakrta Vrttiyuktam Jyotiskarandakam Prakirnakam. Ratlam Shri Rishabhdevaji Kesarimalji, 1928. (JRK 150b; 1984<<1987> JAS 17:1, Introduction p. 88- 89] 1984 <1987>Joisakarandaga, Painnayasuttaim JAS 17 (Part I), p. 361-408. Edition based on 6 manuscripts [the oldest dated samvat 1489]. [English Introduction 88] 3.14 Mahapaccakkhana (MahaPacc.) "Mahapaccakkhana, 'the great refusal,' a formula of confession and renunciation in 143 verses (Winternitz 1933:2, 459). Title: Mahapratyakhyana (Skt). Editions: 1886 *Atha Dasapayanna mala sutra prarambhah / Ganadhara Sudharma Svami sankalitamula sutra ; Tandulavayali 24, Devinddastava 25, Ganivija 26, Causarana 27, Santhara 28, Aurapaccarakana 29, Bhattaparijnana 30, Candravijja 31, Mahapaccarakana 32, Maranavibhatti 33 ; Pratapaji karake samsondhita (sic). Banarasa : Jaina Prabhakara Presa, Samvat 1942. Isavi] 1886. 73 i.e. 146] p. ; 13 x 32 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 24-33). [Univ. of Chicago Library catalogue] "Edition collective des dix painnas, avec commentaire et gloses" (Guerinot 1906 $239). "[E]asily the worst text ever printed in India-so hopelessly faulty that large portions remain wholly unintelligible" (Alsdorf 1966 Utt. study 207nl). "[L]e text ... est tres corrompu, pratiquement incomprehensible sans le secours des manuscrits ou d'autres editions. Consulte a la lumiere de ces derniers, il fournit des indications utiles, confirme telle tradition ou telle interpretation" (Caillat, Cand. 1971, 19). 1905 Payanna sangraha : bhaga 1 lo. Amadavada: Sa. Balabhai Kakalabhai, samvat 1962 [1905). f. 77, 12; 13 x 23 cm. Contents: Bhattap., f.1-25b. Caus., 26a-35b.--Mahapacc., 36a-55b.- Aurapacc., 56a67b.-Aradhana prakarana of Somasuri, 68a-77b.-Atmabhavana (Gujarati) of Buddhisagara 1-6b.--Paramanananda pacisi (25 Sanskrit slokas) 7a-12b. [Schubring 1935 850;JRK 25) ANU BL1312.84.G8 1906 [sic] 1927 Srutasthavirasutritam Catuhsaranadimaranasamadhyantam Prakirakadasakam chayayutam. Bomday [sic] : Shree Agamoday Samiti, Vira sam. 2453. Vikrama sam. 1983. San 1927. [Agamodaya Samiti ; 46). Contents: Causar. la-5a.- AuraPacc. 5a-10a.--MahaPacc. 106-19a.-BhattaP. 19b 31a.-Tand. 31b-53a.--Samth. 536-61a.-Gaccha. 61b-70b.--Gani Vi. 705-75b.Dev Tha. 76a-96a.-Marana Vi. 96a-142b. BORI 3886 / X.B. Jaina texts 1984 <1987> Mahapaccakkhana, Paimnayasuttaim JAS 17 (Part 1), p. 164-169. 163
Page #184
--------------------------------------------------------------------------
________________ Painnas / Prakirnakas Edition based on four manuscripts (the oldest being from the 13th cent. Vikram] (English Introduction 84). 1991-92 *Mahapaccakkhanapainnayam: Mahapratyakhyana-prakirnaka : Muni Punyavijayaji dvara sampadita mulapatha / [Hindi] anuvadaka Suresa Sisodiya ; bhumika Sagaramala Jaina, Suresa Sisodiya. 1. samskarana. Udayapura : Agama Ahimsa-Samata evam Praksta Samsthana, 1991-92.8, 56, 47 p. ; 23 cm. (Agama Samsthana granthamala ; 7). [DKS-4381. DK Agencies, Recent Sanskrit, Prakrit and Pali publications from India, CIR-1378/1994-95, item 74] 3.15 Maranavibhatti (or Maranasamahi) (Marana Vi.) 656 gathas, also called Maranasamacari (JRK 301b-302a); 661 verses (BORI Cat. 17:1, 382). "v. Kamptz [Uber die vom Sterbefasten handelnden alteren Painna des JainaKanons., 1929) ... did not include in his investigations the (Marana Vi.), a late but important text, the composition of which deserves a special study" (Alsdorf, 1966 (Utt, study), 163 n.2). Editions: 1886 *Atha Dasapayanna mula sutra prarambhah / Ganadhara Sudharma Svami sankalitamula sutra ; Tandulavayali 24, Devinddastava 25, Ganivijja 26, Causarana 27, Santhara 28, Aurapaccarakana 29, Bhattaparijnana 30, Candravijja 31, Mahapaccarakana 32, Maranavibhatti 33 : Pratapaji karake samsondhita (sic). Banarasa : Jaina Prabhakara Presa, Samvat 1942. [Isavi] 1886.73 [i.e. 146] p. ; 13 x 32 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 24-33). [Univ. of Chicago Library catalogue] "Edition collective des dix painnas, avec commentaire et gloses" (Guerinot 1906 $239). "[E]asily the worst text ever printed in India--so hopelessly faulty that large portions remain wholly unintelligible" (Alsdorf 1966 Utt. study 207nl). "[L]e text ... est tres corrompu, pratiquement incomprehensible sans le secours des manuscrits ou d'autres editions. Consulte a la lumiere de ces derniers, il fournit des indications utiles, confirme telle tradition ou telle interpretation" (Caillat, Cand. 1971, 19). 1927 Srutasthavirasutritam Catuhsaranadimaranasamadhyantam Prakirnakadasakam chayayutam. Bomday (sic) : Shree Agamoday Samiti, Vira sam. 2453. Vikrama sam. 1983. San 1927. [Agamodaya Samiti ; 46). Contents: Causar. la-5a-AuraPacc. 5a-10a.-Maha Pacc. 106-19a.-BhattaP. 19b 31a.--Tand. 31b-53a.--Samth. 536-61a.-Gaccha. 616-70b.--GaniVi. 700-75b.DevTha. 76a-96a.-Marana Vi. 96a-142b. BORI 3886/X.B. Jaina texts 1984>>1987> Maranavibhatti, Painnayasuttaim JAS 17 (Part 1), p. 99-169. Edition based on four manuscripts [the oldest being from the 13th cent. Vikram] (English Introduction 84). Pajjantarahana see Arahanasara 3.16 Samtharaga (Samth.) "Santhara, 'the pallet of straw upon which the sage, sick unto death, stretches himself in order to meditate, in 122 [Prakrit) verses" (Winternitz 1933:2, 459). Title: Samstaraka (Skt). Exegesis: 16.1 Gunaratna Suri, of the Tapa Gaccha Avacuri (JRK 408b). 16.2 Bhuvanatunga, pupil of Mahendra suri of the Ancala Gaccha, Avacuri (JRK 408b). 16.3 Samaracandra, pupil of Parsvacandra (= Amaracandra? (BORI Cat. 17:1, 294)), Balavabodha, written sam 1603 (JRK 408b). 16.4 Harsakula, Balavabodha (IRK 408b). 16.5 Tika. (JRK 408b). 164
Page #185
--------------------------------------------------------------------------
________________ Editions: 1886 *Atha Dasapayanna mula sutra prarambhah / Ganadhara Sudharma Svami sankalitamula sutra ; Tandulavayali 24, Devinddastava 25, Ganivijja 26, Causarana 27, Santhara 28, Aurapaccarakana 29, Bhattaparijnana 30, Candravijja 31, Mahapaccarakana 32, Maranavibhatti 33 ; Pratapaji karake samsondhita (sic). Banarasa : Jaina Prabhakara Presa, Samvat 1942. (Isavi] 1886. 73 i.e. 146 p. ; 13 x 32 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 24-33). (Univ. of Chicago Library catalogue] "Edition collective des dix painnas, avec commentaire et gloses" (Guerinot 1906 $239). "[E]asily the worst text ever printed in India--so hopelessly faulty that large portions remain wholly unintelligible" (Alsdorf 1966 Utt, study 207nl). "[L]e text ... est tres corrompu, pratiquement incomprehensible sans le secours des manuscrits ou d'autres editions. Consulte a la lumiere de ces derniers, il fournit des indications utiles, confirme telle tradition ou telle interpretation" (Caillat, Cand. 1971, 19). 1922 Pratnapurvadharanirmitam Sritandulavaicarikam Srimadvijayavimalaganidybdhavittiyutam, savacurikam ca Catuhsaranam. Bombay: Sheth Devchand Lalbhai Jain Pustakoddhar Fund, Virasamvat 2448. Vikramasamvat 1978. Kraista 1922.78 [ie. 156) p. ; 12 x 27 cm. (SresthiDevacandra-Lalabhai-Jaina pustakoddhare granthanka ; 59). Contents: Srutasthaviradebdham Tandulavaicarikaprakirnam la-57a.- (Catuhsarana with Avacuri] 576-78a.-Visayanukramanika 776-78a. "Prati 1000." BORI 2768 and 38 208 1927 Srutasthavirasutritam Catuhsaranadimaranasamadhyantam Prakirnakadasakam chayayutam. Bomday (sic) : Shree Agamoday Samiti, Vira sam. 2453. Vikrama sam. 1983. San 1927. [Agamodaya Samiti ; 46). Contents: Causar. 1a-5a-AuraPacc. 5a-10a.-MahaPacc. 106-19a.-BhattaP. 19b31a.-Tand. 31b-53a. Samth. 536-61a.-Gaccha. 616-70b.--GaniVi. 705-75b.DevTha. 76a-96a.-Marana Vi. 96a-142b. BORI 3886 / X.B. Jaina texts 1984<<1987> Samthara, Painnayasuttaim JAS 17 (Part I), p. 280-291. Edition based on five manuscripts (the oldest being from the 13th cent. Vikram) [English Introduction 84. See also p. 118-19] 3.17 Saravalt Painnaya (SaraPa.) 116 gathas (JRK 435a); 136 slokas (BORI Cat. 17:1, 386). 1984<<1987> Saravali. Painnayasuttaim JAS 17 (Part I), p. 350-60. Edition based on four manuscripts (the oldest being from the 16th cent. Vikram] [English Introduction 87. See also p. 121-22.] 3.18 Tandulaveyaliya (Tand.) "[Tand.) in mixed verse and prose, is a dialogue between Mahavira and Goyama on physiology and anatomy, the life of the embryo, the ten ages of man, the measure of length and that of time, the number of bones and sinews, etc" (Winternitz 1933:2, 46061). 400 gathas (JRK 157a). Most of the prose portions are from the Vyakhyaprajnaptisatra ... verbatim (1984 <1987> JAS 17:1. Introduction p. 91). Title: Tandulavaicarika (Skt). 18.1 Exegesis: Vijayavimala Gani = Vanararsi, pupil of Anandavimala Gani of the Tapa Gaccha Avacuri (JRK 157b). Published Tand. 1922. 18.2 Tika, by a pupil of Visalasundara in samvat 1655 [1598), based on Vijayavimala Gani's Avacuri above (JRK 157b). 18.3 Avacuri (IRK 157b). 165
Page #186
--------------------------------------------------------------------------
________________ Painnas/Prakirnakas Editions: 1886 1922 1927 1949 1969 *Atha Dasapayanna mula sutra prarambhah / Ganadhara Sudharma Svami sankalitamula sutra; Tandulavayali 24, Devinddastava 25, Ganivijja 26, Causarana 27, Santhara 28, Aurapaccarakana 29, Bhattaparijnana 30, Candravijja 31, Mahapaccarakana 32, Maranavibhatti 33; Pratapaji karake samsondhita [sic]. Banarasa : Jaina Prabhakara Presa, Samvat 1942. [Isavi] 1886. 73 [i.c. 146] p.; 13 x 32 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 24-33). [Univ. of Chicago Library catalogue] "Edition collective des dix painnas, avec commentaire et gloses" (Guerinot 1906 SS239). "[E]asily the worst text ever printed in India-so hopelessly faulty that large portions remain wholly unintelligible" (Alsdorf 1966 Utt. study 207n1). "[L]e text ... est tres corrompu, pratiquement incomprehensible sans le secours des manuscrits ou d'autres editions. Consulte a la lumiere de ces derniers, il fournit des indications utiles, confirme telle tradition ou telle interpretation" (Caillat, Cand. 1971, 19). Pratnapurvadharanirmitam Sritandulavaicarikam Srimadvijayavimalaganidrbdhavrttiyutam, savacarikam ca Catuhsaranam. Bombay: Sheth Devchand Lalbhai Jain Pustakoddhar Fund, Virasamvat 2448. Vikramasamvat 1978. Kraista 1922. 78 [ic. 156] p. ; 12 x 27 cm. (SresthiDevacandra-Lalabhai-Jaina pustakoddhare granthanka; 59). Contents: Srutasthaviradrbdham Tandulavaicarikaprakirnam 1a-57a. [Catuhsarana with Avacuri] 57b-78a.-Visayanukramanika 77b-78a. "Prati 1000." 1991 BORI 2768 and 38 208 Srutasthavirasutritam Catuhsaranadimaranasamadhyantam Prakimakadasakam chayayutam. Bomday [sic] Shree Agamoday Samiti, Vira sam. 2453. Vikrama sam. 1983. San 1927. [Agamodaya Samiti; 46]. Contents: Causar. la-5a.-AuraPacc. 5a-10a.-MahaPacc. 10b-19a.-BhattaP. 19b31a. Tand. 31b-53a.-Samth. 53b-61a.-Gaccha. 61b-70b.-Gani Vi. 70b-75b.DevTha. 76a-96a.-Marana Vi. 96a-142b. Tandulaveyaliya : ein Painnaya des Jaina-Siddhanta : Textausgabe, Analyse und Erklarung/ von Walther Schubring. Mainz: Verlag der Akademie der Wissenschaften und der Literatur ; Wiesbaden: In Kommission bei F. Steiner, 1969. 32 p. ; 24 cm. (Akademie der Wissenschaften und der Literatur : Abhandlungen der Geistes- und Sozialwissenschaftlichen Klasse; Jahrg. 1969, nr. 6). Review. Colette Caillat. Journal asiatique 260 (1972) 414-17.-Gustav Roth. OLZ 78 (1983) 489-93 [Reprinted in Roth 1986, 445-47]. ANU PAMPHLET PK5003.A54T3 1969 1984 <1987> Tandulaveyaliya. Painnayasuttaim JAS 17 (Part I), p. 35-65. Edition based on five manuscripts, [the oldest being from the 13th cent. Vikram] (English introduction p. 82). BORI 3886/X.B. Jaina texts *[Text (?) with meaning in Hindi ('bhavartha')]. Bikanera: Sve. Sa. Jaina Hitakarini Samstha, Vi. sam 2006 [1949]. [Muni Devendra 1973, 724 item 2] *Tandulaveyaliyapainnayam = Tandulavaicarika-prakirnaka / Punyavijayaji dvara sampadita mulapatha; anuvadaka Subhasa Kothari; bhumika, Sagaramala Jaina, Subhasa Kothari. 1. samskarana. Udayapura: Agama Ahimsa-Samata evam Prakrta Samsthana, 1991. 7, 34, 68 p. ; 23 cm. (Agama Samsthana granthamala; v. 5). [LC catalogue] Studies: Caillat, Colette. 1974a. Sur les doctrines medicales du Tandulaveyaliya : 1 Enseignements d'embryologie. Indologica Taurinensia 2 (1974) 45-56. Caillat, Colette. 1974b. Sur les doctrines medicales du Tandulaveyaliya : 2 Enseignements d'anatomie. Adyar Library bulletin 38 (1974) 102-14. 166
Page #187
--------------------------------------------------------------------------
________________ 3.19 Tithogali (Titho.) 1233 gathas, not usually counted among the ten principal Prakirnakas (JRK 161a). Editions: 1974-75 *[Titthogali. "Critical edition" with Sanskrit chaya and Hindi translation /Kalyanavijayaji (Bhojak strongly queries whether this scholar was seriously involved in the work)], Tha. Gajasimha Rathod). Jalore : Svetambara (Cara Thui) Jaina Sangha, Vira Samvat 2500 (1974-75).) [1984<<1987> JAS 17:1. Introduction / A. M. Bhojak p. 123-34] Bhojak says this edition is full of errors and he has taken time to list numerous bad emendations by the editor(s). 1984 <1987> Titthogali. Painnayasutta im JAS 17 (Part I), p. 408-523. Edition based on four manuscripts [the oldest 'Sam.' being from 1452] (English Introduction 89-90. See also p. 122-39). Studies: Malvania, Dalsukh. 1969. Study of Titthogaliya, Proceedings of the 23rd All-India Oriental Conference, 1966. Pune : BORI, 1969. p. 332-41. Gives an analysis of the contents based on a MS copy. ANU PJ21.A5 23rd (1966) 3.20 Viratthaya (VITha.) 43 gathas enumerating the names of Mahavira (Winternitz 1933:2, 461; JRK 363b). Title: Virastava (Skt). 1984 <1987> Viratthaya. Painnayasuttaim JAS 17 (Part I), p. 292-97. Edition based on four manuscripts (the oldest being from the 13th cent. Vikram] [English Introduction 84. See also 119.) 1995 *Viratthaopainnayam= Virastava-prakirnaka/Muni Punyavijayaji dvara sampadita mulapatha ; anuvadaka Subhasa Kotharl : bhumika Sagaramala Jaina, Subhasa Kothari. Samskarana 1. Udayapura : Agama-Ahimsa-Samata evam Prakrta Samsthana, 1995. 55 p. : 22 cm. (Agama Samsthana granthamala ; 12). [DKS-5222. DK Agencies Recent Sanskrit, Prakrit and Pali publications Ref. No. CIR-1585 / 1996-97, item 73] Hindi translation: Subhasa Kothari (ViTha.1995) 167
Page #188
--------------------------------------------------------------------------
________________ Painnas / Prakirnakas 4 LATE PRAKIRNAKAS 3.21 Arahana-sulasasavaya (?) = Arahanakulaya? 1984<1987> Arahanakulaya. Painnayasuttaim JAS 17 (Part II), p. 244. 3.22 Arahanapayarana (ArahPag.)- Abhayadeva Aradhanakulaka in 85 gathas by Abhayadeva Suri, pupil of Jinesvara Suri (JRK 32b). 1984 <1987> Arahanapagarana, Painnayasuttaim JAS 17 (Part II), p. 224-31. Edited on the basis of two palm leaf manuscripts from Jaisalmere (English Introduction p. 35-36). 3.23 Divasagarapannatti (Divasagarapannatti) 225 gathas [1984<<1987> JAS 17:1, 118] Editions: 1946 *[Edition by Candanasagara). Vejalpur (Gujarat]: Candanasagara Jnana Bhandara, Vira samvat 2472 [1946). [1984_<1987> JAS 17:1, English Introduction p. 85) 1984 <1987> Divasagarapannatti, Sangahanigahao. Painnayasuttaim JAS 17 (Part 1), p. 257-79. Edition based on three manuscripts (the oldest being from the 16th cent. Vikram] [English Introduction 85. See also 118.] 1993 *Divasagarapannattipainnayam = Dvipasagaraprajnapti-prakirnaka / Muni Punyavijayaji dvara sampadita mula-patha ; anuvadaka Suresa Sisodhiya ; bhumika Sagaramala Jaina, Suresa Sisodiya. Samskarana 1. Udayapura : Agama-Ahimsa-Samata evam Praksta Samsthana, 1993. 6, 76, 54 p. ; 22 cm. (Agama Samsthana granthamala ; 8). [DKS-5216. DK Agencies Recent Sanskrit, Prakrit and Pali publications Ref. No. CIR-1585 / 1996-97, item 70] "Verses on mountains and seas in Jaina tradition (mythology); with a critical study with parallels from Hindu mythology" (DK listing). Translation: Hindi 1993 Suresa Sisodhiya (Divasagarapannatti.1993) Study: Kirfel, W. 1924. *["Paper on the origin of the Divasagarapannatti"). ZII 3 (1924) 50-80. IJ. Deleu. 1987-88. A further inquiry into the nucleus of the Viyahapannatti, Indologica Taurinensia 14 (1987-88) 169-79. p. 170 n.2] 168
Page #189
--------------------------------------------------------------------------
________________ 169
Page #190
--------------------------------------------------------------------------
________________ Author: Attributed to Devavacaka.2 Content: Presents the various traditions of epistemological discussion and interpretation. References: Nandi. 1968 Introduction/Dalsukh Malvania; JSBI 303-22; BORI Cat. 17:2, 294; Schubring 1935 $53. Exegesis: 1 2 3 4 1 5.1 NANDISUTTA (NandI.)' Jinadasa, Ksamasramana, Curni (NandiCu.) composed Saka 598 [676] according to its colophon, 1 500 granthas (JRK 201; JSBI 3, 214-15). 1928 *[Nandi Curni with Haribhadra's Vrtti / edited by Sagarananda Suri.] Ratalama : Rsabhadevaji Kesarimalaji Svetambara Samstha, Vikrama samvat 1984 [1928]. [JSBI 2, 304u. 1966b 1 (Prastavana); DLJP series list] Since the editor did not have a good MS source it is printed with many errors but was still used as a comparison for Nandi 1966b (Prastavana, 2). Printed. Nandi.1966a. Niryukti (JRK 201). Haribhadra (700-770 CE) said to have used NandiCu. (BORI Cat. 17:2, 300), Vivarana or Laghuvrtti, 2 336 granthas (JRK 201 which says this Haribhadra was a pupil of Jinabhadra, Muni Punyavijaya however thinks the author is Yakini-mahattara-dharma-sunu Haribhadra (1966b, 3)).3 Printed NandiCu. 1928 and Nandi. 1931; 1966b. 3.1 Sricandra, pupil of Dhanesvara, pupil of Salibhadra, commentary on Haribhadra's Vivarana, Vrtti-Tippana, 3 300 granthas, also called Durgapadavyakhya (JRK 201). Printed Nandi. 1966b. 1969 *Srinandisutrasya Durgapadavyakhya : Haribhadriyakrtteh kathinasthalanam visistavivaranarupa / Candrasuripranita. Prathamavrttih. Surata: Devacandra Lalabhai Jainapustakoddhara Samstha, 1969. 6, 100 p. ; [1] leaf of plates: 1 col. port. ; 25 cm. (Sresthi Devacandra Lalabhai Jaina pustakoddhare; granthankah; 113). 3.2 Visamapadatippanaka, attributed to Candrakirti Suri at first by Muni Punyavijaya, but he later changed his mind on the basis of further research and said authorship of this cty was not settled (Prastavana 1966b. 11-12). Printed Nandi. 1966b. Malayagiri, Tika (mentions both NandiCu. and Haribhadra's Vivarana) 7 732 granthas (JRK 201).5 Editions of which the details have not yet been traced (1) *[Mula. Bikanera: Sethiya Jaina granthalaya.] [JSBI 2: 303n1] (2) *[Mula. Dehali : Mahavira Jaina Bhandara.] [JSBI 2: 304 n.1]-(3) *[Mula / Sadhvi Sitakumvaraji. Udayapura, Rajasthana: Sri Taraka Guru Jaina granthalaya] [Devendra Muni 1977, 719 item 9] 2 Muni Jambuvijaya has drawn attention to the fact that at the time of Simhasuri's commentary on Mallavadin's Dvadasaranayacakra-prior to the council of Valabhi-parts of the Nandisutra were identified as bhasya, however the text as handed down does not have such a division now (Mallavadi. Dvadasaranayacakra / edition by Muni Jambuvijaya 1966-88: 1, Sanskrit Prakkathana, 24). 3 The commentary by Hemacandra Maladharin is no longer extant, but it "must have been a cty on the Nanditika of Haribhadra, dealing with the five kinds of knowledge" (E. A. Solomon, Ganadharavada, 1966, p. 17). Kapadia's comment that this is "A small gloss on Nandisutra" [BORI Cat 17:2, 307] seems to be mistaken. 5 A section of the commentary (the refutation of theism) is given by F. C. Schrader, Uber den Stand der indischen 4 Philosophie zur Zeit Mahaviras und Buddhas, p. 62 ff. (Winternitz 1933:2, 472 n.2). "... The story of the *Judgement of Solomon' has been translated according to the Antarakathasangraha by L. P. Tessitori in Indian antiquary 42 (1913), 148 ff. together with another Jinistic recension (from Malayagiri's commentary on the Nandi-sutra). Hertel (Geist des Ostens 1 (1913) 189 ff. compares the Jinistic recension with the Hebrew one ..." (Winternitz 1933:2, 544 n.1).
Page #191
--------------------------------------------------------------------------
________________ Epistemological works Is this the Nandisutra with the commentary of Malayagiri, s.l. s.d." (Balbir 1993, 22). Printed Nandi. 1878; 1917; 1924; 1969; 1987b. Study: Jambuvijaya. 1994. Quotations in Malayagiri's commentary on the Nandisutra = Jainagamasya Nandisutrasya Acaryasri Malayagirisuriviracitayam vsttau uddhstanam darsanikanam pahanam mulasthanani. WZKS 38 (1994) 389-401. Identification of more than 75 quotations, some have been matched to sources such as the Vartalankara, Sastra vartasamuccaya, Mimamsaslokavartika, Vaisesikasutra, Pramanavartika, Tattvarthakarika, etc. Devyasuri (Devasuri/Yasodevasuri?), Avacuri, 1 605 granthas (JRK 201). Jayadayala, Nutana Vrtti (JRK 201). Tika (JRK 201). Visamapadaparyaya (JRK 201; BORI Cat. 17:2, 308-10). Printed Nandi. 1966b. Parsvacandra, Balavabodha (JRK 201. = BORI Cat. 17:2, 297?). 9 Partial commentaries on the Sthaviravali portion Jnanasagara, Nandyavacuri (Schubring 1944, 41.] 2 Avacuri, Tabba (Gujarati), and Balavabodha are listed in BORI Cat. 17:2, 314-21. Editions: 1878 *Nandi-sutra / Ganadhara-Sudharmasvami-krta-mula-sutra tadupari Sri-Malayagiri-ksta tika, tadupari bhasa Valavodhasameta; Sribhagavan Vijayasadhuna samsodhitam. Kalikata : Nutanasamskrta Yantra, samvat 1935 (1878). p. [1], 520 p. ; 13 x 30 cm (RayaDhanapatisimha-Bahadura-ka Agama-samgraha ; v. 15). [CLIO 2, 1715) Series no. 45 (Emeneau 3950. JSBI 2: 3041). Glose hindie (Guerinot 1906 $249). 1880 (Univ. of Chicago catalogue). 1917 *sriman-Malayagiry-Acarya-vihita-vivarana-yutam Srimad-Devavacaka-Gani-drbdham sriman-Nandi-sutram ... Bombay: Nirnaya-sagara Press, Vikramasamvat 1974 [1917). 2, 254, [1] [ie. 4, 508, 2] p. ; 12 x 27 cm. (CLIO 2, 1715; Nandi.1968, 79 (fourth group); An Illustrated AMg. dictionary 1923-38: 1, xxxiii, item 25] The Agamodaya Samiti series ; no. 16 (BORI Cat. 17:2, 294). Apparently reprinted as Nandi. 1924 below. 1919 *Nandi sutra / Amolaka Rsiji Maharaja Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919. 211 p. ; 13 x 23 cm. Sukhadevasahaya Jvalaprasada, Vi. sam. 2446 [1920] (JSBI 2, 304a). 1920 *Mula, without commentaries/Muni Sri Jnanasundara. Surat: Shah Maneklal Anupchand, V. 2447. V.S. 1977 [1920]. [Schubring 1935 $53). "Critical edition" (Nandi.1968, 103 (fourth group) note 12 item 2). 1924 Srimanmalayagiryacaryapranitavrttiyutam Srimaddusyaganisisyacaryavaryasrimaddevavacakaksamasramananirmitam Srimannandisutram. Bombay: Agamoday-Samiti, Virasamvat 2450. Vikramasamvat 1980. San 1924. 254 [ie. 508) p. ; 12 x 27 cm. "[Edited by Agamoddharaka Sri Sagaranandasuri. This edition has been published by Agamodaya Samiti, Surat, in 1973 [1916] V.S. [ie. presumably this is a reprint of Nandi.1917 above)" (Nandi.1968, 79 (fourth group)). "Prati 750." BORI 2685 *Mula with Haribhadra's Vitti, edited by Acarya Vijayadana Suri.] [s.l.) : Bhai Sri Hiralala, Vikrama samvat 1988[1931). [Nandi. 1966b, Prastavana Da. prati'. Nandi.1968, 103 (fourth group) note 12 item 3] 1931 170
Page #192
--------------------------------------------------------------------------
________________ 5.1 Nandisutra 1935 *[Mula / Yati Sri Chotelala.] Ajmera, V. S. 1991 [1935.) [JSBI 2, 303n1. Nandi.1968, 103 (fourth group) note 12 item 4) 1938 *[Mula / Hiralala Hamsaraja. Jamanagar, 1938. [JSBI 2, 303n1] 1941 Mula. Bikanera. Jivana Sreyaskara Pathamala, 1941. [JSBI 2, 303-4n 1] 1942a *[Mula critically edited Samskrta chaya, Hindi tika, Tippani etc. / Muni Hastimallaksta. Satara : Rayabahadura Motilala Mutha, V.S. 1998 [1942). [JSBI 2,304i; Nandi.1968, 103 (fourth group) n. 12 item 5] 1942b *|Printed edition contained in Agamaratnamanjusa, of the Sutra-version engraved in the marble walls of the Agamamandira, Palitana, VS 1999 [1942] edited by Sagarananda Suri. [Nandi.1968, 103 (fourth group) note 12 item 6, 113-14] "[C]opies of the Agamaratnamanjusa are very few" (Nandi.1968, 114 (4th group)). 1953 Mula suttani : Sri Dasavaikalika sutra, Sri Uttaradhyayana sutra, Sri Nandisutra tatha Sri Anuyogadvara sutra ka suddha mulapatha / sampadaka Kanhaiyalalaji Maharaja 'Kamala'. Prathamavrtti. Byavara, Gurukula Printinga Presa, Vira samvat 2479 [1953). 52, 588 p.; 20 cm. Bare text, Nandisutta, p. 273-336. Reprinted 1975? "1000 (copies)." ANU PK5003.A58 1954 [sic] 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie ; [sutthuruvena] Pupphabhikkhuna sampadio. 1. avitti. Gudagamva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354.2 v. ; 19 cm. Nandisuttam v.2, [1061)-1083. ANU BL1310.58 1954 2 v. 1958a *[Mula.) Agara : Sanmati Jnanapitha, 1958. [JSBI 2, 303-304n 1] 1958b *[Nandi sutra with Muni Ghasilalaji's Sanskrit Vyakhya (Jnanacandrika) and his Hindi and Gujarati translations. Rajkota : Jaina Sastroddhara Samiti, V.S. 2014 (1958). [JSBI 2, 304u. Nandi.1968,103 (fourth group) note 12 item 9; NCC 9, 337b] "The study of Ghasilaji's commentaries on the Agamas makes it quite clear that to determine and finalise the original readings of the Agamas is not his aim in publishing the texts of the Agamas. We have been disheartened whenever we have even cursorily read his editions of the Agamas. Hence we deem it proper to say something even digressing from the topic in hand. "Ghasilalji has not the slightest respect for the ancient commentators whose commentaries he has profusely utilized in writing his own. Not only that but he has no respect even for the authors of the Sutras. He has studied the old commentaries not with the seriousness and attention they require. Hence his own commentaries are fraught with horrible mistakes" (Nandi. 1968, 105 (fourth group)). "Those Sthanakavasi Jain monks, who have favoured him with their kind opinions, seem not to have read his commentaries." (Nandi. 1968, 106 (fourth group)). Reprint 1976. 1960 or 1961 *[First edition of Nandi.1966d.) (Nandi.1966d, 6). 1966a Nandisuttam : Sirijinadasaganimahattaraiviraiyae Cunnie samjuyam / samsodhakah sampadakas ca Munipunyavijayah. Varanasi : Prakrta Grantha Parisad, Virasamvat 2492 [1966]. [1], 16, 103 p. ; 3 leaves of plates ; 28 cm. (Prakstagranthaparisad granthanka ; 9). Contents: Prakasakiya nivedana / Dalasukha Malavaniya [1].-Prastavana / Muni Punyavijaya 1-13.-Curniyukta Nandisutra ka vinayanukrama (14)-16.-Nandisuttam 1-83.-[Appendixes) 1. Nandisutrantargatanam sutragathanam akaradivarnakramena anukramanika (85)-86.-2. Nandisutracurnyantargatanam uddharananam akaradivarnakramena anukramanika [87]-88.-3. Nandisutracurnigatani pahantaramatantarnidarsakani sthanani. 88.-4. Nandisutra-taccurnyantargatanam grantha 171
Page #193
--------------------------------------------------------------------------
________________ Epistemological works granthakara-sthavira-nrpa-sresthi-nagara-parvatadinam akaradivarnakramenanukramanika [89]-95.-5. Nandisutra-taccurnyantargatanam vinaya-vyutpattyadidyotakanam sabdanam akaradivarnakramenanukramanika [96]-101.-Curnisamanvitasya Nandisutrasya Suddhipatrakam [102]-103. ANU LARGE BOOK PK5003.A56 1966j 1966b Nandisutram : Sri-Sricandracaryakrtadurgapadavyakhya-ajnatakartrkavisamapadaparyayabhyam samalarkrtaya Acaryasriharibhadrasurikrtaya Vrttya sahitam / samsodhakah sampadakas ca Munipunyavijayah. Varanasi: Praksta Grantha Parisad, Virasamvat 2493 [1966]. 16, 218, 2 p. ; 1 leaf of plates ; 28 cm. (Prakstagranthaparisad granthanka 10). Contents: Prakasakiya nivedana / Dalasukha Malavaniya [1].-Prastavana / Muni Punyavijaya. [11-13.-Haribhadri Vrtti sahita Nandisutra ka vinayanukrama [14]-16.Nandisutram [1]-97.--Maladharisti-Candrakulina-Sricandrasurivinirmitam Yakinimahattarardhasunusriharibhadrasuripranitayah Nandisutravrtteh tippanakam. [99]169.-Sri-Sricandra surivinirmitatikasameta Laghunandih-Anujnanandih. [170]-179.Joganandi [180]-181.-Acaryasrivimalasurisisyasri-Candrakirtisuriviracitam? Yakinimahattarardhasunusriharibhadrasuripranitayah Nandisutravitteh visamapadatippanakam [182]-186.-[Appendices) 1. Nandisutrantargatanam sutragathanam akaradivarnakramenanukramanika [187]-188.-2. Nandiharibhadri vrtti-taddurgapadavyakhyaLaghunandivittyantargatanam uddharananam akaradivarnakramenanukramanika (1891- 194.--3. Nandisutramula-Haribhadrivstti-Ha.vr.durgapadavyakhya-Ha.vr.visamapadatippanakasavsttilaghunandiyoganandimulantargatanam visesanamnam akaradivarnakramenanukramanika (195)-203.-4. Nandisutravittyadyantargatani pathantaramatantara-vyakhyantaravedakani sthanani. 203.-5. Nandisutramula-Haribhadrivrttyadyantargatanam vyakhyatavyakhyatasabdanam akaradikramenanukramanika [204)-216.-Suddhipatrakam [217]-218. ANU LARGE BOOK PK5003.A56 1966h 1966C Srinandisutram : Samskrtacchaya-padartha-bhavarthopeta-Hindibhasatikasahitan ca/ vyakhyakara Atmarama ji ; sampadaka Muni Sri Phulacandaji 'Sramana'. Ludhiyana : Acarya Sri Atmarama Jaina Prakasana Samiti, Vira sam. 2022 [1966]. 24, 103, 380 p. ; 2 leaves of plates ; 24 cm. (Jainasastramala 8). Contents: Prakasakiya[1].-Donor list (5)-6.-Anadhyayakala [7]-9.-Guvvavali (26 Prakrit verses by Munivikkamo'] [10]-11.-Vyakhyakara ke do sabda / Atmarama 112].-Prakkathana [131-15/Acarya Ananda Rsi. .. Sriatmaramaji Mahara jasanksipta jivana paricaya / Muni Phulacanda 'Sramana' [17]-24.-Nandisutra-digdarsana (1) 68.- Siri Nandisuttam (Bare text] [69]-103.-Nandisutram [Text, chaya, padartha etc.) 1-361.-Parisista 1. [Collection of quotations from other Agamas which Atmarama considers the bases for the Nandisutra] [362]-371.-Parisista 2. Siddha-Srenikaparikarma ke 14 bhedom ki sanksipta vyakhya. [372]-380. "Prathama vrtti 1000." Atmarama b. Bhadrapada Sukla 12. Vi. sam. 1939. d. Maghavadi 9, sam 2018 (18821961?] (plate facing page 17). "In Appendix I given at the end of this translation various relevant passages from the pre-Nandi Agamas are collected ... passages from the Sthananga, the Samavayanga, the Bhagavati and the Anuyoga which (Atmaramaji] considers to be sources of the Nandisutra. His suggestion seems to be legitimate" (Introduction, Punyavijaya, Malvania, Bhojak, Nandi.1968, 37 (fourth group)). ANU PK5003.A56 1966p 1966d Nandi sutra / vivecaka Munisri Parasakumaraji Maharaja. Dvitiyavytti. Sailana, Madhya). Pra[desa). : A[khila). Bha[ratiya). Sadhumargi Jaina Samsksti Raksaka Sangha, Vira samvat 6 On the basis of further research, Muni Punyavijaya in the Prastavana to Nandi.1966b, changed his mind about this epithet and asked readers to add the epithet here in square brackets (Prastavana p. 12). ! As in the previous note, Muni Punyavijaya changed his mind about this attribution and asked readers to remove it, considering the authorship of this super-cty still to be an open question (Prastavana p. 12). 172
Page #194
--------------------------------------------------------------------------
________________ 5.1 Nandisutra 2492 (1966). 18, 509 p. ; 18 cm. Contents: Prakasakiya nivedana (51-6.-Anuvadaka ke sabda [7].-Visayanukramanika [8]-13.-Mulapatha ka suddhi patra (14)-15. Hindi anuvada ka suddhi patra 15-16.Asvadhyaya [list of occasions on which not to study the scriptures] [17]-18.-Text [1]476.-Anujnanandi 477-505.--Laghunandi (without translation] 506-509. "1000 copies]." First edition was printed six years ago, therefore in 1960 or 1961. Corrections to the Hindi translation have been made since then. The translator is Parasakumara, pupil of Muni Lalacanda and Sri Kevalamuni (p. 6, (1st group)). The exemplary stories (from Malayagiri's commentary?) are given in Hindi. ANU PK5003.A56 1967 [sic] 1968 Nandisuttam : Siridevavayagaviraiyam. Anuogaddaraim ca : Siriajjarakkhiyatheraviraiyaim/ sampadakah Punyavijayo Munih ; Dalasukha Malavaniya, Amstalala Mohanalala Bhojaka ity etau ca. Bambai: Sri Mahavira Jaina Vidyalaya, Vira sam. 2494 [1968]. 11, 54, 70, 127, 22, 467 p. ; 25 cm. (Jaina-Agama-granthamala; granthanka 1). Contents: Prakasakiya nivedana (Gujaratil 1-6.-Granthanukrama 171-11.Sampadakiya 1-54. Prastavana / Muni Punyavijaya, Dalsukh Malvaniya, Amrtlala Mo. Bhojaka 1-70.-Introduction [English version of Prastavana by Nagin J. Shah (p. 127)] 1-76.-Editor[s'] note [English version of Sampadakiya by Nagin J. Shah (p.127)] 77-127.-Nandisutra-Laghunandisutrayoh sanketasucih [1].--Anuyogadvarasutrasanketasucih [2].-Nandisutrasya visa yanukramah 3-7.-LaghunandiAnujnanandivisayanukramah[8].--Yoganandivisanukramah [9].-Anuyogadvaranam visayanukramah [10]-22.-Nandisuttam 1-48.-Laghunandi-Anunanandi [49]-53.Joganandi (541-55.-Anuogaddaraim (571-205.-Parisitthaim. Nandisuttaparisitthaim 1. Gahanukkamo [209]-210.- 2. Saddanukkamo-sakkayatthasahio (see comments p. 86-87 (4th group) for explanations (211)-265.-3. Visesanamanukkamo. [266]-273.4. Cunnikarainidditthapadhantarathanaim [274].-1-3 Laghunandi-Anunnanandiparisitthaim. 1. Gahanukammo [275].-2. Saddanukkamo-sakkayatthasahio. [276]282.-3. Visesanamanukkamo. (283).-1-2 Joganandiparisitthaim. 1. Saddanukkamosakayatthasahio. [284)-287.-2. Visesanamanukkamo. (288)-289.-1-18 Anuogaddarasuttaparisitthaim. 1. Gahanukkamo 1290)-292.-2. Saddanukkamo-sakkayatthasahio [293]-454.-3. Visesnamanukkamo [455]-460.-4. Cunnikarainidditthapadhantarathanaim [461].-Suddhipattayam [462]-467. ANU PK5003.A56 1968 - Jambuvijaya, Muni. 1993. The Jaina Agama series. In Jain studies in honour of Jozef Deleu / edited by Rudy Smet and Kenji Watanabe. Tokyo : Hon-no-Tomosha, 1993. xvi, 504 p. 22 cm. p. 1-12. "This article has been compiled on the basis of the introduction of volume 1 (1968) of the Jaina Agama series (Nandisutta)." 1969 *Nandisutram : Devavacakaviracitam : Malayagirikrtatikayah sankseparupa-Avacurya samalankrtam/samosadhakau Vikramasuri-Panyasasribhaskaravijayau. Surata : Devacanda Lalabhai Jainapustakoddhara Samstha, 1969. 42, 247 p. ; 13 x 28 cm. (Sresthi-DevacandraLalabhai-Jaina-Pustakoddhara , granthankah 107). [LC] 1975 Mula-suttini: Dasaveyaliyam, Uttarajjhayanam, Nandi-suttam, Anuogaddaram/nirdesaka Muni Kanhaiyalalaji 'Kamala'; samyojaka Vinaya Muni 'Vagisa.' Sanderava, Rajasthana : Agama Anuyoga Prakasana, Vira samvat 2503 (1975). 730 p. ; 14 cm. Contents: Apni bata [1]-12.-Dasavaikalika-sutrantargata Padyanamanukramanika [1] 13.-Sri Uttarajjhayanasuttam [14]-46.-Parisista 2 (sic). Mula-sutram mem nirdista dpstantam ki akaradi anukramanika 47-52. Dasaveyaliyam [1]-86.-Uttarajjhayanam 87-335.-Nandi-suttam (337) 419.-Anuogaddaram (421)-730. Mula only. Reprint of 1953 edition? Acknowledgements mention Sri Misrimalaji 'Madhukara' and Sobhacandra Bharilla. (p. 11-12 (1st group)). ANU PK5003.A51 1975 173
Page #195
--------------------------------------------------------------------------
________________ Epistemological works 1976 Nandisutram / Ghastlalaji-Maharaja-viracitaya Jnanacandrikakhyaya-vyakhyaya samalankrtam Hindi-Gujara-bhasa'nuvadasahitam niyojakah Srikanhaiyalalaji Maharajah. 2. avstti. Rajkot: Sri A[khila). Bha[rata). Sve[tambara). Sthanakavasi Jainasastroddharasamiti, Vira-samvat 2502. Vikrama samvat 2033. Isavisan 1976.38, 16, 697 p. ; 25 cm. First printed 1958. RW 1977 Svadhyaya-sudha/nirdesaka Kanhaiyalalaji Kamala"; samyojaka Vinaya Muni Vagisa'. Bakhatavarapura Sanderava, Pali, Rajasthana : Agama Anuyoga Prakasana, Vira samvat 2503 [1977). 12, 480 p. ; 15 cm. Contents: 1. Vira-stuti 10-13.- 2. Mulasuttani (1) Dasavedaaliyasuttam 1-86.-3. Mulasuttani (2) Uttarajjhyayana suttam 87-335.-4. Nandi suttam 337-419.-5. Tattvartha sutra 421-443.-6. Bhaktamara stotram 444-453.-7. Sri Kalyana-mandirastotram 545-462.-8. Mahavirastaka stotram 463 464.-9. Sri Cintamani-Parsvanathastotram. 465-467.-10. Sri Ratnakarapancavimsatih 467-469.-11. Acarya Amitagati Suri-krta dvatrimsika 470-476.-12. Subhasita 476-478.-13. Tirthankarastotram 479-- 14. Satistotram 479-480. 15. Uvasa ggahara stotra 480. Compendium of bare texts. ANU BL1310.2. 585 1977 1982 Nandisutra : Sridevavacakaviracita : mulapatha, Hindi anuvada, vivecana, parisista yukta samyojaka tatha pradhana sampadaka Srimisrimalaji Maharaja 'Madhukara'; anuvadanavivecana Jaina Sadhavi Umaravakuivara Arcana' ; sampadana Kamala Jaina 'Jiji.' Byavara, Rajasthana : Sri Agamaprakasana-samiti, Viranirvanasamvat 2508 [1982]. 29, 219 p. ; 25 cm. (Jinagama granthamala, granthanka 12). 2. samskarana. Vira sam. 2517 [1991]. ANU PK5003.A56 1982 1987a Navasuttani: Avassayam, Dasavealiyam, Uttarajjhayanani, Nandi, Anuogadaraim, Dasao, Kappo, Vavaharo, Nisihajjhayanam / vacana pramukha Acarya Tulasi; sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana: Jaina Visva Bharati, Vikrama samvat 2044. I[svi san). 1987. 140, 812, 29, 320 p.: four pages of plates ; 25 cm. Nandi [2451-288. Parisittham 1: Anunjanandi 281-285.-2. Joganandi 286-288. "Original text critically edited" on the basis of three MSS of the text from Shrichand Ganeshdas Gadhaiya, Library, Sardarshahar' dated V.S. 1576, 1600 and 1576- and Nandi. 1968;1966a; 1966b 'described' on p. 22 = 77-78 (1st group). Forms v.5 of a complete edition of the Jaina Agama. ANU NEW BOOKS COLLECTION 1 484 435 *Srimat Nandisutram/Devavacakaganiviracitam ; Malayagirivihita vivaranayutam. Mumbai: Sri Jinasasana Aradhana Trasta, 2044 [1987]. 254 [ie. 508) p. ; 13 x 28 cm. [LC] 1987b 1991 Reprint Nandi.1982. Contents: Samarpana / Madhukara Muni (5).--Prakasakiya / Ratanacanda Modi, Sayaramala Corariya, Amaracanda Modi [71. Sri Agama Prakasana Samiti, Byavara (karyakarini samiti) [8]. [donor details for first edition) 9-10.-Adi vacana (prathama samskarana se) / Muni Misrimala "Madhukara" (Yuvacarya) (11)-14.-Sampadakiya (prathama samskarana se) / Jainasadhvi Umaravakumvara "Arcana" 15-16.Prastavana (prathama samskarana se) / Vijayamuni Sastri [17)-29.-Visayanukrama 31-32.--Siridevavayagaviraiym Nandisuttam [1]-210.-Parisista: Nandisutragathanukrama (211)-212.-Anadhyayakala [[Nandi.1966c, 7-9 se uddhsta) (213)-215. 1997 Nandi : mulapatha, Samskrta chaya, Hindi anuvada, tulanatmaka tippana tatha vividha parisistom se yukta / vacana pramukha Ganadhipati Tulasi; sampadaka, vivecaka Acarya Mahaprajna. Ladanum: Jaina Visva Bharati Samsthana, 1997. 24, 255 p. Contents: Samarpana 5.-- Antastosa / Ganadhipati Tulasi 7.-Prakasakiya / Sricandra Ramapuriya, 16 Oktubara 1997, 9.-Sampadakiya / Acarya Mahaprajna, 28 August 1996, 11.-Bhumika / Ganadhipati Tulasi, Acarya Mahaprajna, 29 Agast 1996, 13- 22.-Visayanukrama 23-24.- Pahala prakarana (gatha 1-44, sutra 1) [1]-31.-Dusara prakarana (sutra 2-33) [33]-76.-Tisara prakarana (sutra 34-54) [77]-106.-Cautha prakarana (sutra 55-73) [107)-129.-Pamcavam prakarana (sutra 74-127)[131]-160. 174
Page #196
--------------------------------------------------------------------------
________________ 5.1 Nandisutta Parisista 1. Anunnanandi-Anujnanandi (sanuvada] [163)-167. -2. JoganandiYoganandi (1981-200.-3. Kathas=drstantal [201]-227.-4. Visesanamanukramadesisabda 12281-237.-5. Padanukrama (238)-239.-6. Tippana : anukrama (240)242.-7. Jnanamimamsa [243]-250.-8. Prayukta grantha suci (251)-255. ANU NBC 2 177 726 Translations: Gujarati: 1958 Ghasilala (Nandi. 1958b) 1976 Ghasilala (Nandi.1976) Hindi: 1878 1942 1958 1966 1966 1976 1982 1997 (Nandi. 1878) Muni Hastimalla (Nandi.1942a) Ghasilala (Nandi. 1958b) Atmarama (Nandi. 1966) Parasakumara (Nandi.1966d) Ghasilala (Nandi.1976) Misrimala 'Madhukara' (Nandi.1982) (Nandi.1997) Indexes: 1928 Nandyadigathadyakaradiyuto visayanukramah: Srinandi-Anuyogadvara-Avasyaka-Oghaniryukti-Dasavaikalika-Pindaniryukti-Uttaradhyayananam sutrasutragathaniryuktimulabhasyabhasyanam akaradikramah arkasuddhih laghubshams ca visayanukramah = An Alphabetical index of the aphorisms etc. occuring in Nandisutra, Anuyogadvara, Avasyaka, Oghanirylukti, Dasavaikalika, Pindaniryukti and Uttaradhyayanasutra : along with detailed lists of subjects treated in these seven Agamas. Mumbayyam : Sri Agamodayasamiteh karyavahakah Jivanacandra Sakaracandra Jhaveri, Virasamvat 2454 (1928). f. 183 [ie. 366 p.) : 12 x 26 cm. (Sri-Agamodayasamiti Granthoddhara , granthakah 55). ANU BL1313.89.N25 1928 1966a (Nandi. 1966a): [Appendixes] 1. Nandisutrantargatanam sutragathanam akaradivarnakramena anukramanika p. [85)-86.-2. Nandisutracurnyantargatanam uddharananam akaradivarnakramena anukramanika (87)-88.-[Appendixes] 1. Nandisutrantargatanam sutragathanam akaradivarnakramena anukramanika (85)-86.-2. Nandisutracurnyantargatanam uddharananam akaradivarnakramena anukramanika (871-88.-3. Nandisutracurnigatani pathantara-matantarnidarsakani sthanani. 88.-4. Nandisutra-taccurnyantargatanam grantha-granthakara-sthavira-nspa-sresthi-nagara-parvatadinam akaradivarnakramenanukramanika (891-95.-5. Nandisutra-taccurnyantargatanam visaya-vyutpattyadidyotakanam sabdanam akaradivarnakramenanukramanika [96]-101.-4. Nandisutra-taccurnyantargatanam grantha-granthakara-sthavira-n;pa-sresthi-nagara-parvatadinam akaradivarnakramenanukramanika [89]-95.-5. Nandisutra-taccurnyantargatanam vinayavyutpattyadidyotakanam sabdanam akaradivarnakramenanukramanika 196)-101. 1966b (Nandi.1966b): Appendices) 1. Nandisatrantargatanam sutragathanam akaradivarnakramenanukramanika p. [187]-188.-2. Nandiharibhadrivrtti-taddurgapadavyakhyaLaghunandivittyantargatanam uddharananam akaradivarnakramenanukramanika (1897- 194.-3. Nandisutramula-Haribhadrivstti-Ha.vr.durgapadavyakhya-Ha.vr.visamapadatippanakasavsttila ghunandiyoganandimulantargatanam visesanamnam akaradivarnakramenanukramanika (195)-203.-4. Nandisutravrttyadyantargatani pathantara-matantaravyakhyantaravedakani sthanani. 203.-5. Nandisutramula-Haribhadrivsttyadyantargatanam vyakhyatavyakhyatasabdanam akaradikramenanukramanika (204)-216. (Nandi.1968): Nandisuttaparisitthaim 1. Gahanukkamo p. [209)-210.-2. Saddanukkamosakkayatthasahio (see comments p. 86-87 (4th group) for explanations (211)-265.-3. Visesanamanukkamo. [266-273.-4. Cunnikarainidditthapadhantarathanaim [274].-13 Laghunandi-Anunnanandiparisitthaim. 1. Gahanukammo (275).-2. Saddanukkamo 1968 175
Page #197
--------------------------------------------------------------------------
________________ Epistemological works 1987 sakkayatthasahio. [276]-282.-3. Visesanamanukkamo. [283].-1-2 Joganandiparisitthaim. 1. Saddanukkamo sakayatthasahio. [284]-287.-2. Visesanamanukkamo. [288]-289. (Nandi.1987) combined index of: Nandi. (including JogNa. and LahuNa.) AnuOg., Utt., Dasave., Av., Dasa. (including AyarDas.), BIhKapp., Vava. and Nis.: Parisista 3. Navasuttani saddasuci [15 505 words). p. [1]-319. (Nandi.1997): 4. Visesanamanukrama-desisabda (p. 228]-237.-5. Padanukrama [238]239. 1997 5.2-3 JOGANANDI (Jog N a.), LAHUNANDI / LAGHUNANDI (La hu Na.) and ANUJNANANDI | ANU NANANDI Exegesis: Sricandra Suri, Tika. Printed Nandi.1966b. Editions: See Nandi. 1966b; 1966d;1968;1987; 1997. Also perhaps given in some editions not yet examined, ie, marked with an * above. Translations: Hindi 1997 (Nandi.1997) Index: 1987 (Nandi.1987) combined index of: Nandi. (including JogNa. and LahuNa.) AnuOg., Utt., Dasave., Av., Dasa. (including AyarDas.), Brhkapp., Vava. and Nis.: Parisista 3. Navasuttani saddasuci[15 505 words). p. [1]-319. (Nandi.1997): 5. Padanukrama [238]-239. 1997 Studies: Thakur, Anantlal. 1972. Identification of a few Sastras mentioned in the Jaina sutras. Proceedings of the 24th All-India Oriental Conference, 1968. Pune : Bhandarkar Oriental Research Institute, 1972. p. 317-20. ANU PJ21.A5 1968 176
Page #198
--------------------------------------------------------------------------
________________ 5.4 ANUOGADARAIM (Anu Og.) Author: Ascribed to Aryaraksita.! Title: Anuyogadvara (Skt). Content: A work exemplifying the method of exposition required to interpret and explain the Agamas, using the Avasyaka-sutra as an example (Dundas 1996, 77). Dundas also suggests a date of the third or fourth century of the CE. References: AnuOg.1968, Introduction 46-76; BORI Cat. 17: 2, 290-336; Schubring 1935 $53. Exegesis: Jinadasa Mahattara, Curni (AnuOgCu.) (JRK 8: JSBI 3.297).* 1928 * Jinadasa-Gani-viracita Srianuyogadvara-curni tatha Haribhadra-Acarya-viracita Anuyoga-dvara-sutra-vrtti[/edited by Sagarananda). Ratalama : Srigsabhadevaji Kesarimalaji Svetambarasamstha, Vira samvat 2454. Vikrama samvat 1984. Kraista 1928. 90, 128 p. ; 12 x 27 cm. [CLIO 1, 134. JSBI 325nlu. JL 1, 1(4th group); DLJP series list] ***Pratayah 500." BORI 29 1952 Printed AnuOg.<1999-> Haribhadra, pupil of Jinabhata, Tika (JRK 9).* Printed. AnuOgCu. 1928; <1999- >. Hemacandra Maladharin, pupil of Abhayadeva of the Harsapuriya Gaccha, Prasnavahanakula, Tika, 5 700 granthas (JRK 9; BORI Cat. 17:2, 322).* Printed. AnuOg. 1880; 1915-16 (= 1973?); 1923; 1939;<1999-> Tika, (JRK 9). Molha, disciple of Sobharsi, Vartika (BORI Cat. 17:2, 334). Editions: 1878 *Anuyogadvarasutra/Ganadhara Sudharma Svamiksta mulasutra tadupari Sri Hemacandra Suri krta tika : tadupari bhasatikasameta ; Srimohanamunina samsodhitam. Kalikata : Nutana Samskrtayantra, 1935 [1878). [1], 660 p. ; 13 x 31 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha ; 44). [CLIO 1, 134; Univ. of Chicago Library catalogue] (Series no. 45) (Emeneau 3951). Includes Gujarati gloss of Mohana (BORI Cat. 17:2, 326). 1915-16*[Hemacandracarya-viracita-vitti-yuktam ... Anuyogadvara-sutram/edited by Sagarananda). Bombay: Nirnaya-sa gara Press, 1915-16.2 v.; 12 x 26 cm. (Sresthi-Devacandra-LalabhaiJaina-pustakoddhara ; no.s 31, 37). [CLIO 1, 134; DLJP series listing! Part 1: 102 sie 2041 p. Title from cover.- Part 2: 103-270 [ie 206-540 p. 1 plate. (CLIO 1, 134). Reprinted 1973? 1917 *[Text with Hindi translation / Atmarama Panjabi.] Ajmer, 1917. [Schubring 1935 $53] Reprinted 1931? "A late date for the Anuyogadvara--or at least for this passage of it--is confirmed by the reference to a Patanjali(ya) in it ... the terms Patanjali and Patanjala are used in the earlier literature with reference to Yoga Sutra and Bhasya together, never with reference to the Yoga Sutra alone (Bronkhorst 1985, 203 ff)." A Note on zero and the numerical place-value system in ancient India, Asiatische Studien = Etudes asiatiques 48 (1994) p. 1039-1042, page 1040. Muni Jambuvijaya is "preparing a critical edition of the Anuyogadvarasutra with the Curni, the Vrtti by Haribhadrasuri, the Vrtti by Maladhari Hemacandrasuri together, based on many palm-leaf MSS." (Undated acrogramme, received late September 1997). Although I have seen the BORI copy, I have not yet been able to re-check my notes; the details from that titlepage differ from the CLIO entry: Srianuyogadvaranam curnih Sriharibhadracaryaksta vittis ca. The Anuyogadvaracurni occupies pages 1-91. 177
Page #199
--------------------------------------------------------------------------
________________ Epistemological works 1918 or 1919 Srimadanuyogadvarasutram. Gopipura, Surat : Srijainacaryasrijinakrpacandra surisvaropadesena, Vikrama sam. 1976 [1919). Vira samvat 2444 [1918). 49 [ie 98] p. ; 12 x 27 cm. (Srijinadatta suripracinapustakoddharaphanda , granthankah 21). "Pratayah 500." ANU BL1313.6.A58 1919 1919b *Anuyogadvara sutra / Amolaka Rsiji krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudrala ye, 1919. 379 p. ; 13 x 23 cm. Haidarabada : Sukhadevasahaya Jvalaprasada, Vi. sam. 2446 [1920] (JSBI 2, 325n.la). One of the few editions not to follow the confusion of sutras 591 and 592 that was first printed in the 1878 edition. See discussion AnuOg.1968, 113-17 (4th group). 1923 Srianuyogadvarani: Srimanmaladharagacchiyahemacandrasurinirmitavrttiyutani. Bombay: Agamodayasamiti, Vikramasamvat 1980. Kraistasan (1923). f. [1], 271, [2] ; 12 x 27 cm. "Prati 750." BORI 1649 (water-damaged), 2688 and 38 157 1931 *[Text with Hindi translation]/Atmarama (Purvardha) Bambai: Svetambara Sthanakavasi Jaina Kanpharensa. (Uttarardha) Patiyala : Muralilala Caranadasa Jaina, 1931. [JSBI 2, 325nli). Reprint of 1917 edition? 1939 Srianuyogadvarasutram/Srimadganadharapravaragautamasvamivacananugatam Srimanmaladhariyahemacandrasurisandsbdhavsttiyutam. Patana : Sri Kesarabai Jnana Mandira, Vira samvat 2465. Vikrama samvat 1995. Kraistasya 1939.2, 49, 250 (ie. 4, 98, 500) p. ; [1] leaf of plates : ill. ; 13 x 28 cm. (Acaryasrimadvijayakamalasurisvaraji-Jaina-granthamala ; granthanka 1). Contents: Nivedana 1)-2.- Black and white plate of Vijayakamalasuri, the Sri Kesarabai Jnana Mandira (Patana), and the financer of the publication Manilalal Karamacanda).-Anuyogadvarasutram : Srimatsthaviraviracitam [text only) 1a-50a.Srianuyogadvarasutram : Srimanmaladharihemacandra surisandrbdhavrttiyutam (text with commentary) (la-251a). Text follows AnuOg. 1923 (AnuOg. 1968 Editors' note p. 120n.47 (4th group)). That edition is cited in the Gujarati Nivedana and stated there to be unavailable. "Patana Sri Naginabhar Pausadhasala ane Sri Kesarabhai Jnanamandira (book no.) 872." 1953 Mula suttani : Sri Dasavaikalika sutra, Sri Uttaradhyayana sutra, Sri Nandisutra tatha Sri Anuyogadvara sutra ka Suddha mulapatha / sampadaka Kanhaiyalalaji Maharaja 'Kamala'. Prathamavrtti. 52, 588 p. ; 20 cm. Byavara : Gurukula Printinga Presa, Vira samvat 2479 [1953). Bare text, Anuogaddaram, p. [337)-588. Text follows AnuOg.1923 edition (AnuOg.1968 Editors' note p. 120 n.47 (4th group)). "1000 [copies)." Reprinted 1975? ANU PK 5003.A58 1954 [sic] 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie ; (sutthuruvena Pupphabhikkhuna sampadio. 1. avstti. Gudagamva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354.2 v. ; 19 cm. Anuogadarasuttam v. 2: (1085)-1163. Text follows AnuOg.1923 (AnuOg.1968 Editors' note p. 120 n.47 (4th group)). ANU BL1310.58 1954 2 v. 1967-68 Sri Anuyogadvarasutram / Ghasilalaji-Maharaja viracitaya Anagaradharmamsta varsinyakhyaya vyakhyaya samalankrtam Hindi-Gurjara-bhasa'nuvadasahitam. Rajakota, (Saurastra) : Sri Akhila). Bhafratiya). Svetambaral. Stha[nakavasi). Jainasastroddhara Samiti, Vira samvat 2493-[2494?] [1967-68]. 2 v. ; 25 cm. Reprint 1993-94. 1. bhagah 10, 848 p. start-sutra 174, Vira samvat 2493 (1967). BORI *2 bhagah. Univ. of Pennsylvania Library 1968 Nandisuttam : Sirideva vayagaviraiyam. Anuogaddaraim ca : Siriajjarakkhiyatheraviraiyaim/sampadakah Punyavijayo Munih; Dalasukha Malavaniya, Amftalala Mohanalala Bhojaka ity etau ca. Bambai: Sri Mahavira Jaina Vidyalaya, Vira sam. 2494 [1968]. 178
Page #200
--------------------------------------------------------------------------
________________ 5.2 Anuogadaraim 11, 54, 70, 127, 467 p. ; 25 cm. (Jaina-Agama-granthamala, granthanka 1). Contents: Prakasakiya nivedana (Gujarati] 1-6.-Granthanukrama [71-11.Sampadakiya 1-54.--Prastavana 1-70.-Introduction (English version of Prastavana by Nagin J. Shah (p.127)] 1-76.-Editor[s'] note [English version of Sampadakiya by Nagin J. Shah (p.127)] 77-127.-Nandisutra-Laghunandisutra yoh sanketasucih [1]. - Anuyogadvarasutrasanketa sucih (2).-Nandisutrasya vinayanukramah 3-7.Laghunandi-Anujnanandivisayanukramah [8]. --Yoganandivisanukramah [9]. - Anuyogadvaranam vinayanukramah (10)-22.-Nandisuttam 1-48.--LaghunandiAnunanandi [49]-53.-Joganandi (54)-55.-Anuogaddaraim (571-205.-Parisitthaim. Nandisutta parisitthaim 1. Gahanukkamo [209]-210.-2. Saddanukkamo-sakkayatthasahio (see comments p. 86-87 (4th group) for explanations] [211]-265.-3. Visesanamanukkamo. [266]-273.-4. Cunnikarainidditthapadhantarathanaim [274]. - 1-3 Laghunandi-Anunnanandiparisitthaim. 1. Gahanukammo (275).-2. Saddanukkamosakkayatthasahio. [276]-282.-3. Visesanamanukkamo. (283).-1-2 Joganandiparisitthaim. 1. Saddanukkamo-sakayatthasahio. [2841-287.-2. Visesanamanukkamo. [288)-289.-1-18 Anuogaddara suttaparisitthaim. 1. Gahanukkamo [290)-292.-2. Saddanukkamo-sakkayatthasahio (293)-454.-3. Visesanamanukkamo (455)-460.-4. Cunnikarainidditthapadhantarathanaim [461].-Suddhipattayam (462)-467. ANU PK5003.A56 1968 * Reprint of AnuOg.1915-16?) [Nirukta kosa / vacana pramukha Acarya Tulasi; pradhanasampadaka Mahaprajna ; sampadaka Sadhavi Siddhaprajna, Sadhavi Nirvanasri, 1984. p. 23).] Mula-suttani: Dasaveyaliyam, Uttarajjhayanam, Nandi-suttam. Anuogaddaram/nirdesaka Muni Kanhaiyalalaji Kamala'; samyojaka Vinaya Muni "Vagisa.' Sanderava, Rajasthana : Agama Anuyoga Prakasana, Vira samvat 2503 (1975). 730 p. ; 14 cm. Contents: Apni bata [1]-12.-Dasavaikalika-sutrantargata Padyanamanukramanika [1]13.--Sri Uttarajjhayanasuttam [14]-46.-Parisista 2 (sic). Mula-sutram mem nirdista drstantam ki akaradi anukramanika 47-52. Dasaveyaliyam [1]-86.--Uttarajjhayanam 87-335.-Nandi-suttam (337)-419.-Anuogaddaram (421)-730. Acknowledgements mention Sri Misrimalaji 'Madhukara' and Sobhacandra Bharilla. (p. 11-12 (1st group)). Mula only. Reprint of 1953 edition? ANU PK5003.A51 1975 1973 1975 1987a Navasuttani: Avassayam, Dasavealiyam, Uttarajjhayanani, Nandi, Anuogadaraim, Dasao, Kappo, Vavaharo, Nisihajjhayanam / vacana pramukha Acarya Tulasi ; sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2044. I[svi san]. 1987. 140,812, 29, 320 p.: four pages of plates ; 25 cm. "Original text critically edited" on the basis of three MSS of the text-two from the Shrichand Ganeshdas Gadhaiya Library, Sardarshahar, c. V. S. 1500; one from the collection of the Jain Svetambara) Terapanthi Sabha, Sardarshahar, c. 16th cent. V. S.;-and three printed editions: AnuOgCu.1928; AnuOg. 1938; and the edition of Hemacandra's cty 1938, described on p. 20-24 = 79-81 (1st group). Anuogadaraim 289)-421. Forms v.5 of a complete edition of the Jaina Agama. ANU NEW BOOKS COLLECTION 1 484 435 1987b Anuyogadvarasutra / Aryaraksitasthaviraviracita : mulapatha, Hindi anuvada, vivecana, parisista yukta/adyasamyojaka-pradhanasampadaka Misrimalaji Maharaja Madhukara'; anuvadaka-vivecaka Sri Kevalamuniji; sampadaka Devakumara Jaina, mukhyasampadaka Sobhacandra Bharilla. Byavara, Rajasthana : Sri Agama Prakasana-Samiti, Viranirvana samvat 2513 (1987). 47, 501 p. ; 25 cm. (Jinagama-granthamala; granthanka 28). ANU NEW BOOKS COLLECTION 1 778 564 1993-94 Sri Anuyogadvarasutram / Ghastlalaji-Maharaja viracitaya Anuyogacandrikakhyaya vyakhyaya samalankstam Hindi-Gurjara-bhasa'nuvadasahitam. 2. avstti. Ahamadabada : Sri Askhila). Bhafrata). Sveftambara). Stha[nakavasi). Jainasastroddhara Samiti, Vira samvat 2519-20. Vikrama samvat 2050-50. Isavisan 1993-94.2 v. ; 25 cm. "Prati 250." Originally published. 1967-168?). 179
Page #201
--------------------------------------------------------------------------
________________ Epistemological works RW <1999-> Anuyogadvarasutram: Part I: the text critically edited by Punyavijaya with three commentaries, Curni by Jinadasa Gani Mahattara, Vivrti by Haribhadra Suri, Vrtti by Maladhari Hemacandra Suri / critically edited by Jambuvijaya. Bombay: Sri Mahavira Jaina Vidyalaya, . v. ; 25 cm. (Jaina-Agama-granthamala ; no. 18 (1)). Translations: English: 1970 Gujarati: 1878 1916 Hindi: 1917 1919 1931 Index: 1928 1. bhagah: 8, 848 p. start-sutra 174. 2. bhagah: 5, 912 p. sutra 175-end. 1967-68 Ghasilala (AnuOg.1967-68) [= 1993-94] 1968 1970 Anuogaddaraim: English translation/by Taiken Hanaki. Vaishali, Bihar : Research Institute of Prakrit, Jainology & Ahimsa, 1970. lxii, 246 p; 25 cm. (Prakrit Jain Institute Research Publications series; v.5). Atmarama? (AnuOg.1917) Amolakarsi (AnuOg.1919) Atmarama (AnuOg.1931) 1967-68 Ghasilala (AnuOg.1967-68) [= 1993-94] 1987 Contents: General Editor's Introduction/Nathmal Tatia. [v]-xlix.-Contents [li]-lxii. Anuogaddaraim = The Doors of Disquisition [1]-212.-Appendix 1. Prakrit words [213]226.-2. English words [227]-229.-3. Selected proper names [230]-231.-4. The gathas [232]-242.-5. Index of the gathas [243]-246.-Abbreviations. Based on AnuOg.1968. Also AnuOg.1939; 1915-16; 1923; 1953-54. The introduction gives "A critical study of the Anuogaddaraim... mentioning the problems discussed" (Introduction p. v). ANU BL1311.S53E5 1970 Mohana Muni. (AnuOg.1878) *[Abridged (sanksipta) translation of the Anuyogadvara into Gujarati [?] by Muni Sri Devavijayaji. Bhavnagar: Atmananda Sabha, samvat [?] 1973 [1916]. [AnuOg.1968, Sampadakiya [Gujarati] p. 33 (3rd group) = Editors' note [English] p. 115 (4th group)] Nandyadigathadyakaradiyuto visayanukramah : Srinandi-Anuyogadvara-Avasyaka Oghaniryukti-Dasavaikalika-Pindaniryukti-Uttaradhyayananam sutrasutragathaniryuktimulabhasyabhasyanam akaradikramah ankasuddhih laghubrhams ca visayanukramah = An Alphabetical index of the aphorisms etc. occuring in Nandisutra, Anuyogadvara, Avasyaka, Oghanir[y]ukti, Dasavaikalika, Pindaniryukti and Uttaradhyayanasutra : along with detailed lists of subjects treated in these seven Agamas. Mumbayyam: Sri Agamodayasamiteh karyavahakah Jivanacandra Sakaracandra Jhaveri, Virasamvat 2454 [1928]. f. 183 [ie 366 p.]; 12 x 26 cm. (Sri-Agamodayasamiti Granthoddhara; granthakah 55). ANU BL1313.89.N25 1928 (AnuOg.1968): Anuogaddarasuttaparisitthaim. 1. Gahanukkamo p. [290]-292.-2. Saddanukkamo-sakkayatthasahio [293]-454.-3. Visesnamanukkamo [455]-460. (AnuOg.English translation. 1970): Appendix 1. Prakrit words p. [213]-226.-2. English words [227]-229.-3. Selected proper names [230]-231.-4. The gathas. [232]-242.-5. Index of the gathas. [243]-246. (AnuOg.1987a) combined index of: Nandi. (including JogNa. and LahuNa.) AnuOg., Utt., Dasave., Av., Dasa. (including AyarDas.), BrhKapp., Vava. and Nis.: Parisista 3. Navasuttani saddasuci [15 505 words]. p. [1]-319. 180
Page #202
--------------------------------------------------------------------------
________________ Title: Uttaradhyayana (Skt). Content: A collection of texts for monks and nuns in 36 chapters (ajjhayana) on a variety of topics: difficulties to be endured, the nature of karman, right conduct, the animate and inanimate world etc. Exegesis:1 A B References: Winternitz 1933:2, 466-70; Schubring 1935, $54; Schubring 1944, 42-53; BORI Cat. 17:3, 1-90; JSBI 2, 143-70; Tripathi 1975, 94-98. A 1 2 3 6 MULASOTRAS 4 6.1 UTTARAJJHAYANA (Utt.) 1 Dated commentaries Undated commentaries Dated commentaries Bhadrabahu, Niryukti 607 Prakrit gathas, apparently only known from Santyacarya's cty (JRK 430). Ref. JSBI 3, 105-109. 1989 Niryukti-sangrahah / Bhadrabahusvamiviracitah; sampadakah samsodhakas ca Srijinendrasuri. Prathamavrttih. Lakhabavala, Santipuri, Saurastra: Sri Harsapuspamrta Jaina granthamala, Vira sam. 2515. Vikrama sam. 2045. San 1989. 20, 600 p. ; [1] plate; 19 cm. (Sri Harsapuspamrta Jaina granthamala; 189). 5. Sriuttaradhyayanasutra-niryuktih 365-419. ANU BL1310.4 B432 1989 1995 The Nijjuttis on the seniors of the Svetambara Siddhanta : Ayaranga, Dasaveyaliya, Uttarajjhaya and Suyagada: text and selective glossary / Willem B. Bollee. Stuttgart: Franz Steiner, 1995. ix, 197 p. ; 24 cm. (Beitrage zur Sudasienforschung Sudasien-Institut Universitat Heidelberg; Band 169). Uttarajjhaya Nijjutti: p. 75-117. (Apparently based on Utt. 1916-17, although a Bombay ed. of 1950 is also mentioned on p. 75 but without details). Reviews: Herman Tieken, Asiatische Studien = Etudes asiatiques 1996 [681]-683.Nalini Balbir BEI 13-14 (1995-96) 547-48.- Paul Dundas, BSOAS 60 (1997) 15253-K. R. Norman The Jain nijjuttis Acta Orientalia 58 (1997) 52-74. Printed. Utt.; 1916-17; <1950->. Govaliya Mahattara Sisya, Curni, 5 850 granthas (JRK 43). Ref. JSBI 3, 308-309. Author, Jinadasa Mahattara? (1960-67 edition v. 1 p. 6 (1st group)). Printed Utt. 1933. RW Santyacarya Vadivetala, Tharapadra gaccha, tika called Sisyahita, 16 000 granthas (JRK 43). Contains the Niryukti of Bhadrabahu = Paiatika (Utt. 1991, 12 (1st group)). Also called Brhat-tika (Tripathi 1975, 95). Santisuri is reputed to have died in sam 1096 [1039] [Kapadia] quoted by Tripathi 1975, 95. Ref. JSBI 3, 388-393. Vadivetala Santisuri d. 1040 CE (JSBI 2, 146 n; Bollee 1990, 265). "... the oldest and best of all commentaries [on Utt.]" (Alsdorf 1966 study, Foreword.) Printed Utt.1916-17; <1950->. CGRM lists a MS of a Gujarati version of this cty (p. 22-23). Nemicandra Suri, before diksa called Devendra (fl. 1072-83), pupil of Amradeva, pupil of *Dvavimsatiparisaha-kathah / sampadakah samsodhakas ca Vijayajinendrasurisvarah. Prathamavrtti. Lakhabavala Santipuri, Saurastra: Sri Harsapuspamrta Jaina Granthamala, 1988. 2, 112 p.; 13 x 26 cm. (Sri Harsapuspamrta Jaina granthamala; 182). [DK4079. DK listing 1988-96, item 175] "Jaina religious stories based on the commentary of the Uttaradhyayasutra." (DK listing). I am not certain which commentary is meant here.
Page #203
--------------------------------------------------------------------------
________________ Mulasutras Uddyotanasuri of the Brhad Gaccha. Sukhabodha, 14 000 granthas Cty based on Santyacarya's Sisyahita and composed in samvat 1129 [1072] (JRK 43). Roth says finished in samvat 1179 [1123] (Roth, Gustav. 1974. Notes on the Pamcanamokkara-parama-mangala in Jaina literature, The Adyar Library bulletin 38 (1974) [1]-18, p. 5). "Devendra is not troubled by any metrical scruples; he explains the traditional text before him without the slightest regard to metrical correctness" (Alsdorf 1962 Itthiparinna, p. 111). Printed Utt. 1937 [reprinted? 1982a); <1950->.? Extracts: 1884 Jacobi, Hermann. Ueber die Entstehung der Cvetambara und Digambara Sekten /von Hermann Jacobi. ZDMG 38 (1884)1-42. [Roman text of Ratnanandin's Bhadrabahucaritra and Roman text and translation of section from 3rd adhyayana of Devendra's commentary on Utt.]. [Emeneau $4134] 1886 Jacobi, Hermann. Ausgewahlte Erzahlungen in Maharashtri : zur Einfuhrung in das Studium des Prakrit: Grammatik, Text, Worterbuch / herausgegeben von Hermann Jacobi. lxxii, 160 p. Leipzig : S. Hirzel, 1886. Contents: Vorwort [v]-ix.-Einleitung (xi)-xx.--Grammatik [xxi]-Ixix.-Anhang [lxx]lxxi. Texts 11-86.-Worterbuch (87)-156.-Nachtrage: Erklarung der Apabhramcastophen. [157]-158.-Verbesserungen und Druckfehler (159)-160. Reprint: Darmstadt : Wissenschaftliche Buchgesellschaft, 1967. lxxi, 160 p. ; 23 cm. Translated in 1909 John Jacob Meyer, see below, Translation of extracts. ANU PK 1233.J3 1967 1888a Fick, Richard. Eine jainistische Bearbeitung der Sagara-Sage / von Richard Fick. Kiel : G. Busolt, 1888. xxiii, 29 p. ; 23 cm. [Guerinot 1906 $342] "Inaugural-Dissertation zur Erlangung der Doctorwurde der philosophischen Fakultat der Christian-Albrechts-Universitat zu Kiel." Contents: Einleitung vii-xxiii.Text. 1-11.-Uebersetzung 12-21.-Anmerkungen 2226.--Glossar 27-29. Based on the same two MSS in Jacobi's personal collection used for his Ausgewahlte Erzahlungen (xxii-xxiii). "Fick has made rather many blunders in his little book; only a few I could rectify in connection with my little list of variants (given here]" (J. J. Meyer 1909, 289). ANU PAMPHLET PK5013.D5A6 1888 1888b Jacobi, Hermann. Die Jain Legende von dem Untergange Dvaravati's und von dem Tode Krishna's ZDMG 42 (1888) 493-529. [Guerinot 1906 $343] Text and translation of part of Devendra's cty. Variants cited by Meyer (1909, see 289). 1950a Ghatage, A. M. Kahanaya-tigam : a Prakrit reader, edited with various readings, translation, vocabulary, notes and an introduction. Kolhapur : Bharat Bookstall, 1950. vii, 64, 56, 48, 152 p. ; 18 cm. Contents: Preface [i]-vii.-Introduction 1-64. [I. Text 1-8.-II. The author 8-22.-III. Utt. and associated stories. 22-30.--IV. Comparative study of the stories 30-54.-V. Language and metre 54-64).-Kahanaya-tigam = A Prakrit reader (texts with variants [1]-56.- Translation. I. The destruction of Dvaravati. [3]-24.-II. Muladeva (25)-40.III. Karakandu (41)-48.-Notes (1)-66.-Etymological and comparative vocabulary : Prakrit-Sanskrit-English [67]-152. Sources: (1) For the Karakandu and Muladeva episodes, Jacobi's 1886 reader (p. 34-38 and 56-65), the Dvaravati episode, Jacobi's ZDMG article (1888b above). (2) The same Utt. 1966 indicates a printed edition "published by Devacandra Lalabhai" but gives no further details. Three verses from the Karakandu tale also translated by Gustav Roth (1974. Notes on the Pamca-namokkaraparama-mangala in Jaina literature, The Adyar Library bulletin 38 (1974)[11-18 p. 5-7. 182
Page #204
--------------------------------------------------------------------------
________________ 6.1 Uttarajjhayana two MSS used by Jacobi, A. VS 1611, 324 leaves and B. VS. 1660, 259 leaves. (Jacobi, 1886, vii). (3) The appendix to Meyer 1909 from MS D. 396 leaves. (4) Utt. 1937. Ghatage has carefully compared Jacobi's text with that of Utt. 1937 and noted the readings of Meyer (1909). For the first two stories he has also consulted Somaprabha's Kumara palapratibodha (1920 (GOS; 14) p. 7-16 and 92-105) since that often follows Devendra very closely. Ghatage has successfully restored the Apabhramsa verses. Cover dated 1951. BORI 159 274 1950b Ghatage, A. M. Kahanaya-tigam : a Prakrit reader, edited with various readings, translation, glossary, notes and an introduction. Kolhapur : Bharat Book-stall, 1950. 56, 48 p. ; 18 cm. Contents: [Texts without variants) [1]-56.--Translations 1-48. Texts reprinted separately 1956a below. BORI 31 348 1956a Ghatage, A. M. Kahanaya-tigam. Kolhapur : Bharat Book-stall, 1956.48 p. ; 18 cm. Extract from 1950b above. Contains only the three Prakrit texts without variants. BORI 41 540 1956b Bambhadatto = The story of Bambhadatta : edited with introduction, notes and translation / by N. V. Vaidya. Poona : N. V. Vaidya, 1956. vi, 93 p. ; 19 cm. Revised and modified version of his edition of 1937 (Preface). This narrative is taken from Devendra's commentary on the Uttarajjha yana, chapter 13. ANU PK5013.D3B47 1956 1961 *Bambhadatta and Agadadatta / edited by N. V. Vaidya and H. A. Umranikar. 1961. 8, 81, 68 p. ; 19 cm. (Univ. of Pennsylvania library catalogue). Selections in Prakrit with Marathi translation 1963 Kahanaya-tigam / E. Ema. Ghatage ani Em. Es. Rapadive. Satara Sahara : Suceta Madhava Ranadive. 15, 92 p. Contents: Nivedana.-Prastavana [3)-15.-1. Baravai-vinaso [1]-17.-Muladevo [18]29.-3. Karakandu [30]-35.--Sabdartha va tipa (37)-47.--Marathi bhasantara [48] 92 p. Text reproduced from 1950a or 1950b above, without variants. BORI copy inscribed 1963 (by M. S. Ranadive?). BORI 27 589 1987 Devendra Ganin's Agadadatta cariyam : text, with words [sic] meaning, Hindi translation and critical questions / edited by Rajaram Jain. Ara : Pankaj Prakashan, 1987. 130 p. ; 18 cm. School text-book and notes, source(s) of text not stated. Cover title: Agadadattacariyam. BORI Translation of extracts: 1882 Pavolini, P. E. *La novella di Brahmadatta tradotta ed annotata GSAI6 (1882). [BORI Cat. 17:3, 23] 1888 (Richard Fick's dissertation above). 1895-96 Pavolini, P. E. *Vicendo del tipo di Muladeva GSAI 9 (1895-96) 175ff. [BORI Cat. 17:3, 23] 1903 Ballini, Ambrogio. *Agadadatta. Firenze, 1903. [Guerinot $382). Italian translations of texts Xa and X (Agaladatta and Agadadatta) from Jacobi's Ausgewahlte Erzahlungen (p. 66-86). 1909 Meyer, John Jacob. Hindu tales, an English translation of Jacobi's Ausgewahlte Erzahlungen in Maharashtri / by John Jacob Meyer. London: Luzac and Co., 1909. x, 305 p. ; 21 cm. Lienhard, Siegfried. Muladeva und Verwandtes. In, Beitrage zur Indienforschung : Ernst Waldschmidt zum 80. Geburtstag gewidmet. Berlin : Museum fur Indische Kunst, 1997. (Veroffentlichungen des Museums Fur Indische Kunst Berlin : Band 4). 571 p. ; 26 cm. p. [299]-308. 183
Page #205
--------------------------------------------------------------------------
________________ Mulasutras 5 6 7 8 9 10 11 12 13 14 15 16 Contents: Preface [vi]-x.-Translations [1]-288.-Appendix. 289-305. (Corrections and additions 290-95). Variant readings of C (MS of Devendra's Tika sent to Jacobi from Ahmedabad by Keshavlal Premchand) 295-99.-Untergang Dvaravatis 299.-- Sagarasage 299-300.-Citta and Sambhuya 300-301.-A Jaina king Cibi. 301-302.(The Faithless wife ... 302-305.) The appendix includes three further stories taken from the same MS as Jacobi's original extracts: king Sibi, Citta and Sambhuta (see also Leumann WZKM6 (1892) 12f.); "the faithless wife" (p. 289). ANU IPK1233.J313 1909 [Photocopy] Study of extracts: 1976. Roth, Gustav. Notes on Bambhadatta's story. JOI 25 (1976) 349-53. [Reprinted in Indian studies: selected papers / by Gustav Roth. Delhi: Sri Satguru Publications, 1986. (Bibliotheca Indo Buddhica; no. 32). p. 175-79. Discusses the word sari-sari and suggests an emendation for the verse beginning jaha vanadavo vanadavam (Jacobi 1886, 3 line 17-18). Jnanasagara Suri, pupil of Devasundara Suri of the Tapa gaccha, Avacuri, composed in samvat 1441 [1384] or 1414 [1357] (JRK 44). Samvat 1141 (Utt.1941-<1959> Prastavana p. 5, n. 5). 3600 slokas (Utt.1960-67 edition v. 1 p. 7 (1st group)). Printed Utt. 1960-67. Avacuri composed samvat 1488 [1431] (JRK 45). Uttaradhyayanasutrakatha, one MS dated samvat 1520 [1463] (JRK 45). Uttaradhyayanasutralaghuvrttigatakatha one MS dated samvat 1541 [1484] (JRK 46). Udayasagara of the Ancalika Gaccha, Tika, 8 500 granthas, composed samvat 1546 [1489] (JRK 44). Taporatna Vacaka, Laghuvrtti, composed samvat 1550 [1493], during the reign of Jinasamudra Suri of the Kharatara Gaccha. It was corrected by Tejoraja (JRK 44). Kirtivallabha Gani, pupil of Siddhantasagara Suri, when the latter was the head of the Ancala Gaccha, Tika, composed sam. 1552 [1495] (JRK 44). "Uttaradhyayanasutravrtti 8 265 sloka pramanani Ancalagacchiya Siddhantasagarasuri sisya Jayakirti samvat 1552 mam raci che [and published by] Pandita Hi. Ham." (Utt.1960-67 edition v. 1 p. 7 (1st group)). Printed Utt. 1909. [JSBI 2, 144 item i] Kamalasamyama Upadhyaya, pupil of Jinabhadra Suri of the Kharatara Gaccha, Tika, composed sam. 1554 [1497]. [JRK 44] 14 000 slokas, samvat 1544 [1487], also called Sarvarthasiddhivrtti (1960-67 edition v. 1 p. 7 (1st group)). "Jaisalamera prakasita" (Utt.1941-<1959> Prastavana p. 5, n. 8). 'Agra' (Winternitz 1933:2, 466 n2). Printed. Utt. 1923-33; 1927. Munisundarasisya (Subhasila?) Uttaradhyayanasutrakathasangraha, one MS dated sam 1560 [1503] (JRK 46). Avacuri or Tika (JRK 45). [This entry in JRK seems to be a few lumped together, eg. one is date samvat 1503, 2 000 granthas and another is 11 267 granthas.] Vinayahamsa, pupil of Mahimaratna, during the spiritual reign of Bhavasagara Suri of the Ancala Gaccha (sam. 1567-81 [1510-24]) Vrtti (JRK 44). Brahmarsi, Svadhyaya (in Gujarati) composed in samvat 1599 [1542], one MS dated that same year (JRK 45). 184
Page #206
--------------------------------------------------------------------------
________________ 6.1 Uttarajjhayana 700 granthas (Utt. 1941-<1959), Prastavana p. 6, item 42). Aksararthalavalesa, one MS dated sam. 1621 [1564) (JRK 45). Ajitadeva Suri, pupil of Mahesvara Suri of the Candra Gaccha, Tika, one MS dated sam 1629 [1572] (JRK 44). Author belonged to Pallivalagaccha (Utt.1941 <1959> Prastavana p. 5n.11). Tika called Dipika composed samvat 1637 [1580] (10 707 granthas). [JRK 44] Uttaradhyayanasutravrttiprakstakatha, samvat 1641 [1584] (JRK 46). Padmasagara Gani, pupil of Vimalasagara Gani of the Tapa Gaccha, UttaradhyayanaSutrakatha, composed samvat 1657 [1600). Begins: pranamya Srimahaviram (JRK 45). [Writtenin Pipara (Utt.1941-<1959> Prastavana p. 6, n. 38). Kamalalabha, Kharatara Gaccha, Balavabodha, samvat 1674-99 [1617-42). (Utt. 1941<1959> Prastavana p. 6, item 33). Mahimasimha / Mahimasimha, Gitani composed samvat 1675 [1618) (JRK 45; Utt.1941<1959> Prastavana p. 6, item 41). Bhavavijaya Gani, pupil of Munivimala Suri of the Tapa Gaccha, Vrtti, 6 255 granthas, composed sam. 1689 [1632] (JRK 44]). This commentary was written in Rohinipura samvat 1689 [1632], with help from a gurubhrata, Vijayaharsa Gani. [Bhavavijaya was a) pupil of Upadhyaya Munivimala, pupil of Vimalaharsa pupil of Vijayadana Suri of the Tapa Gaccha. He wrote Sattrimsajjalpavicara (samvat 1679 [1622]), and Campakamala-katha, written in Bijapur, samvat 1708 [1651). He began writing at 30 years of age, he also corrected the works of some other authors: Jayavijaya's Kalpasutra Dipika, written samvat 1677 [1620]; Vinayavijaya's Subodhika tika, samvat 1696 [1639) and the same author's large work Lokaprakasa samvat 1708 [1651). This tika was published Bhavanagara, Atmananda Sabha, [1915-18) in 2 parts, because that was unobtainable Harsavijaya has prepared (?) this edition (Utt. 1941-1959> Prastavana p. 7). "Sutragranthagram 2000 Vyttigranthagram 14 255, ubhayam 16 255" (Utt. 1941<1959>:3, 169.] Printed in Utt. 1915-18; 1941-<1959>;1982b. 1911 Charpentier, Jarl. Le commentaire de Bhavavijaya sur le neuvieme chapitre de l'Uttaradhyayanasutra / par M. Jarl Charpentier. Journal asiatique 10e ser. 18 (1911) 201-55. [Text in Roman characters and analysis) ... Reprint. 59 p. Paris : Imprimerie Nationale, 1911. [Emeneau $3958] 1993 *Srimaduttaradhyayanatikantargatanihnavavaktavyata / Bhavavijayaji Ganiviracita; samsodhaka-sampadakas ca Vijayajinendrasurisvarah. Prathamavrttih. Santipuri, Saurastra : Sri Harsapuspamsta Jaina granthamala, 1993. 52 p. ; 19 cm. (Sri Harsapuspamrta Jaina granthamala ; granthanka 272). [DK listing, Recent Sanskrit, Prakrit and Pali publications from India CIR-1625 / 1996-97, item 15) Harsananda Gani, pupil of Samayasundara Gani of the Kharatara Gaccha, tika (JRK 44). Composed samvat 1711 [1654), [MS) in Bikaner (Utt.1941-<1959> Prastavana p. 5, n. 15). Laksmivallabha, pupil of Laksmikirti of the Kharatara Gaccha (Ksemasakha), Sanskrit Dipika (JRK 44). 15 000 slokas, composed samvat 1745 [1688]. Printed by Hiralala Hamsaraja, Jamanagara. [1960-67 edition v. 1 p. 6 (1st group)] [Emeneau 3959). Printed. Utt. 1879; <1935-39>; 1984b. 27 Manavijaya, Balavabodha, samvat 1741 [1684). (Utt. 1941-<1959> Prastavana p. 6, item 34) 185
Page #207
--------------------------------------------------------------------------
________________ Mulasutras 28 29 30 31 B 1 2 3 5 6 7 8 9 10 11 2 3 4 5 6 0 12 13 14 15 16 18 19 220 21 20 21 Dharmamandira Upadhyaya, tika called Makaranda, composed samvat 1750 [1693] (JRK 44). Rajasila, Kharatara Gacha, Uttaradhyayana gita chattisa, 413 granthas, [samvat?] 16th cent. (Utt.1941-<1959> Prastavana p. 6, item 45). See also 35 above. Rajalabha, Kharatara Gaccha, Uttaradhyayana gita chattisa, 18th cent. VS.?] (Utt.1941<1959> Prastavana p. 6, item 46). Manikyasekhara Suri, pupil of Merutunga Suri of the Ancala Gaccha, Tika called Dipika, no MS extant but it is mentioned by the author in his Prasasti to Avasyaka-niryukti-dipika (JRK 44). Undated commentaries: Adicandra or Rajacandra, Tabba (Utt.1941-1959> Prastavana p. 6, item 36). Ajitacandra Suri, Stabaka (JRK 45). Amradeva Suri, pupil of Uddyotana Suri of the Candra Gaccha, tika, this is probably Nemicandra's Sukhabodha, (see 4 above) (JRK 44-45). Brhadvrtti (JRK 45). Perhaps same as no. 3 above [Utt.1941-<1959> Prastavana p. 6, n. 23). "Cirantanacarya" Laghuvrtti Utt. 1960-67. [Is this the same as a cty already listed above?] Gunasekhara, pupil of Vimalacandra, pupil of Sricandra, pupil of Prabhananda, pupil of Devabhadra, pupil of Abhayadeva (Navangavrttikara), Curni (JRK 44). Harsakula, Dipika (JRK 44). Jayakirti, Gujarati cty, printed in Utt.1909. (see also the entry for 7. Kirtivallabha above). Jnanasila Gani, Avacuri, 3600 granthas (JRK 45). Matikirti sisya, Kharatara gaccha, Vrtti (Utt. 1941-<1959> Prastavana p. 6, item 37). Megharaga Vacaka, Stabaka (JRK 45). Payacanda Gaccha (Utt.1941-<1959> Prastavana p. 6, item 31). Municandra Suri, Tika, 14 000 granthas (JRK 45). Nagarsi Gani, Stabaka (JRK 45). [A Kalpasutra cty by the author is dated to Vikram 1657] Parsvacandra Suri, Uttaradhyayana chattisi (Utt.1941-<1959> Prastavana p. 6, item 43). Punyanandana Gani, of the Tapa Gaccha, Uttaradhyayanasutrakatha (JRK 45). Rajasila, Svadhyaya (JRK 45), see also 51 below. Samaracandra, Payacanda Gaccha, Balavabodha [VS.?] (Utt.1941-<1959> Prastavana p. 6, item 32). Santibhadra Acarya, Vrtti, 18 295 granthas, probably the same as Santyacarya's Vrtti (see 5 above) (JRK 45). Udayavijaya, Svadhyaya (JRK 45). Udayavijaya, Uttaradhyayana chattisa, [samvat?] 18th cent. published. (Utt.1941-<1959> Prastavana p. 6, item 44). Uttaradhyayanasutradrstanta (JRK 46). Uttaradhyayanasutrakathasanksepa (JRK 45). 186
Page #208
--------------------------------------------------------------------------
________________ 6.1 Uttarajjhayana Uttaradhyayanasutravrttisamskrtakatha, (IRK 46). Uttaradhyayanasutrarthakatha = Uttaradhyayanasutrakatha (JRK 46). Uttaradhyayanasutrabshadvittiparyaya (BORI Cat. 17:3, 74-75). Vijayasena, Uttaradhyayanasutrakatha, probably the same as 38 above (JRK 45). Vitti, 8670 granthas (JRK 45). 16 070 granthas (Utt.1941-<1959> Prastavana p. 6, n. 23). Vitti called Dipika, 8 670 granthas. Begins: Sriuttaradhyayanasya kincidarthah kathas ca (JRK 45). Vrtti called Dipika, 11 000 granthas (JRK 45). Editions: 1879 *Uttaradhyayana : sampurnatam agamat/Bhagavanavijayasadhuna samsodhitam. Calcutta ; [Government Press?), samvat 1936 [1879). [1], 1109 p. ; 13 x 31 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 41). CLIO 2, 2827; Emeneau $3959; JRK 42; Univ. of Chicago Library catalogue Includes Laksmivallabha's Sanskrit commentary. Hindi gloss (Guerinot 1906, 143 item 245). "Gujarati-anuvada-sameta" (CLIO entry). No publisher's name (Univ. of Chicago Library catalogue). *Atha Sri Uttaradhyayana sutra taba mula Magadha bhasa artha Gujarati sahita, adhyayana 36 ... Bombay: Bombay City Press, 1895. 6, 486 p. ; 13 x 27 cm. [CLIO 2, 2826] 1895 1909 1911 *[Text with commentary (tika) of Jayakirti (in Gujarati). Jamanagar : Hiralala Hamsaraja, 1909. [JRK 42; JSBI 2, 144 item i] *Uttaradhyayana sutra ... (edited by Hermann Jacobi: carried through the press by Jivaraja Ghelabhai Dosi.] Ahmadabada : City Printing Press, 1911. 2, 198 p. ; 14 x 24 cm. (CLIO 2, 2826; Emeneau $3952; JSBI 2, 145 item au). Anonymous edition but based on Jacobi's (Jacobi Kleine Schriften I. p. xvii). Ahmedabad, 1911. (Sacred books of the Jains) (Bollee 1977:1,177). Reprint 1925. 1913 *Sri-Uttaradhyayana-sutra. Ahmedabad : Satya-prakasa Press, 1913. 125, [1] p. ; 13 x 22 cm (CLIO 2, 2827] 1915-18 *Srimad-Uttaradhya yana-sutram ... Srimad Bhava vijaya-Gani-viracitaya vivrttya samalankrtam. Bhavanagar : Jaina atmananda-Sabha, 1915-18. 2 v. ; 12 x 27 cm. (Atmananda-Jaina-Grantha-Ratna-mala ; 32). [CLIO 2, 2827] Part 1, [1], 318, [1] [ie. 2, 636, 27 p.- Part 2, 2, 319-615, [1], 26 sie. 4, 4, 638-1230, 2, 52] p. 1916-17 Srimad-Bhadrabahu-Svami-sukta-niryuktikani ... Sri-Santi-surivarya-vivstani srimanty Uttaradhyayanani / edited by Sagarananda. Bambai : Devacanda Lalabhai Jaina Pustakoddhara Samstha, 1916-17. 3 v. ; 12 x 27 cm. (Sresthi Devacanda Lalabhai Jaina Pustakoddhara Fund series, no. 33, 36, 41). [CLIO 2, 2827; Alsdorf 1966. Foreword; DLJP series list Part 1: 1916. [1], 227, [1] [ie. 2, 454, 2] p.-- Part 2: 1916. [1], 229-512 [ie. 458-1024] P.-Part 3: 1917. [1], 513-713 [ie. 1026-1426] p. Prathama vibhaga, adh. 1-4 (JL 2, 3 (3rd group)). Printed: Nirnayasagara Press. "Now being reprinted by Lalan B. H. Surat Sarasvati mudranalaya, 1950-" (Tripathi, 1975, 94). Only pt. 1 seems to have been reprinted (Tripathi 1981, 326). BORI 1628 [v. 2 only) 1919 *Uttaradhyayana sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919.651 p. ; 13 x 23 cm. Haidarabada : Sukhadevasahaya Jvalaprasada, Vi. sam. 2446 [1920]. [JSBI 2, 145 item ol ANU ON ORDER 21 May 1996. 187
Page #209
--------------------------------------------------------------------------
________________ Mulasutras 1922 The Uttaradhyayanasutra being the first Mulasutra of the Svetambara Jains : edited with an introduction, critical notes and a commentary / by Jarl Charpentier. Uppsala : Appelbergs Boktryckeri Aktiebolag, 1922. 409 p. ; 24 cm. (Archives d'Etudes Orientales ; v.18). Contents: Preface (dated June 1914) (5)-8.-Introduction. [9]-65.--Uttaradhyayanasutram [67]-274.--Commentary (275)-409. Review: W. Schubring, OLZ (1924) 4841. (Schubring 1935 954] Criticised by Alsdorf (1962 Itthiparinna, p. 111) for not taking into account metrical considerations. "Charpentier's edition, with its valuable notes, serves as a useful text-book for University courses in AMg. Its faults include rather a large number of misprints (mostly corrected in the edition by Vadekar and Vaidya (Utt.1959), which is based upon Charpentier but lacks his notes), and the omission of an index of the words discussed in the notes" (K. R. Norman. Middle Indo-Aryan studies 14, JOI(B) 29 (1976) 37 = Collected papers 2 (1991) 113). ANU PK5003.A58U8 1922 *Reprint. New Delhi : Ajay Book Service, 1980.409 p. ; 22 cm. 1923 *[Text edition?) Bikaner. [Schubring 1935 854] 1923-33 *Uttaradhyayanasutram, Kharataragacchiyasrikamala-samyamopadhyaya-viracita sarvarthasiddhitikaya samalaikrtam / edited by Muni Sri Jayantavijaya. Agra : Laksmicandra Jaina Library, 1923; Vijaya Dharma Laksmi Jnana Mandira, 1925, 1927, 1933. 4 v. ; 12 x 27 cm. oblong. [CLIO 2, 2827; Emeneau item 3954. W. Norman Brown 1941 study, p. 3] Part 1: 1923. [1], 154, [1] f.-Part 2: 1925. f. [1], 157-300, [1].--Part 3: 1927. f. [1], 301-460, [1]--Part 4: 1933. f. [1], 463-599. Jayantavijaya, pupil of Vijayadharma Suri Kharatara Gaccha. 3 v. [Winternitz 1933:2, 466 n2] 1925 2. edition of Utt. 1911. [CLIO 2, 2827] 1927 *[Text with commentary of Kamalasamyama. Bhavnagar, 1927. (Yasovijaya Jaina grantha mala series no 46). [JRK 42] 1932 Jaina Siddhanta pathamala : Samskrtachayayuta : Dasavaikalika Uttaradhyayana sutra chaya sathe sampurna tatha Bhaktamara adi atha stotra, pucchisunam ane Tattvarthadhigama sutra mala patha sahita / chaya samyojaka Saubhagyacandraji. Prathamavrttih. Limbadi, Kathiavada : Sriajaramara Jaina Vidyasala. Vira] 2485. Vikrama samvat 1989 [1932). 12, 456 p. ; 18 cm. Contents: Nivedana 3-Prasangika vaktavya 4-5--Suddhi-patraka 6-12.Dasavaikalika sutram 1-108.-Sri Uttaradhyayana sutram 109-424.-Bhaktamarastotram 425-29.-Srikalyanamandirastotram 429-33.-Sricintamani Parsvanatha stotram 434-35.- Sri Amitagatisuriviracita prarthana pancavimsatih 436-38.-Sri Ratnakarapancavimsatih 438-40.-Sri Paramananda pancavimsatih 441-42.-Svatma cintvana 442.-Pucchissu nam 443-45.-Sri Tattvarthasutram 445-55.-Tirthankarastotram 455-56.-Satistotram 456. "Prata 2000." ANU BL1310.5.J25 1952 1933 Srimanti Uttaradhyayanani : Jinadasaganimahattara krtaya Curnya sametani.[/edited by Sagarananda). Ratnapura (Ratlam]: Srilsabhadevaji Kesarimalajityabhidha Srisvetambarasamstha, Vira samvat 2459. Vikrama samvat 1989. Kraista san 1933. 284 p. ; 12 x 26 cm. [DLJP list BORI 6742 <1935-39> Srimaduttaradhyayanasutram : mulapatha, mulartha Srilaksmivallabhaganipranita Arthadipika tika tena Gujaratibhasanuvada sahita. Jamanagara : Hiralala Hamsaraja, Samvat <1991-95> [<1935-39>]. <2, 3, 4, 5 > v. ; 12 x 27 cm. Sri Jainabhaskarodaya Printinga Presamam, 188
Page #210
--------------------------------------------------------------------------
________________ Bhaga dvitiya samvat 1991 [1935] 1 plate. ; p. 289-573. Adhyayana 4-9. Trtiya bhagah. Vira samvat 2462 [1936]. 1 plate. p. 577-860. Adhyayana 10-14. Caturtho bhagah. Vira samvat 2462 [1937]. p. 861-1101. Adhyayana 15-18. Pancamo bhagah. Vikrama samvat 1995 [1939]. p. 1105-1374. Adhyayana 19-23. Description taken from v. 2-5. ANU BL1313.9.U776434 1935 v. 2-5. "<-1936>" Sriuttaradhyayanasutrani: purvaddhrtasrijina bhasitasrutastha virasandrbdhani : Sribuddhivijayaganina sankalitottaradhyayanasutrasya Samskrtachaya [yutani). Rajanagarastha [Ahmedabad]: Srivirasamajah, Vira sam. < -2462>[<-1936>]. 142-236 [ie. 188 p.]; 12 x 27 cm. 'Pratayah 1000'. Adhyayanas 22-36 only. Details of chaya from final page. ANU BL1313.9.U77 1939 [sic]. Srimannemicandracaryaviracitasukhabodhanamnya vrttya samalankrtani Sriuttaradhyayanani. Valad, Ahmadabada: Sheth Pushpachandra Khemchandra, Vikramasamvat 1993. Virasamvat 2463. Atmasamvat 41. Isvisan 1937. 14 x 24 cm. (Sriatma-vallabhagranthanka; 12). 1937 6.1 Uttarajjhayana Contents: Prastavana / Vijayomangasuri. 1a-5a.-[Donor list 5b].-Laghusuddhipatrakam 6a-6b. Sriuttaradhyayanani la-391b. Sriuttaradhyayanasutralaghuvyakhyavyakhyatuh prasastih 392a. "[W]e have an edition of the whole of Devendra's commentary on the Utt. by the monk Vijayomanga." "[Vijayomanga] made use of ten MSS, the MS from Valad consisting of 240 folios being taken as the basis. From among the remaining, four are dated VS. 1495, 1545, 1552 and 1563. Others are later than Jacobi's MS A. In spite of this excellent material, the editor has not recorded any variant readings." (Ghatage, A. M. Kahanayatigam: a Prakrit reader, edited with various readings, translation, vocabulary, notes and an introduction. Kohlapur : Bharat Bookstall, 1950, p. 4. See the entry for Devendra's cty on the Utt. above.). Reprinted in 1982a. "[T]his edition tends to print intervocalic -t- " (Norman, 1977, 9). "Pratinam pancasati." BORI 34 012 1938 [Text only. Hiralala Hamsaraja. Jamanagar, 1938.] [JSBI 2, 145 item au] Last volume of a Gujarati chayanuvada? [Devendra Muni 1977, 717 item 15] 1939-42 *Uttaradhyayanasutram: Samskrtacchaya-padarthanvaya-mularthopetam, Atmajnanaprakasika-Hindi-bhasa-tikasahitam ca/anuvadaka Atmaramaji Maharaja. Lahaura: Jaina Sastramala Karyalaya, Mahavirabda 2465. Isavi sam 1939-42. 3 v. (2, 9, 11, 8, 31, 2, 1814, 11, 74 p.); 25 cm. (Jainasastramala; 3. ratnam). v. 1-2 1941. v.3 1942. In places the editor offers readings different from Utt. 1922 (see p. 52 of Gustav Roth 'A saint like that' and 'A saviour' in Prakrit, Pali, Sanskrit and Tibetan literature *Shri Mahavira Jaina Vidyalaya Golden Jubilee volume: pt. 1, Bombay, 1968, p. 46-62. Reprinted in Indian studies: selected papers / by Gustav Roth. Delhi: Sri Satguru Publications, 1986. (Bibliotheca Indo Buddhica; no. 32). p. 91-107). ANU MICROFICHE IN PROCESS MARCH 1997. 1941-<1959> Sriuttaradhyayanani : Srimadbhavavijayaganiviracitaya vrttya samalankrtani purvoddhrtajina bhasitasrutasthavirasandrbdhani: trtiyaturyabhagau sampurnatmakau/sam. Harsavijayo Munih. Benapa Srivinaya-bhaktisundaracaranagranthamala, Virasamvat 2467-2485> [1941-<1959>]. [1], 8, 268, 176 p. ; 12 x 28 cm. (Srivinaya-Bhakti-SundaraCaranagranthamala ; <13-14>) Contents v. 13-14: Prakasana ange [1].-Prastavana / Agaracanda Nahata. 1-8.-- Sriuttaradhyayanasutram bhaga 3. Atha astadasamadhyayanam 1-268.-Atha ekonatrimsamadhyayanam. Bhaga 4. 1-169.-Sriuttaradhyayanasutra bhaga 3-4 mam presamam trutigayela taiponi bhulone nice mujaba sudharine vanco? 170-172Sriuttaradhyayanasutravrtteh (bhaga 3-4) sodhanapatrakam. 173-176. "Pratinam pancasati." Description taken from 1959 volume. Printed Bikanera: Gopala Printinga Presa. 189
Page #211
--------------------------------------------------------------------------
________________ Mulasutras Venapa, Vikrama sam. 1997 [1940) (Uttaradhyayana-sutra : eka parisilana / lekhaka Sudarsanalala Jaina. Amrtasara: Sohanalala Jainadharma Pracaraka Samiti ; Praptisthana : Varanasi: Parsvanatha Vidyasrama Sodha Samsthana, 1970. p. 506). ANU BL1313.9.0776332 1959 [sic] Bhaga. 30-4) [only] 1946 *Dasavaikalika tatha Uttarajjhayana/Pandit Munisri Harsacandji. Kallol, Kathiawad, 1946. 188 p. [Secondhand book catalogue; another catalogue "Dallol, 1949. 186 p."] <1950- > Sriuttaradhyayanani : purvoddhrtajinabhasitasrutasthavirasandrbdhani Srutakevalisribhadra bahusvamisankalitaniryuktiyutani ; Vadivetalasrisantyacarya vihitasisyahitakhyavrttiyuktani (Surat: Lalan Balubhai Hiralal, 1950). 13 x 28 cm. ; 1-278 p. Tripathi 1981, 326] Adhyayana 1-3. No title-page. ANU Library holds only this single volume, purchased in 1973, judging by Norman's bibliographic entry below this is the same item he is describing. "The edition, Utt. 1916-17, is now being reprinted by Lalan B. H. Surat Sarasvati mudranalaya, 1950-" (Tripathi, 1975, 94). A reprint of pt. 1 of Utt.1916-17 (Tripathi 1981, 326). ANU BL1313.9.U776736 1970 [sic] v. 1 Vadivetala-Sri-Santyacaryavihitasisyahitakhyavrttiyuktani Sri-Uttaradhyayani. Ujjayini, 1950. [Norman 1993, 376] 1952 *Uttaradhyayana sutra : mula ane Gujarati anuvada-santippana/anuvadaka ane tippanakara Bhogilala Ja. Sandesara. Amadavada : Gujarata Vidyasabha, 1952. Avstti 1. xiv, 172 p. (Setha Punamacanda Karamacanda kotavala-granthamala ; nam. 3. Setha Bholabhai Jesingabhai Adhyayana-Samsodhana vidyabhavana samsodhana granthamala, granthanka 38). [LC] Adhyayana 1-18 only? 1953a Mula suttani: Sri Dasavaikalika sutra, Sri Uttaradhyayana sutra, Sri Nandisutra tatha Sri Anuyogadvara sutra ka suddha mulapatha/ sampadaka Kanhaiyalalaji Maharaja 'Kamala'. Prathamavrtti. 52, 588 p. ; 20 cm. Byavara : Gurukula Printinga Presa, Vira samvat 2479 [1953). "1000 (copies)." Bare text, Nandisutta, p. 273-336. ANU PK5003.A58 1954 [sic] 1953b *[Text with Hindi translation / Ghevaracandra Banthiya. Bikanera, Vi. sam. 2010 (1953) [JSBI 2, 145 item o] 1953c *[Text only.) Santilala Va. Setha. Byavara, Vi. sam. 2010 (1953). (JSBI 2,145 item au] 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie ; (sutthuruvena Pupphabhikkhuna sampadio. 1. avstti. Gudagava-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 1953- 54.2 v. ; 19 cm. Uttarajjhayanasuttam v.2, 1977)-1060. ANU BL1310.58 1954 2 v. 1954 *Edition with English translation by R. D. Vadekar and N. V. Vaidya, published by them also). [Simha 1990 Utt, study, p. 251; Nagraj 1986, 740 n.14] 1959 Uttaradhyayanasutram=Uttaradhyayanasutram: a Jain canonical work: edited for the use of university students / by R. D. Vadekar; N. V. Vaidya. Poona : Prof. R. D. Vadekar & Prof N. V. Vaidya, 1959. 150 p. ; 21 cm. Contents: Preface. [1].--Text 1-128-Index of verses 129-50. "The text followed is essentially based on the excellent edition of Prof. Jarl Charpentier. ... We have corrected a few misprints in Prof. Charpentier's edition and have incorporated a few better readings, as given in Devendra's commentary. An index of verses is also added at the end." Reprint of Utt. 1954. ANU PK5003.A58U8 1959. 190
Page #212
--------------------------------------------------------------------------
________________ 6.1 Uttarajjhayana 1959-61 Uttaradhya yana-sutram = Uttaradhyayana sutram / Ghasilala-Maharaja-viracitaya Priyadarsinyakhyaya vyakhyaya samalankstam Hindi-Gurjara-bhasa'anuvadasahitam ; niyojakah Srikanhaiyalalaji-Maharaja. 1. avrtti. Rajakota : Sri A[khila). Bha[rata). Sthanakvasi Jaina Sastroddhara Samiti, 1959-61. 4 v. ; 25 cm. [v. 1 not seen.]. Reprint. 1985. Contents v. 2: Adhyaya 4-14. Vira samvat 2486. Vikrama-samvat 2016. Isvisan 1960. iv, 44 886 p. *LD 12 855 to 12 858 Contents v. 3: Adhyaya 15-24. Vira samvat 2487. Vikrama-samvat 2017. Isvisan 1961. 4, 44, 995 p. Contents v. 4: [t.p. missing, details from cover] Adhyaya 25-36. Vira samvat 2486. Vikrama-samvat 2016. Isvisan 1960. 4, 44, 12, 967 p. "Prati 1000." RW 1960-67 Sriuttaradhyayanani : cirantanacaryaviracita-sakathanaka-laghuvsttirupavacurnyupetani/ sampadakah Kancanavijayah. Suryapuriya (Surat : Sresthidevacandralalabhai-Jainapustakoddharakakosasya karyavahakah Moticanda-Maganabhai Cokasi. Virasam. 248693 [1960-67). 1. samskaranam. 2 v. ; 13 x 27 cm. (Sresthidevacandralalabhai-JainaPustakoddhara granthankah 104, 112). v. 1: Trayovimsatyadhyanatmakah purvarddhah. 16, 196 [ie. 392) p. v. 2: Uttarardhah (Adhya. 24 tah 36). 64, 197-407 [ie. 393-813) p. Contents, v. 1: Prakasakiya nivedana 5.-Uttarajjhayana-Uttaradhyayanasutra sambandhi vivecana-khyala 6-9.- Reprints the list of the commentaries given in JRK] 9-13.-Sampadakiya yatkincit / Kancanavijaya 14-15.-Savacurnika-Sriuttara - dhya yanasutrapurvabhagasya laghuvisayanukramah 16. Cirantanacaryaviracita sakathanaka Srimati Uttaradhyayanasutrasyavacurnih (Laghuvsttirupa) [folios) 1-196. Contents v. 2: Prakasakana be sabda 5-6.-Uttaradhyayana, teni avacurni-karta ane visaya 7-11. Parisisto ne teno visaya 12-14. [Colophons from the manuscripts used] 14-16.-Citrama ya be pratono gathadi-samanvaya 17-24.-Agama ane citra 25-27.Agama citraratnavali 28-34.-Savacurnika-sriuttaradhyayanasutra-uttarabhagasya laghuvisayanukramah 35.-Parisistani 36.--Sriuttaradhyayanavacurevisayanukramah Isic 37-64 Text Adhyayana 24-36) folios 197-331. Sriuttaradhyayanavacurnau 1. parisistam. Gathanam sutranam cakaradikramah 332a-344a.-2. Savacurikasriuttaradhyayanagatani granthanamani 344b-345a.-3. Savacurikasriuttaradhyayanagatasaksipathanam akaradikramah 345a-347a.-4. Savacurikasriuttaradhyayanagatanam namnam akaradikramah 347a-355a.-5. Sriuttaradhyayanavacurnigata 'anye' ityadi 355a.-6. Sriuttaradhyayanavacurnigata nyayah 355a.-7. Sriuttaradhyayanavacurnikrtkrta kesancit sabdanam vyakhya 355a.-8. Savacurikasriuttaradhyayanagatani agamiki-paribhasadini. 356a-358b.-9. Agamoddharakaksta-Agamacitraratnamalayam darsitani Sriuttaradhyayanacitrani 358.-10. Sriuttaradhyayanavacurnigatadratantanam anukramah 359a-360b. (11.) Srimaduttaradhyayanasutrasya Srimajjnanasagarasurikrtavacureh adibhagah 361a-402a.-12. Sriuttaradhyayanavacurnau suddhipatrakam 4026-408a. "Pratayah 500." ANU BL1313.9.U776347 1960 v. 1, 2/RW Part of Jnanasagara's Avacuri is printed here in v. 2. The anonymous avacuri also printed here begins: samyogat matradivisa yadbahyat and partly agrees with the text of the MS used by Jacobi for his translation, ie Strasbourg MS no. 16 (Tripathi, 1975, 82-83). 1963 *[Text with Hindi translation / Ratnalala Dosi.] Sailana : Sri Akhila Bharatiya Sadhumargi Jaina Samsksti Raksaka Sangha, Vi. sam. 2489 (1963). [JSBI 2, 145 item o] 1966 Dasavealiyam taha Uttarajjhayanani/vacana pramukha Acarya Tulasi; sampadaka Muni Nathamala. Kalakatta : Jaina Svetambara Terapanthi Mahasabha, samvat 2023 [1966). [5), 3, [35), 46, 'dha', 349, 352 p. ; 23 cm. (Agama-sutta granthamala, grantha 1). Contents: Granthanukrama [1].-Antastosa [5].-Prakasakiya (1)-3.-Sampadakiya *eka'-'paintisa'.-Bhumika [11-46.-Bhumika mem prayukta granthom ki talika [47] 191
Page #213
--------------------------------------------------------------------------
________________ Mulasutras 52.-Dasavealiyam : visaya-suci ['ka')-'na.'-Uttarajjhayanam : visaya-suci ['ca')dha.'-Dasavealiyam text only (1)-84.-Uttarajjhayanam (87)-349.-Parisista 1. Dasave. sabdasuci[1]-90.-2. Utt. sabdasuci (93)-330.-3. Namanukrama [333]-340.Suddha aura apuraka patra 1, 2, 3 [341]-352. Sources for text of Utt. described on pages "ekatisa-cauntisa": Five MSS of the text: (1) MS A.: Sanghiya-sangraha, 96 leaves, samvat 1538.--(2 and 3) MS A. and I.: Library of Mohanalala Dudhoriya, Chapara, 178 and 76 p. samvats 1591 and 16th cent.--(4 and 5) MS U. and Sa.: Sardarsahar, Jain Svetambara Terapanthi Sabha, 59 and 79 leaves, about samvat 1500 and Vikramabda 1535. (6) MS Sa. of the cty Sarvarthasiddhi, Library of Mohanalala Dughoriya, Chapara, 323 leaves, about 16th cent. samvat.--Printed editions: (7) Su., Sukhabodha tika of Nemicandra, published by "Devacandra Lalabhai" [Utt.1916-17?).--(8) Vr. Utt.1916-17.-(9) Cu. "Curni: "Gopalika Mahattara sisya krta" states that it is included in Utt. 1916-17 (samvat 2442) (unconfirmed). This edition reprinted as Utt. 1987 below. Univ of Poona Q31:2163 / 1516 /J6/ 132 831 Uttarajjhayanani: Uttaradhyayana-tippana / vacana pramukha Acarya Tulasi ; vivecaka sampadaka Muni Nathmala. Kalakatta : Jaina Svetambara Terapanthi Mahasabha, 1967. *do,' 2, 332, 38, 14 p. ; 28 cm. (Agama-anusandhana-granthamala, grantha 3). Contents: Prakasakiya eka'-'do. Sampadakiya (1)-2. Uttaradhyayana-tippana [1]332.-Parisista 1. Sabda-vimaria [1]-26.-2. Pathantara-vimaria [27]-38.-Prayukta grantha-suci [1]-9.-Suddhi-patram [11]-14. "Mudrita prati 1500." University of Poona Q31:2161 / 151637.2 / 132 835 *Uttaradhyayanasutra sangraha. Maisuru : Abhinandana Prakasana, 1971. 128 p. ; 22 cm. Prakrit text with Kannada translation. 1967 1971 1972 Uttaradhyayana sutra : Bhagavan Mahavira ka antima upadesa : sanksipta vivecana, anuvada evam visesa tippana / sampadana Sadhvi Candana. Agara : Virayana Prakasana, Vira Nirvana divasa 2498. Vi. sam. 2029. 1972. ii, c, 9, 10, 2, 480 p ; 23 cm. Contents: Prakasakiya i-ii.-Sahayoga (2 leaves of monochrome plates).Sampadakiya *a'-'c'.-Utt, sutra : eka anucintana / Vijayamuni 1-9.-Antar ke bola / Amaramuni [1]-10.-Adhyayana-anukramanika i-ii.--Uttaradhyayana sutra [includes a separate section of tippana (annotations) at the end) [1]-480. Sadhvi Candana's translation and comments were translated into Hindi by Durlabhaji Kesavaji Khetani and published in Bombay, sometime before 1984 (Utt. 1984a, 14 (1st group)). University of Poona, CASS Library Q31:216/152L2/12511 ANU NBC 2 118 338 (incomplete p. 1-162 only) Mula-suttani: Dasaveyaliyam, Uttarajjhayanam, Nandi-suttam, Anuogaddaram/nirdesaka Muni Kanhaiyalalaji 'Kamala'; samyojaka Vinaya Muni Vagisa.' Sanderava, Rajasthana : Agama Anuyoga Prakasana, Vira samvat 2503 [1975]. 730 p. ; 14 cm. Mula only, Uttarajjhayana, p. 87-335. ANU PK5003.A51 1975 1975a 1975b Dasavaikalika aura Uttaradhyayana / sampadaka Muni Nathamalaji. Ladanum: Jaina Visvabharati, 1975. 'ja', 267 p. ; 21 cm. Unclear how this relates to Utt.1966, no details taken. LD 20 089 1977a Dasaveyaliyasuttam / Sirisejjambhavatherabhadantaviraiyam: Uttarajjhayanaim, Avassayasuttam ca / anegatherabhadantaviraiyaim : sampadakau Punyavijayo Munih ; Pandita Amrtalala Mohanalala Bhojaka iti ca. 1. samskarana. Bambai: Sri Mahavira Jaina Vidyalaya, Vira sam. 2503 [1977). 91, 664 p. ; 25 cm. (Jaina-Agama-granthamala ; 15) Contents: Prakasakiya nivedana (10)-11.-Prastavana (Gujarati] / Amstalala Mo. Bhojaka. 15-37.- Introduction (English translation of the preceding] [39]-58.-Detailed analyses of the contents of each of the three texts. (591-88.-Sanketasuci (89)-91.Dasaveyaliyasuttam 1-81.-Uttara'jjhayanani [83]-329.-Avassayasuttam [331]358.-1. parisittha Dasaveyaliyasuttassa suttanukkamo. [359]-368.-2. Dasaveyaliya 192
Page #214
--------------------------------------------------------------------------
________________ 1977b 1977c 1982a 1982b 1983 6.1 Uttarajjhayana suttantaggayanam saddanukkamo [369]-443.-3. Dasaveyaliyasuttantaggayanam visesanamanamanukkamo [444] 4. Uttarajjhayanasuttassa suttanukkamo [445]-470.5. Uttarajjhayanasuttantaggayanam saddanukkamo [471]-630.-6. Uttarajjhayanasuttantaggayanam visesanamanamanukkamo [631]-634.-7 Avassayasuttassa suttanukkamo [635]-636.-8. Avassayasuttantaggayanam saddanamanukkamo [637]657.-9. Avassayasuttantaggayanam visesanamanamanukkamo [658].-Vaddhipattayam [659] Suddhipattayam (660)-664. ANU BL1313.83 1977 Svadhyaya-sudha/nirdesaka Kanhaiyalalaji 'Kamala'; samyojaka Vinaya Muni 'Vagisa.' Bakhatavarapura Sanderava, Pali, Rajasthana: Agama Anuyoga Prakasana, Vira samvat 2503 [1977]. 12, 480 p.; 15 cm. Contents: 1. Vira-stuti 10-13.-2. Mulasuttani (1) Dasavedaaliyasuttam 1-86.--3. Mulasuttani (2) Uttarajjhyayana suttam 87-335.-4. Nandi suttam 337-419.-5. Tattvartha sutra 421-443.-6. Bhaktamara stotram 444-453.-7. Sri Kalyana-mandirastotram 545-462.-8. Mahavirastaka stotram 463-464.-9. Sri Cintamani-Parsvanathastotram. 465-467.-10. Sri Ratnakarapancavimsatih 467-469.-11. Acarya Amitagati Suri-krta dvatrimsika 470-476.-12. Subhasita 476-478.-13. Tirthankarastotram 47914. Satistotram 479-480. 15. Uvasaggahara stotra 480. Compendium of bare texts. ANU BL1310.2. S85 1977 Uttaradhyayana sutra: the last testament of Bhagavan Mahavira : text, translation and notes/K[astur]. C[hand]. Lalwani. Calcutta: Prajnanam, 1977. vi, 488 p. ; 22 cm. Text and translation on same page, some notes after each chapter. Has used the commentaries of Curni, Sukhabodha [Nemicandra], the Arthadipika [from edition of <1935-1939>?] and Sarvarthasiddhi [Kamalasamyama's?], (these last two though are not further identified.) ANU BL1313.9.U774 E5 1977 and PK5003.A58U8 1977 Sri Uttaradhyayanasutram : Srimannemicandracaryaviracitasukhabodhanamnya Vrttya samalankrtam purvoddhrtajinabhasitasrutastha virasandrbdham/[sampadana Umangas@ri] samyojaka Padmasenavijaya. Mumbai: Divyadarsana Trusta, [Vi. sam. 2039 [1982]]. 261 p.; 34 cm. A reprint in standard bound form of Vijayomanga / Vijaya-umanga's loose-leaf edition Utt. 1937. The reverse of the title-page says only that a few years ago Umangasuri edited the Utt. with the commentary of Devendra, but that edition is generally unavailable now. No date of publication of this book is given but a note on the reverse of the titlepage refers to Vikrama sam. 2039 [1982] which I have taken as the date of publication. ANU LARGE BOOK BL1313.9.U776 1980z Set Uttaradhyayanasutram: Mahopadhyayasimadbhavavijayaganiviracita(vr]ttya sahitam. Mumbai : Divya Darsana Trasta, Vi. sam. 2039 [1982]. 418 p. ; 29 cm. LC cataloguing note says originally published 1944 (unconfirmed). Not a reprint of 1941<1959> edition. ANU LARGE BOOK BL1313.9.U776 B5 1970 and BL1313.9.U776 1974 Uttara 'jjhayanani = Uttaradhyayana sutra / anegatherabhadanta viraiyaim; samyojaka Kanhaiyalalaja Kamala.' Ahamadabada: Agama Anuyoga Trasta, Vi. sam. 2040. 1983. 16, 340, 104 p.; 14 cm. Contents: Prakasakiya / Baladeva Bhai Patela [5]-6.-Uttaradhyaya udbodhana/Muni Kanhaiyalal 'Kamala' [7]-13.-Anukrama [14]-16.-Uttara'jjhayanani [1]-340.Uttara'jjhayanasuttassa gathanukkamo [1]-100.-Agama-anuyoga-prakasana-yojana [102]-104. "Mulapatha gutaka" ie. bare text in small format edition. ANU NBC 2 118 349 1983-89 Uttaradhyayana sutra : mula-padyanuvada-anvyartha-bhavartha-vivecana-katha-parisista yukta / tattvavadhana Hastimalaji Maharaja; Hindi padyanuvada Sasikanta Jha. Prathamavrtti. Jayapura: Samyagjnana Pracaraka Mandala, 1983-89. 3 v. ; 23 cm. 193
Page #215
--------------------------------------------------------------------------
________________ Mulasutras v.l. Prathamavstti. Vi. sam. 2039 [1983]. Adhy. 1-10 Dvitiyavstti. Vi. sam. 2044 [1987]. 14, 336 p. 1987. v.2. Prathamavstti. Vira Nirvana samvat 2511 (1985). 23, 472 p. [25-26 (1st group) Suddhipatram. Adhy. 11-21. v.3. Prathamavrtti. Vira Nirvana samvat 2515 [1989). 16, 572 p. Adhy. 23-36. ANU BL1313.9.U772 H5 1983 [ie. 1987) vols. 1,2,3 1984a Uttaradhyayanasutra : mulapatha, Hindi anuvada, vivecana, parisista, tippanayukta / samyojaka tatha pradhana sampadaka Misrimalaji Maharaja 'Madhukara'; anuvadakavivecaka-sampadaka Rajendramuni. Byavara, Rajasthana : Sri Agama Prakasana-Samiti, Vi. sam 2510 [1984). 110, 732 p. ; 25 cm. (Jinagama-granthamala , granthanka 19). Reprint. 1991. ANU BL1313.9.U774 H5 1984. 1984b Sri Uttaradhyayanasutram : Sri Laksmivallabhagani-viracita-tika-sametam/ sampadaka Muni Bhagyesavijayah 1. avrtti. Jhinjhuvada, Gujarata : Sarada Prakasana Kendra ; Ahamadavada : Praptisthana Sarasvati Pustaka Bhandara, Vikramasamvat 2041 [1984 or 1985). 2 v. ; 25 cm. v. 1. 7, 433 p. Suddhipatrakam p. [429]-433. Adhyayana 1-19.v. 2. 16, 379 p. Suddhipatrakam p. [12]-16 (1st group). Adhyayana 20-36.-Atha Tikakarasya prasastih p. [342]-323 ANU BL1313.9.077 1984 v. 1,2 Reprint of Utt.1959-61.v. 1: Adhyaya 1-3. Vira samvat 2511. Vikrama-samvat 2041. Isvisan 1985. 8, 800 p. "Prati 500." RW 1985 1987 Navasuttani : Avassayam, Dasavealiyam, Uttarajjhayanani, Nandi, Anuogadaraim, Dasao, Kappo, Vavaharo, Nisihajjhayanam / vacana pramukha Acarya Tulast ; sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana: Jaina Visva Bharati, Vikrama samvat 2044. I[svi san). 1987. 140, 812, 29, 320 p.: four pages of plates ; 25 cm. "Original text critically edited on the basis of six MSS of the text-one from the order's collection, Ladnun" Vikram samvat 1538 [1481); three from the collection of "Mohanlal Dudhodia, Chapar" V.S. 1591, 16th cent.; two from the collection of the Jain Svetambara Terapanthi Sabha, Sardarshahar, V. S. 1500 and 1535;--and three printed editions: [Utt. 1937?]; Utt. 1916-17;[1933?] described rather erroneously on p. 20-22 = 74-77 (1st group).Forms v. 5 of a complete edition of the Jaina Agama. Uttarajjhayanani (89)244.First printed as Utt.1966 above. ANU NEW BOOKS COLLECTION 1 484 435 Reprint of Utt1984a. 1991 1992-93 *Uttarajjhayanani : mulapatha, Samskrta chaya, Hindi anuvada, tulanatmaka tippana/ vacana-pramukha Acarya Tulasi; sampadaka-vivecaka Yuvacarya Mahaprajna. 2. samskarana. Ladanum, Rajasthana : Jaina Visvabharati Samsthana, 1992-93.2 v. 29 cm. DKS 4481. DK Agencies Recent Sanskrit, Prakrit and Pali publications Ref. No. CIR1378/1994-95, item 72).Details of the 1. samskarana have not yet been traced. PARTIAL EDITIONS: Adhyayana 1-9 1921 *[Utt. 1-9 in Jainapathamala.] 4. avstti, Ahmedabad, 1921. (Schubring 1935 954) Adhyayana 1-15 1954 *[Text with Gujarati translation and stories (Adhyayana 1-15). Ahmadabada : Jaina Pracya Vidyabhavana, 1954.) [JSBI 2, 145 item ai] Adhyayana 1-18 1962 *[Text with Bengali translation of Adhyayanas 1-18 [?]/by Purana Chand Syamsukha and Ajit Ranjan Bhattacharya. Calcutta : University of Calcutta, 1962 (or 1963?). [Personal communication S. R. Banerjee, January 1997] Introduction, text with translation and notes on technical terms. 194
Page #216
--------------------------------------------------------------------------
________________ Adhyayana 1 1898 1993 *Jaina jnana prakasa = Jaina-jnanaprakasa. Part I. 155 p. Amadavada, 1898. [A Supplementary catalogue of Marathi and Gujarati Books in the British Museum / by J. F. Blumhardt. London: British Museum, 1915. (... Gujarati printed books, column 93); Schubring 1935 $54] "Comprising the Sanskrit [sic] text of the Sutrakridanga, I. vi., and II. vi.; Uttaradhyayana I.i.; Gujarati translations and notes to the preceding, and Gujarati catechism, appendics on Jain doctrine, etc." (reference as above). Uttarajjhayana-sutta 1: an edition and translation, with a metrical analysis and notes / K. R. Norman. In Jain studies in honour of Jozef Deleu / edited by Rudy Smet and Kenji Watanabe. Tokyo: Hon-no-Tomosha, 1993. xvi, 504 p.; 22 cm. p. [375]-394. [Reprinted K. R. Norman. Collected papers 5 (1994) 180-206.] Uses Utt.1911; 1922; <1950->; 1953-54; 1954; 1977a. Adhyayana 4 1980 Adhyayana 5 1923 6.1 Uttarajjhayana Uttarajjhayana studies: an edition and translation of the fourth ajjhayana, with a metrical analysis and notes / K. R. Norman. In, Siddhantacarya Pandita Kailasacandra Sastri abhinandana-grantha = Siddhantacharya Pandit Kailashchandra Shastri felicitation volume/ sampadaka mandala Vagisa Sastri, Balacandra Jaina, [et al]. Riva, M[adhya] Pra[desa] : Siddhantacarya Pandita Kailasacandra Sastri Abhinandana Samiti, 1980. 573 p. ; 25 cm. p. 564-72. [Reprinted. K. R. Norman. Collected papers 3 (1992) 1-11] Contents: Introduction 564-65.-Text 565.-Critical apparatus 566.-Metrical analysis 566-67. Translation 567-68.-Notes 568-72. Adhyayana 6 1990 ANU NEW BOOKS COLLECTION 2 064 239 Adhyayana 8 1977 Uses Utt.1911; 1922; 1954; 1953-54; 1937; 1975. Santisuri's commentary however was not available. Jain, Banarsi Das. Ardha Magadhi reader. Lahore, 1923. lxv, 178 p. ; 22 cm. Printed as extract 9 (Bala-pandiyamaranam), p. 55-57, no variants and no details of the source are given. Translation reprints that of Jacobi, 1895. Reprint. Delhi: Sri Satguru Publications, 1982. ANU BL1353.S56 1980 Khuddaga-niyanthijjam (Uttarajjhaya 6): "An epitome of the Jain doctrine"/ W. B. Bollee Annals of the Bhandarkar Oriental Research Institute 71 (1990) [265]-286. ANU SERIAL PK101.B45 ANU PK 1255.J34 1982 195 Kaviliyam: a metrical analysis of the eighth chapter of the Uttaradhyayana-sutra / K. R. Norman. In, Mahavira and his teachings/ editorial board A. N. Upadhye, Nathmal Tatia [et al]. Bombay Bhagavan Mahavira 2500th Nirvana Mahotsava Samiti, 1977. iv, 462 p. ; 25 cm. ; p. 9-19. Reprinted. K. R. Norman. Collected papers 2 (1991) 9-19. Contents: Text 10-11.-Critical apparatus 11-12.-Metrical analysis 12-14.Translation 14-16.-Notes 16-19. Revision and analysis of the text of Utt. 8. "one of only three chapters of the whole Jain canon written... in the old arya metre" the others are Ayaranga 1,9 and Suyagada 1,4. Based on Utt.1911; 1922; 1937; 1953-54; 1954a. Santisuri's cty not available to Norman, no MSS used. ANU BL1371.M3 Adhyayana 11 1987-88 Pourquoi il faut respecter un savant : Uttarajjhaya 11 / W. B. Bollee, Indologica Taurinensia 14 (1987-88) [145]-62.
Page #217
--------------------------------------------------------------------------
________________ Mulasutras Text established from eight editions (Utt: 1916-17; 1922, 1925 [ie. 1923-33]; 1933; 1937; 1960-67, 1967; 1977a) and translated into French (excluding verses 2-9). ANU SERIAL DS401.158 Adhyayana 13-14 1891 *Leumann, E. 1891. Die Legende von Citta und Sambhuta WZKM 5 (1891) 111-46 and 6 (1892) 1-46. Balbir 1993, 21] Text and German translation. See also Bruhn 1996, 19-20. 1923 Jain, Banarsi Das. Ardha Magadhi reader. Lahore, 1923. lxv, 178 p. ; 22 cm. Printed as extract 12 (Cittasambhuya), p. 63-74, a few variants from the (Agamodaya Samiti edition [Utt.1916-17?) are cited. Reprint. Delhi : Sri Satguru Publications, 1982. ANU PK1255.J34 1982 Adhyayana 14 1926 *Iksukaradhyayana sa-citra (Hindi-bhasa]/anuvadaka ... Muni Sri-Pyaracandaji ... [adhyaya 14]. Ratlam : Jainaprabhakara Press, 1983 [1926). [2], 2, [2], 2, 68, [2] ; 13 x 18 cm. [CLIO 2, 2827] TRANSLATIONS: English: 1895 Gaina Sutras translated from Prakrit / by Hermann Jacobi. Part 2: The Uttaradhyayana Sutra. The Sutrakritanga Sutra. Oxford, Clarendon Press, 1895. xli, 456 p. (Sacred Books of the East; 45). Contents: Introduction (xiii)-xli.Uttaradhyayana [1]-232.Sutrakritanga (2351 435.Index of names and subjects [4371-442.-Index of Sanskrit and Prakrit words occuring in the text and the notes (443)-451.-Correction [to p. 102] 451. The translations of Adhyayanas 5, and 13-14 are reprinted in Banarsi Das Jain's Ardha Magadhi reader (Lahore, 1923), p. 142-146 and 154-166. Reprint. Delhi : Sri Satguru Publications, 1982. Reprint 2. Delhi : Motilal Banarsidass, 1964, 1968 etc. 22 cm. 3 New York : Dover, 1968. ANU BL1010.53 v. 45 See also Utt. 1977c. German: 1979 Die Bekehrung des Konigs Nami : Legenden aus den Uttaradhyayana-Sutra : mit 36 Miniaturen aus einer Jaina-Handschrift / herausgegeben und aus dem Prakrit ubertragen von Wolfgang Morgenroth. Leipzig : Gustav Kiepenheuer Verlag, 1979. 94 p. ; 23 cm. Contents: (Colour plates and translation] 1-76.-Nachwort / W. Morgenroth 76-85.Die >>Westliche Schule<< der Miniaturmalerei und die Jaina-Handschriften des 13.-16. Jahrhunderts / Regina Hickmann 86-90.--Text- und Bildnachweis 90-91.Anmerkungen 91-94. Miniatures reproduced from Berlin MS.or.fol. 1708 University of Poona CASS Library Q31:2161 / 113L9 / 14942 Gujarati: 1879 (Utt.1879) 1934 *[Incomplete Gujarati translation. Jamanagara : Hiralala Hamsaraga, 1934. [Utt. 1984a, 13 (1st group)] 1935 *[Gujarati translation / Muni Santabala.) (Utt. 1984a, 14 (1st group] <1935-39> (Utt.<1935-39>) 5 Gujarati commentary by Jayakirti published in Utt.1909. 196
Page #218
--------------------------------------------------------------------------
________________ 6.1 Uttarajjhayana 1938 *|Mahavirasvamino antima upadesa : Gujarati chayanuvada / Gopaladasa Jivabhar Patela. Ahamadabada : Jainasahitya Prakasana Samiti, 1938.) [JSBI 2, 145 item ga; JSBI 2:146n] (Utt.1952) 1952 1954 *[Meaning (artha) in Gujarati with exemplary stories (dharmakatha) Utt. 1-15 only.) Ahmadabada : Jaina Pracya Vidya Bhavana, 1954. [Utt. 1984a, 14 (1st group)] 1954 (Utt. 1954b) 1959-61 Ghasilala (Utt. 1959-61) <1984 Hindi translation of Utt.1972 translated into Gujarati by Durlabhajr Kesavaji Khetani. Bombay. [date unknown, but between 1972 and 1984) (Utt. 1984a, 14 (1st group) Hindi: 1919 Amolaka Rsi (Utt.1919) 1935 Sri Uttaradhyayana sutra ka Hindi anuvada/mula anuvadaka Muni Sri Saubhagyacandraji. 1. avrtti. Mumbai : Sri. Sve. Sthanakavasi Jaina Kanpharensa, Vira samvat 2461 (1935).9, 5, 8, 454 p. ; 18 cm. (Srihamsaraja Jinagama Vidya-pracaraka phanda samiti, grantha 1). Printed Ajmer. "2000 prati." ANU BL1313.9.U774 H4 1935 and PK5003.A58U8 1935 1939-42 (Utt. 1939-42) 1953 Ghevaracandra Banthiya (Utt.1953b) 1959-61 Ghasilala (Utt. 1959-61) 1963 Ratnalala Dosi (Utt.1963) 1967 Muni Nathmal (Utt. 1967) 1972 Sadhavi Candana (Utt.1972) 1974 Dasavaikalika aura Uttaradhyayana / vacana pramukha Acarya Tulasi ; sampadaka anuvadaka Muni Nathamala ; sahayogi Muni Mithalala, Muni Dulharaja. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2031 [1974). ja, 267 p. Contents: Prakasakiya [1].--Sampadakiya [3].--Sva kathya [ka]-na.-Visaya-vastu [cal-ja.-Dasavaikalika [1]-70.-Uttaradhyayana [72]-255.-Parisista Iktisvem adhyayana memae hue kucha-eka visayom ka vivarana [257]-267. BORI 28 611 X.B(Jainism) 1983-89 Hastimala (Utt. 1983-89) 1984 Misrimala (Utt. 1984a 1 =1991]) 1992-93 Yuvacarya Mahaprajna (Utt. 1992-93) 1926 Adhyayana 14. (Utt.Partial edition . 1926) Kannada: 1971 (Utt.1971) PARTIAL TRANSLATIONS: Bengali: Adhyayana 1-18 (Purana Chand Syamsukha and Ajit Ranjan Bhattacharya. Utt.Partial edition.1962) English: Adhyayana 1 1993 K. R. Norman (Utt.partial edition. 1993) Adhyayana 4 1980 K. R. Norman (Utt.partial edition. 1980) Adhyayana 6 1990 W. B. Bollee (Utt.partial edition. 1990) Adhyayana 8 1977 W. B. Bollee (Utt.partial edition. 1977) Adhyayana 14 1981 N. Tatia and Muni Mahendra Kumar. (Tatia 1981, 87-90) Atmaramaji published a Hindi translation in Lahore : Jaina Sastramala, date unknown (Nagraj 1986, 740 no. 15). 197
Page #219
--------------------------------------------------------------------------
________________ Mulasutras Adhyayana 28 1989 John Edward). Cort. Liberation and wellbeing : a study of the Svetambar Martipujak Jains of North Gujarat/John E. Cort. PhD dissertation, Harvard University. 545 p. [1993, 421). Appendix I: Moksa-marg, includes English translation of Utt. 28 (p. 475-81) (The bibliography cites two editions, Utt.1922 and 1923-27 sie. 1923-33]). French: Adhyayana 11 1987-88 W. B. Bollee (Utt.partial edition. 1987-88) German: Adhyayana 13-14 1891 E. Leumann (Utt.partial edition. 1891) Gujarati: Adhyayana 1 Utt.partial edition. 1898 Adhyayana 1-15 Utt.partial edition. 1954 STUDIES: General: Alsdorf, Ludwig. 1966. The Arya stanzas of the Uttarajjhaya : contributions to the text history and interpretation of a canonical Jain text. Mainz : Akademie der Wissenschaften und der Literatur, 1966. [1], [1571-220. ; 25 cm. (Abhandlungen der Geistes- und Sozialwissenschaftlichen Klasse Jahrgang 1966, Nr.2). Uses Utt. 1922, 1916-17. Treats "the 109 Aryas found in seven of the dogmatic and disciplinary chapters of the last third of the Utt. (adhy. 24, 26, 28, 30, 33, 34, 36). 24.16 (p. 160-62): 26.15-16, 19-20, 24-31, 33-35 (detailed retranslations, pages 179-200): 28.16-31 (p. 200-09): 30.2, 8, 10-13, 30 (p. 209-14) 33.5-6 (p. 178-79): 34.10-15, 20, 33-60 (p. 214-20): 36.61 (p. 176-78); 36.255-66 (p. 163-76) Review. K. Bruhn *ZDMG 122 (1972) 431-33. See also Bruhn 1996, 23-38. ANU PAMPHLET PK 5003.A8A4 Brown, W. Norman. 1941. Manuscript illustrations of the Uttaradhyayana sutra, reproduced and described / by W. Norman Brown. New Haven : American Oriental Society, 1941. xiii, 54 p. ; 23 leaves of black and white plates ; 32 cm. (American Oriental series ; vol. 21) Illustrations from four MSS from Jain collections in India (details p. 3). Brown dates the text itself between 300 BCE and 526 CE. ANU END1002.B7 Caillat, Colette. 1983. The Strasbourg manuscript no. 4385 of the Uttarajjhaya-sutta : illustrations with a narrative subject and illustrations with edifying connotation. Indologica Taurinensia 11 (1983) (241)-273 [2 colour plates ; 25 figures). ANU SERIAL DS401.158 Charpentier, Jarl. 1913. *Uber eine alte Handschrift der Uttaradhyayanatika des Devendragani. ZDMG 67 (1913) 665-78. [Oberlies 1993, 185) Dixit, K. K. 1978. A historical evaluation of Uttaradhyayana and Dasava ikalika. In, Early Jainism. Ahmedabad : L. D. Institute of Indology, 1978. 8, 99 p. ; 25 cm. (LD series ; 64), p. [22]-33. ANU BL1351.2 .053 Guerinot, A. La doctrine des etres vivants dans la religion jaina. Revue de l'histoire des religions 48 (1903). [BORI Cat. 17:3, 6] Jaina, Sudarsanalala. 1970. Uttaradhyayana-sutra : eka parisilana / lekhaka Sudarsanalala Jaina. Amstasara : Sohanalala Jainadharma Pracaraka Samiti ; Prapti-sthana: Varanasi : Parsvanatha Vidyasrama Sodha Samsthana, 1970. 16, 532 p. ; 23 cm. (Parsvanatha Vidhasrama granthamala ; 15). 198
Page #220
--------------------------------------------------------------------------
________________ 6.1 Uttarajjhayana PhD. thesis, Banaras Hindu University, 1967. [Jain and Singh 1983, 6] ANU BL1313.9.U776 J3 1970 Nathmal, Muni 1989. Abhyudaya : adhara-sutra, Uttaradhyayana / mukhya sampadaka Muni Dulaharaja ; sampadaka Muni Dhananjaya. 1. samskarana. Nagaura, Raja. : Jaina Visva Bharati, 1989. 12, 225 p. ; 23 cm. (Prajnaparva pravacanamala; 1). Discourses on the Uttaradhyayana. 2. samskarana. Ladanum, Rajasthana : Jaina Visva Bharati, 1990. ANU BL1313.9.U776 N37 1990 Navaba, Sarabhai Manilala. 1961 or 1962. Sri Uttaradhyayanasutra citravali. Gopipura, Surata : Setha Devacanda Lalabhai Jaina Pustakoddhara Phanda, Vira samvat 2488 (1962); Vikrama Samvat 2018 (1961). 13 x 28 cm. 37 [ie. 74 p. l. (Sresthi Devacanda Lalabhai Jaina Pustakoddhara Phanda granthanka ; 114). Black and white reproductions of manuscript illustrations, one for each adhyayana of the Utt.; some verses cited. ANU LARGE PAMPHLET BL1313.9.U777628/RW Norman, K. R. 1960-76. Middle Indo-Aryan studies 1-16. Journal of the Oriental Institute (Baroda) 9-29 (1960-83). (Reprinted in K. R. Norman. 1990-<1996> Collected papers. v.1-. Oxford : The Pali Text Society, 1990<1996>.] A series of articles discussing (amongst other things) many words from the Utt. The Collected papers are indexed. JOI(B) 9 (1960) 268-73. [Collected papers 1 (1990) (15)-20). JOI(B) 10 (1961) 268-73. (Collected papers 1 (1990) (25)-29). JOI(B) 11 (1962) 322-27. Collected papers 1 (1990) [30]-35). JOI(B) 13 (1964) 208-13. [Collected papers 1 (1990) (36) 41). JOI(B) 15 (1965) 113-17. [Collected papers 1 (1990) [42]-46). JOI(B) 16 (1966) 113-19. [Collected papers 1 (1990) (77)-84). JOI(B) 18 (1969) 225-31. Collected papers 1 (1990) (85)-92]. JOI(B) 20 (1971) 329-36. [Collected papers 1 (1990) [122]-129). JOI(B) 21 (1972) 331-35. [Collected papers 1 (1990) (156)-60). JOI(B) 23 (1973) 64-71. Corrected. Collected papers 1 (1990) (161)-69). JOI(B) 24 (1974) 139-44. Collected papers 1 (1990) (181)-86). 12 JOI(B) 28 (1978) 78-85. [Collected papers 2 (1991) [20]-29). 13 JOI(B) 25 (1976) 328-42. Collected papers 2 (1991) [220]-37). 14-15 JOI(B) 29 (1976) 37-49. [Collected papers 2 (1991) [113]-27). Simha. Mahendranatha, 1990. Bauddha tatha Jaina dharma : Dhammapada aura Uttaradhyayanasutra ke paripreksya mem tulanatmaka adhyayana. 1. samskarana. Varanasi: Visvavidyalaya Prakasana, 1990. 20, 260 p. ; 23 cm. PhD. thesis, Kasi Hindu Visvavidyalaya. ANU BL1313.9.U776 S56 1989 Ticken, Herman. 1998. The distribution of the absolutives in -una(m) in Uttarajjhaya. Asiatische Studien = Etudes asiatiques 52 (1998) [261]-286. Tulsi, Acarya. 1968. Uttaradhyayana : eka samiknatmaka adhyayana. 1. avrtti. Kalakatta : Jain Svetambara Terapanthi Mahasabha, 1968. 12, 514, 60 p. ; 22 cm. University of Poona 031:2161:9 / 15 Watanabe, Shoko. * Explorations of the parallels between the Jaina Utt. and Buddhist literature" in A commemorative volume for Dr. (R.) Hikata. Tokyo, 1964. 81-95. Studies of individual chapters: Adhyayana 9 Alsdorf, Ludwig. 1962. Namipavvajja : contributions to the study of a Jain canonical legend. In, Indological studies in honor of W. Norman Brown/ edited by E. Bender. New Haven, 1962. p. 8-17. On Utt. 9. (Reprinted. Kleine Schriften 1974, 215-24) See also Bruhn 1996, 20-21. 199
Page #221
--------------------------------------------------------------------------
________________ Mulasutras ANU PK 102.Z5B75 Thaker, J. P. 1968. Genuineness of Uttaradhyayana-sutra IX. 34-36. Sri Mahavira Jaina Vidyalaya suvarnamahotsa va grantha = Shri Mahavira Jaina Vidyalaya Golden Jubilee volume : pt. 1. Bombay: Sri Mahavira Jaina Vidalaya, 1968. p. 179-84. (English section). Adhyayana 12 Charpentier, Jarl. *ZDMG 62: 725-47; 63:171-88. Deals with the legends in Utt. 12 (Hariesijja) and Utt. 14 (Usuyarija) (Schubring 1935 $54] Caillat, Colette. 1994. *The beating of the brahmins (Uttaradhyayana 12). In, Festschrift Klaus Bruhn. Reinbek, 1994. p. 255-66. [Bruhn 1996, 50) Adhyayana 13-14 Charpentier, Jarl. *ZDMG 62: 725-47; 63:171-88. Deals with the legends in Utt. 12 (Hariesijja) and Utt. 14 (Usuyarijja) (Schubring 1935 $54) Leumann, E. 1890. *Welt in Bild und Wort/hrsg. von Chr. G. Hottinger. Strassburg, 1890, 5 p. ; the legend of Utt. 13-14 (Citta-Sambhuijja). (Schubring 1935 $54] Alsdorf, Ludwig. 1957. The Story of Citta and Sambhuta. In, Felicitation volume presented to Prof. S. K. Belvalkar/ edited by S. Radhakrishnan, S. K. De [et al). Benares, 1957 p. 202-208. On Utt. 13-14. See also Bruhn 1996, 19-20. ANU PK402.Z5B4 Reprint. Kleine Schriften 1974, 186-92. ANU DS404.5.A47 Norman, K. R. 1991. Uttarajjhayana-sutta 14 : Usuyarijjam. In, Pam. Dalasukhabhai Malavaniya abhinandana grantha (1) = Pl. Dalsukh Bhai Malvania felicitation volume 1/ sampadaka Madhusudana Dhaki ; Sagaramala Jaina. Varanasi : Parsvanatha Vidyasrama Sodha Samsthana, 1991.32, 284, 206 p. ; 25 cm. (Jaina Vidya ke Ayama, granthanka 3 = Aspects of Jainology ; 3). p. [16]-26. "Examination of some of the verses of Utt. 14 and their counterparts elsewhere ..." deals with v. 9, 18, 19, 20, 27, 44-45, 46, 48. [Reprint. K. R. Norman. Collected papers 3 (1992) [244-56]] ANU NEW BOOKS COLLECTION 1 861 971 Adhyayana 15 Alsdorf, Ludwig. 1962. Uttarajjhaya studies IIJ 6 (1962) 110-36. On Utt. 10, 12, 15, 25. (Reprinted. Kleine Schriften 1974, 225-51] Text is only given in full for Utt. 15 and Das.10. "Devendra is not troubled by any metrical scruples; he explains the traditional text before him without the slightest regard to metrical correctness" (p.111). Alsdorf also censures Charpentier's edition for the same reason. See also Bruhn 1996, 21-23. ANU PK 1.15 Adhyayana 22 Alsdorf, Ludwig. 1955. [V]antam apatum, Indian linguistics 16 [Suniti Kumar Chatterji Jubilee volume) (1955) 21-28. On Utt. 22. Reprint. Kleine Schriften 1974, 178-85. See Bruhn 1996, 18-19. ANU PK1501.148 Charpentier, Jarl. 1910. *Studien uber die indische Erzahlungsliteratur, 4. Devendra's tika zu Uttaradhyayana 22. ZDMG 64 (1910) 397-429. [Oberlies 1993, 184) Adhyayana 23 Charpentier, Jarl. 1915. "Die Legende des heiligen Parsva, des 23. Tirthakara der Jainas : aus Devendra's tika zu Uttaradhyayana 23. ZDMG 69 (1915) 321-59. [Oberlies 1993, 185) Adhyayana 25 Charpentier, Jarl. 1910. *Zu Uttarajjhayana XXV. WZKM 24 (1910) 62-69. [Bruhn 1996, 50) 200
Page #222
--------------------------------------------------------------------------
________________ 6.1 Uttarajjhayana Adhyayana 27 Caillat, Colette. 1985. Le maitre et les bouvillons : Uttarajjhaya 27. Bulletin d'etudes indiennes 3 (1985) [11]-24. French translation and notes, without text. ANU SERIAL DS401.B86 Indexes: 1928 Nandyadigathadyakaradiyuto visa yanukramah : Srinandi-Anuyogadvara-Avasyaka Oghaniryukti-Dasavaikalika-Pindaniryukti-Uttaradhyayananam sutrasutragathaniryuktimulabhasyabhasyanam akaradikramah ankasuddhih laghubshams ca visayanukramah = An Alphabetical index of the aphorisms etc. occuring in Nandisutra, Anuyogadvara, Avasyaka, Oghanir y ukti, Dasavaikalika, Pindaniryukti and Uttaradhyayanasutra : along with detailed lists of subjects treated in these seven Agamas. Mumbayyam: Sri Agamodayasamiteh karyavahakah Jivanacandra Sakaracandra Jhaveri, Virasamvat 2454 (1928). f. 183 [ie. 366 p.) ; 12 x 26 cm. (Sri-Agamodayasamiti Granthoddhara, granthakah 55). ANU BL1313.89.N25 1928 1959 (Utt. 1959): Index of verses p. 129-150. 1960-67 (Utt. 1960-67): Sriuttaradhyayanavacurnau 1. parisistam. Gathanam sutranam cakaradi kramah 332a-344a.-2. Savacurikasriuttaradhyayanagatani granthanamani 344b-345a.3. Savacurikasriuttaradhyayanagatasaksipahanam akaradikramah 345a-347a.-4. Savacurikasriuttaradhyayanagatanam namnam akaradikramah 347a-355a.-5. Sriuttaradhyayanavacurnigata 'anye' ityadi 355a.-6. Sriuttaradhyayana vacurnigata nyayah 355a.-7. Sriuttaradhyayanavacurnikstksta kesancit sabdanam vyakhya 355a.-8. Savacurikasriuttaradhyayanagatani agamiki-paribhasadini. 356a-358b.-9. Agamoddharakakrta-Agamacitraratnamalayam darsitani Sriuttaradhyayanacitrani 3586.-10. Sriuttaradhyayanavacurnigatadestantanam anukramah 359a-360b. (11.) Srimaduttaradhyayanasutrasya srimajjnanasagarasurikrtavacurehadibhagah 361a-402a.-12. Sriuttaradhyayanavacurnau suddhipatrakam 402b408a. 1966 (Utt. 1966): Parisista 2. Utt. sabdasuci p. [93]-330.--3. Namanukrama (333)-340. 1967 1977 (Utt.1967): Parisista 1. Sabda-vimarsa p. [1]-26. (Utt.1977a): 4. parisittha. Uttarajjhayanasuttassa suttanukkamo p. [445)-470.-5. Uttarajjhayanasuttantaggayanam saddanukkamo (471)-630.--6. Uttarajjhayanasuttantaggayanam visesanamanamanukkamo (631)-634. (Utt.1983): Uttara'jjhayanasuttassa gathanukkamo [1]-100. (Utt. 1987): combined index of: Nandi. (including JogNa. and Lahuna.) AnuOg., Utt., Dasave., Av., Dasa. (including Ayar.Das.), BhKapp., Viva, and Nis. : Parisista 3. Navasuttani saddasuci (15 505 words). p. [1]-319. 1983 1987 1995 Uttarajjhaya : pada index and reverse pada index/ Moriichi Yamazaki and Yumi Ousaka. Tokyo : The Chuo Academic Research Institute, 1995. iii, 261 p. ; 30 cm. (Philologica Asiatica : Monograph series ; 5). Based on Charpentier's edition (1922). Index integrated into A Pada index and reverse pada index to early Jain Canons : Ayaranga, Suyagada, Uttarajjjhaya, Dasaveyaliya, and Isibhasiyaim/ by Moriichi Yamazaki and Yumi Ousaka. Tokyo : Kosei Publishing Co., 1995. 537 p. 23 cm. Review: BEI 11-12 (1993-94), 467-68. 1995 A Pada index and reverse pada index to early Jain Canons : Ayaranga, Suyagada, Uttarajjhaya, Dasaveyaliya, and Isibhasiyaim/ by Moriichi Yamazaki and Yumi Ousaka. Tokyo : Kosei Publishing Co., 1995.538 p. 23 cm. Includes Uttarajjhaya : pada index and reverse pada index / Moriichi Yamazaki and Yumi Ousaka. Tokyo : The Chuo Academic Research Institute, 1995. iii, 261 p. ; 30 cm. 201
Page #223
--------------------------------------------------------------------------
________________ Mulasutras (Philologica Asiatica : Monograph series ; 5). Based on Charpentier (1922) but here expanded to include Chapter 15 Alsdorf (1962); Chapters 1, 4, 8 Norman (1993, 1980, 1977a); Chapter 10 Alsdorf (1962). Review: "Les editions de la Jaina-Agama-Series ne sont toujours pas prises en compte et aucune explication n'est fournie a ce fait ... On continue aussi a regretter qu'aucune indication abregee ne figure pour caracteriser le metre des pada. Toutefois, tel qu'il est, ce volume fait un instrument de travail extremement utile." Nalini Balbir BEI 13-14 (1995-96), 543. RW 1997 Uttarajjhaya : word index and reverse word index / Moriichi Yamazaki and Yumi Ousaka. Tokyo : The Chuo Academic Research Institute, 1997. ii, 302 p. ; 30 cm. (Philologica Asiatica : Monograph series ; 11). [RW] Based on Charpentier's edition (1922). Review: Nalini Balbir BEI 13-14 (1995-96) 544-45. RW 1999 A word index and reverse word index to early Jain canonical texts : Ayaranga, Suyagada, Uttarajjhaya, Dasaveyaliya, and Isibhasiyaim / Moriichi Yamazaki and Yumi Ousaka. Tokyo : The Chuo Academic Research Institute, 1999. iii, 410 p. ; 30 cm. (Philologica Asiatica : Monograph series ; 15). The 1997 index integrated with those for other texts with additional material from Alsdorf's Utt.partial edition.1962 (Alsdorf) and Norman's work on chapters 1, 4, and 8 in Utt.partial editions. 1993, 1980, 1977 (see p. iii). RW 202
Page #224
--------------------------------------------------------------------------
________________ 6.2 DASAVEYALIYASUTTA (Dasave.) Author: attributed to Sejjambhava /Sayyambhava, who is said to have taught it to his son as a collection of the most important teachings. Title: Dasakaliya!: Dasavaikalika (Skt). Content: "Sayings pertaining to the monastic life, some of which remind us of the sayings in the Dhammapada, whilst others contain only rules for monastic discipline. Section II is connected with the ballad of Rajimati in the Uttaradhyayana ... she admonishes Rathanemi who wishes to seduce her" (Winternitz 1933:2, 471). References: Schubring 1935, 854; JRK 169-71; BORI Cat. 17:3, 91-131; JSBI 2, 179-91. Exegesis: Bhadrabahu, Dasaveyaliyaniryukti (DasaveNi.). Reference: JSBI 3, 97-104. In 445 gathas, of which about 63 gathas are termed Mulabhasya gathas. The latter are evidently supplements to the original work, cf. A. M. Ghatage. The Sutrakrtanga-niryukti, IHQ 12 (1936) 631. (JRK 169-170). 1989 Nirvukti-sangrahah / Bhadrabahusvamiviracitah , sampadakah samsodhakas ca Srijinendrasuri. Prathamavsttih. Lakhabavala, santipuri, Saurastra : Sri Harsapuspamsta Jaina granthamala, Vira sam. 2515. Vikrama sam. 2045. San 1989. 20, 600 p. ; [1] plate : 19 cm. (Sri Harsapuspamsta Jaina granthamala ; 189). Sridasavaikalika-sutra-niryuktih [328]-364. "750 Pratayah." ANU BL1310.4 B432 1989 1995 The Nijjuttis on the seniors of the Svetambara Siddhanta : Ayaranga, Dasaveyaliya, Uttarajjhaya and Suyagada : text and selective glossary/Willem B. Bollee. Stuttgart : Franz Steiner, 1995. ix, 197 p. ; 24 cm. (Beitrage zur Sudasienforschung SudasienInstitut Universitat Heidelberg; Band 169). Dasaveyaliya Nijjutti: p. 31-73. Based on editions of Leumann (1892), who worked from MSS, and [Dasave.1918b), the text in the latter edition was used for the 1989 Niryukti-sangrahah text. The two Curnis have also been used (1933 and 1973a). Reviews: Herman Tieken, Asiatische Studien = Etudes asiatiques 1996 [681)-683.Paul Dundas, BSOAS 60 (1997) 152-53.--Nalini Balbir BEI 13-14 (1995-96) 54748.-K. R. Norman, The Jain nijjuttis Acta Orientalia 58 (1997) 52-74. RW Also printed Dasave. 1892; 1900b; 1918b; 1932b; 1973a. Dasave.Cu. 1933. Translated into Gujarati: Dasave.Trans.Guj. 1921-30. | The following notes are from Ghatage's 1938 article on this text: even from the earliest times it appears, there was no agreement among the traditional writers about the form and the interpretation of the name of the work usually known as the Dasavaikalika Sutra. Like many other works in the Ardha-Magadhi canon there is no occasion to give the title either in the introductory or concluding portions of the text. References in other works and the comments upon it are also not unanimous. The Nandisutra uses "Dasaveyaliya." Bhadrabahu, author of the oldest cty on the Nandi uses Dasakaliya (six times), Dasaveyaliya (twice) and where he attempts to explain the name he uses Dasakaliya. Jinadasamahattara in the DasaveCu. uses Dasaveyaliya as does Haribhadra. Although other forms are found, these two authors always explain the name based on the form Dasaveyaliya. Only in the case of the Vanhidasao is "-dasa" in a title not linked to ten chapters. Here we have ten chapters plus two appendices, culikas. -veyaliya occurs only in Tandulaveyaliya, also in the ukkaliya section with the Dasaveyaliya, but there it means calculation (veyaliya = vicara) of the number of rice grains and so cannot have any link to Dasaveyaliya. The Nijjutti makes three different attempts to give the meaning of the title. vikala may mean the time of evening or an improper time. As to the word kaliya: "There is a method of dividing the canon into four Anuyogas and it is common to both the sects of the Jain community and as such it must be very old." Caranakarananuyoga: canonical works on carana and rules of good conduct and karana or rules of begging food were called Kalikasruta. The Nandi has the older classification into Anga and Angabahira. To Ghalage's mind, originally the work was called Dasakalika and not Dasavaikalika it thus meant: "ten chapters dealing with the rules of conduct and of begging food." (Ghatage, Dasave.study. 1938, p. 232-38).
Page #225
--------------------------------------------------------------------------
________________ Mulasutras 2 3 5 6 7 8 9 10 11 1.1 Jnanasagara Suri, pupil of Devasundara Suri of the Tapa Gaccha, Niryukti-avacuri, a brief commentary on Bhadrabahu's Niryukti, composed samvat 1441 [1384] (JRK 170b). 13 14 Study: 1935 Ghatage, A. M. The Dasavaikalika-Niryukti. IHQ 11 (1935) 627-39. [Balbir 1993, 18] Vrddhavivarana (Bruhn 1996, 46), formerly known as Dasaveyaliyacunni (DasaveCu.). I. Jinadasagani, 7 000 granthas (JRK 170a; JSBI 3, 306-307). 1933 Prasiddhya Srijinadasaganimahattararacita Sridasavaikalikacurnih : Srutakevalibhagavacchayyambhavasurisutritasutrya Srutakevalisrimadbhadrabahusvamisandrbdhaniryuktika [ / edited by Sagarananda]. Ratalama Sri Rsabhadevaji Kesarimalaji Svetambarasamstha, Vira samvat 2459. Vikrama sam. 1989. Kraista 1933. 1, [ie. 2], 380 p.; 12 x 27 cm. Contents: Sridasavaikalikacurner upakramah / Anandasagarah [1a].-Adhyayananam anukramah [2].-Atha Dasavaikalikacurnih 1-380 p. Haribhadra himself has referred to this cty using the name Vrddhavivarana (Dasave.Cu. p. 252), ... also mentioned in Sumatisuri's tika (p. 214) (Dasave. 1973, Prastavana p. 2). "Many of [DasaveCu. 1933's] readings are of little interest, because they are against the metre... or uncertain, because integrated in the syntax of the Curni... A striking feature... is the great number of quotations from Panini" (W. B. Bollee, DasaveNi. 1995, 31). "Pratayah 500." LD 6257/BORI 3736 X.B. II Agastyasimha. [Ref. JSBI 3, 315-20] Printed Dasave. 1973a. Haribhadra, Yakiniputra Tika 6 850 granthas. Begins: jayati vijitanya ... (JRK 170a). Printed Dasave.1900a; 1900b; 1918b; <1942>; 1980 or 1981. Vrtti. Ends: bhavambudhes samullanghya te yanti paramavyayam. MS dated samvat 1200 [1143] (JRK 171a). Tilakacarya, pupil of Sivaprabha Suri, Tika, 7 000 granthas, composed samvat 1304 [1247] (1346 [1280] according to Jaina granthavali) (JRK 170b) = Sritilaka? (Schubring 1944, 5758). Vinayahamsa, pupil of Mahimaratna of the Vidhipaksa (Ancala) Gaccha, Vrtti, 2 100 granthas, composed samvat 1572 [1515] (JRK 170b). Rajahamsopadhyaya, Balavabodha one MS dated samvat 1662 [1605] (JRK 171b; Schubring 1944, 56, 59). Rajacandra Suri, Stabaka, composed samvat 1667 [1610] (JRK 171a). Samayasundara, pupil of Sakalacandra of the Kharatara Gaccha, Sabdarthavrtti, composed samvat 1681 [1624] (JRK 170b). Printed Dasave. 1900a; 1900b; 1915; 1918a. Yatindra, pupil of Hemanandana, pupil of Ratnasagara Gani of the Kharatara Gaccha, Balavabodha composed samvat 1711 [1654] (JRK 171a). Kamalaharsa, pupil of Manavijaya of the Kharatara Gaccha, Dasavaikalikagitani, composed in samvat 1723 [1666] (JRK 171b). Undated commentaries 12 Dasavaikalikasutrabrhadvrttiparyaya (BORI Cat. 17:3, 113-14). Dipika. Printed 1905. Jinadeva Suri (?), Vrtti, 3 600 granthas (JRK 171a). 204
Page #226
--------------------------------------------------------------------------
________________ 6.2 Dasaveyaliya Kanakasundara Gani, Tabba (BORI Cat. 17:3, 125). Merusundara, pupil of Ratnamurti of the Kharatara Gaccha, Balavabodha (JRK 171a). Manikyasekhara, Vrtti-dipika (JRK 171a). Niryukti-avacuri (JRK 171a). Parsvacandra Suri, Balavabodha (JRK 171a). Santideva Suri, Avacuri (JRK 171a). Somavimala Sari, Stabaka (JRK 171a). Sumatisuri, pupil of Bodhakacarya, Tika 2 600 granthas (JRK 170b; Schubring 1944, 55, see *ZDMG 46 (1892) p. 583). Printed Dasave.1954b. Sumativijaya (Sumatisuri?), sika (JRK 171a). Vrtti (JRK 171a). Yasobhadra Suri, Dasavaikalikasutra-Culikayugalavacuri (BORI Cat. 17:3, 125). 205
Page #227
--------------------------------------------------------------------------
________________ Mulasutras Editions: 1892 1900a 1900b 1900z 1905a 1905b 1910 1912a 1912b 1915 1918a *Leumann, Ernst. Dasavaikalika-sutra und -niryukti auf ihren Erzahlungsgehalt untersucht und herausgegeben. ZDMG 46 (1892) 581-663. [Bollee 1991-94 1,vii] Translation of the first three chapters. "[H]ighly valuable introduction formed by an investigation of the stories alluded to in the commentaries." Text. p. 613-43.-Niryukti p. 643-63 (Schubring, Dasave.1932, vii). To be reprinted in the Kleine Schriften of Ernest Leumann (forthcoming) (Bruhn 1996, 51). *The Dasa-vaikalika-sutra by Sayyambhava and the Dasa-vaikalika-niryukti by Bhadrabahu published in Roman characters from Strassburg, Berlin and Poona manuscripts with a German introduction/ [by Ernst Leumann]. Abstract from vol. 46 of the Journal of the German Oriental Society, 1892. [3], 581-663 p. ; 22 cm. [CLIO 1, 702] *[Text with ctys of Haribhadra and Samayasundara and avacuri in Gujarati / edited by Bhimasimha Manaka [Maneka?]]. Bombay : Nirnayasagara Press, 1900. [Bollee 1995, 31; unclear whether it is the same as 1900b or not] *Dasavaikalika-sutra / Sri Sayyambhavodgararupam; Gurjarabhasasahitamavacurisamvalitam, Samayasundaropadhyayakrta Dipikasanatham, Sriharibhadrasuri krta Brhadvrtti virajitam. Mumbapuri: Nirnayasagara, samvat 1957 [1900]. 722 p. ; 27 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 43). [Univ. of Chicago Library catalogue] Dasavaikalikasutra : mula / pragata karta Dosi Jivarajabhai Ghelabhai. Amadavada: Sri Jaina Printinga Presa, [no date]. 70 p. ; 22 cm. Contents: Prastavana [Gujarati in Devanagari script, mentions that [Dasave.1892] is here printed in Devanagari] reverse of t.p.-Dasavaikalikasutra 1-68.-Suddhipatra [69]-70.-Prastavana repeated. Schubring says the third edition of this book came out in 1924 (Schubring Dasave.1932 Introduction, viii). Other dates: 1912 (JRK 169); 1914 and 1924 (JSBI 2, 179). The relationship between the editions of 1900z, 1912b and 1923-24 is unclear. ANU MENZIES pamphlet BL1313.9.D38 1900z *Dasavaikalika Dipika. Jamanagara : Hiralala Hamsaraja, 1905. [Devendra Muni 1977, 718 item 16] *Dasa-vaikalika-sutra mula. Ahmedabad : Jaina Printing Press, 1905. [ii], 70, [i] p.; 13 x 22 cm. [CLIO 1, 701] Sri Dasavaikalikasutraprarambhah. Surata : Nanacanda Bhayacanda, samvat 1966 [1910]. 80 [ie. 160] p.; 12 x 27 cm. Printed. Mumbai: Nirnayasagara Presamam. Large print. ANU MENZIES BL1313.9.D38 1910 *Dasa vaikalika sutra of Sejjambhava / edited by ... Ernst Leumann... Journal of the German Oriental Society, 46 (1892). Nagari transcription [without Leumann's text of the Niryukti]. Ahmedabad: United Printing and General Agency Company, 1912. [iv], 80, p. covers; 24 cm. (The Sacred books of the Jains). [CLIO 1, 701] 3rd edition 1923-24. *Sri-dasa-vaikalika-sutra-prarambhah [Gujarati] artha suddha mula tatha bhavartha sahita) ... (Chapavi prasiddha karanara Daktara Jivaraja Ghelabhai DosT). Ahmedabad: The United Printing Press, 1912. f. 6, 183+ [1] ; 13 x 23 cm. [CLIO 1, 701] The relationship between the editions of 1900z, 1912b and 1923-24 is unclear. *[Text with Samayasundara's commentary.] Jamanagar: Hirala Hamsaraj, 1915. [JRK 169a] Reprint 1938? (JSBI 2, 179). Dasavaikalikasutram: Mahopadhyayakharataragacchiyasrimatsamayasunadaraganiviracitaya vrttya samalankrtam. Khambhatavartti Jainabhandhusamajajnaya : Srijinayasas 206
Page #228
--------------------------------------------------------------------------
________________ 1918b 1919a 1919b 1924 1930a *LD 10 834 1923-24 Dasa-vaikalika-sutra. 3rd ed. Ahmedabad: The Praja Hitarth Mudralaya Printing Press, 1923-24. [2], 80, p. covers; 13 x 23 cm. (The Sacred books of the Jains). [CLIO 1, 701] The relationship between the editions of 1900z, 1912b and 1923-24 is unclear. *Dasa-vaikalika-sutra-prarambhah (artha suddha mula tatha [Gujarati-]bhavartha sahita). Ahmedabad: Praja-hitartha Press, 1924. [2], 183, [1] p. ; 13 x 25 cm. [CLIO 1, 701] 1930b 1932a 6.2 Dasaveyaliya 1932b surijigrantharatnamalasamitih, Vikrama samvat 1975 [1918]. 4, 118 [ie. 8, 236] p.; 12 x 27 cm. (Srijinayasahsuriji-grantharatnamalayah; prathamam (1) ratnam). t.p. "Atha Dipikavyakhyasametam Sridasavaikalikam prarabhyate." Prastavana (3b (1st group)) refers to Dasave.1900b. Printed: Cambay / Khambata, 1919. (Jinayasasuri granthamala) (JRK 169a). A "reliable edition" (W. Schubring Dasave. 1932a, viii). Reprinted 1980 or 1981? ANU BL1313.9.D384 1918 Srimacchayyambhavasurisvarasutritam Srimaddharibhadrasurivarasisyabodhinisamjnakam Vivaranayutam Sridasavaikalikasutram. [/edited by Sagarananda]. Bombay: Sheth Devchand Lalbhai Jain Pustakoddhar Fund, Virasamvat 2444. Vikramasamvat 1974. Kraista 1918. [ii] [ie. 4], 286 [ie. 572] p; 12 x 22 cm. (Sresthi Devacandra Jainapustakoddhara ; no. 47). [CLIO 1, 702; DLJP series list] "Pratayah 1000." BORI 38125 *Dasavaikalika sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919. 144 p. ; 13 x 23 cm. *Sayyambhava-Suri-pranitam atha Sri-dasa-vikalika-sutra mula patha/samsodhaka Muni Jnanasundara. Bombay: Nirnaya-sagara Press, 2445 [1919]. 4, 52 p. covers; 14 x 18 cm. (Ratna-prabhakara Jnana-puspa-mala ; no. 34). [CLIO 1, 701] *Sri Dasavaikalika sutta: mula patha. Ahamadabada: Umedacanda Rayacanda, 1930. 80 p. [JSBI 2, 179] *[Dasavaikalikasutra with two culikas, [Gujarati] sabdartha and bhavartha.] Bombay : JainaMahila-Mandala, Santinatha Upasraya, samvat 1987 [1930]. [BORI Cat. 17:3, 96; Dasave.1932b] Dasaveyaliya sutta = The Dasaveyaliya sutta / edited by Ernst Leumann, and translated, with introduction and notes, by Walther Schubring. Ahmedabad: The Managers of Sheth Anandji Kalianji, 1932. ix, 130 p. ; 24 cm. [Reprinted. Walther Schubring. Kleine Schriften/ herausgegeben von Klaus Bruhn. Wiesbaden: Franz Steiner, 1977. xvii, 496 p. ; 22 cm. (Glasenapp-Stiftung; Band 13). p. [109]-248.] 1977b] Contents: Introduction iii-ix.-Text 1-80.-[English translation] 81-121.-Notes [122]130. "The text, as critically constituted by the first editor [Leumann], is, in this book, intended to serve the need of Prakrit students. It could be taken [ie. has been taken] nearly unchanged from the Nagari transcription supervised by the present writer [Schubring] in the charge of the late Dr. Jivraj Ghelabhai Doshi, L.M.S. (Bombay), a book of which the third edition came out in 1924" (vii-viii). The work has been guided by Jacobi's translation of parallel passages in SBE 22 and 45 and Leumann's metrical German version of chapters 1-3 [Dasave.1892]. Haribhadra's Tika (8th cent.) has been consulted throughout, it can be consulted from the reliable edition of the Devchand Lalbhai Fund [Dasave.1918b] (Introduction, viii).2 BORI 38 687 [1932 edition] ANU BL1355.S37 1977 Dasavealiya sutta (Ardha-Magadhi text with Niryukti of Bhadrabahu) = Dasavaikalikasutram (Bhadrabahukrtaniryuktisahitam): critically edited and published with introduction, notes and English translation / by Kashinath Vasudev Abhyankar. 1st ed. Ahmedabad: Kashinath Vasudev Abhyankar, 1932. 4, xvi, 100, 84, 60 p.; 17 cm. 207
Page #229
--------------------------------------------------------------------------
________________ Mulasutras Contents: Preface (3)-4.-Introduction i-xvi.--Dasavealiyasuttam [text with variant readings) 1-58. Raivakka culiya padhama 59-62 [Text with variants)--Biya culiya 6264.-Dasavaikalikaniryuktih [No variant readings 65-100.-Notes (on text and appendices, but not on the Niryukti] 1-84.- Translation text and appendices only) 160. "1000 copies" "The text of the present edition is mainly based on the oldest manuscript in the Dehla Upashraya [Ahmedabad), which was found to be written almost correctly, in the old manner of writing. The oldest of the Bhavnagar manuscripts consulted mentions 1643 Samvat (ie. 1586 CE or thereabout) as the date of its being written; the oldest Bhandarkar Oriental Research Institute manuscripts mention 1492 and 1515 samvat as their dates, while the oldest of the Dehla Upashraya copies go back to samvat fifteenth century. The text of the Niryukti is based upon two manuscript copies of the Dehla Upashraya Ahmedabad and one manuscript copy of Bhavnagar." (Preface, p. [3] (1st group)) **There are many printed editions also of the Sutra available and they have also been consulted, the Agamoda ya Samiti edition with Haribhadrasuri's commentary [Dasave. 1918b). Dr. Jivraj Ghelabhai's edition [Dasave.1900z; 1912b, 1923-24?] being the chief ones. It is to be regretted that almost all the printed editions are full of misprints and inaccuracies and present considerable difficulty to the reader. The Agamodaya Samiti edition is the best of the lot, but copies of it are no longer available in the market. There is no English translation also of the book prepared as yet. ... For purposes of translation and notes there was taken at several places, the help of the commentaries of Haribhadracarya, Sumatisuri, santisuri and a few Sanskrit and Gujarati glosses, by unknown authors. The Sanskrit glosses appear to be only abridgements of Haribhadrasuri's commentary." (Preface p. [3)-4) The MSS sources are described on p. xv-xvi: MS A, Dosabhai Abhechand Jain Sangha, Bhavnagar, not dated, no culikas. MS Ka Jaisalmer (Samvat 1643, Friday Ashadha Suddha 5) and Gujarati Balavabodha written by Rajahamsa Mahopadhyaya, pupil of the pupil of Jinaragasuri of Kharataragaccha, corrections in yellow pigment, no culikas. MSS Kha samvat 1653, Sunday Bhadrapad Vad 1, written at Stambatirtha, gives appendices. MS Ga with Dipika in Sanskrit is slightly different from kha. MS Gha BORI, samvat 1515, Saka 1377, culikas and Skt gloss. Two other MSS there samvats 1492 and 1663 and others with no date. MS Sa, Ahmedabad from Dehla Upashraya, no date but "a very reliable manuscript which has got the two Chulikas." The present edition is mainly based on this MS. Second edition 1938b. (Bollee 1995, 181). ANU PK5003 .A58D3 1932 BORI 57 917 X.B.Jaina text/ *LD 2722 1932c 1932d *[Text with Hindi tika / Atmarama. Mahendragarha, Patiyala : Jvalaprasada Manakacanda Jauhari, Vi. sam 1989 (1932). [JSBI 2, 179 item Reprint. 1946. *LD 6264 Jaina Siddhanta pathamala : Samskrtachayayuta : Dasavaikalika Uttaradhyayana sutra chaya sathe sampurna tatha Bhaktamara adi atha stotra, pucchisunam ane Tattvarthadhigama sutra mula patha sahita/chaya samyojaka Saubhagyacandraji. Prathamavrttih. Limbadi, Kathiavada: Sriajaramara Jaina Vidyasala. Vira 2485. Vikrama samvat 1989 (1932). 12, 456 p. ; 18 cm. Contents: Nivedana 3--Prasangika vaktavya 4-5-Suddhi-patraka 6-12.Dasavaikalika sutram 1-108. Sri Uttaradhyayana sutram 109-424.-Bhaktamara 2 Although it was thought that the English translation "was tacitly censored at the verse where the monk was enjoined to avoid meat with too many bones in it" (Dundas 1992, 153), subsequent information suggests this was not the case (Dundas, The meat at the wedding feasts : Krsna, vegetarianism and a Jain dispute. Toronto: University of Toronto, 1997. (The 1997 Roop Lal Jain Lecture) p. 20 n.7 and n.17). 208
Page #230
--------------------------------------------------------------------------
________________ 6.2 Dasaveyaliya stotram 425-29.-Srikalyanamandirastotram 429-33.-Sricintamani Parsvanatha stotram 434-35.-Sri Amitagatisuriviracita prarthana pancavimsatih 436-38.-Sri Ratnakarapancavimsatih 438-40.--Sri Paramananda pancavimsatih 441-42.-Svatma cintvana 442.-Pucchissu nam 443-45.-Sri Tattvarthasutram 445-55.Tirthankarastotram 455-56.--Satistotram 456. "Prata 2000." ANU BL1310.5.J25 1952 1938a 1938b *[Mula). Jamanagara, Hiralala Hamsaraja, 1938. [JSBI 2, 179] Reprint of Dasave.1915? *[Second edition of Abhyankar, 1932b.) [Bollee, 1995, 181] *[Text with Hindi cty/Muni Hastimallaji). Satara : Motilala Balamukunda Mutha, 1940. [JSBI 2, 179 item ;). 1940a 1940b Dasaveyaliya-suttam : edited with introduction, translation and copious notes / by A. T. Upadhye. Belgaum : Mahavir Press, 1940. 1. ed. viii, 352 p. ; 19 cm. (Sanskrit & Prakrit Jain Literature series ; no. 2). Contents: Errata (ii).--Preface (iii). -Contents [iv-v).-Introduction (vi)-viii.Dasaveyaliya-suttam: chapters 1-6 (text and translation][1]-63.--chapters 7-12 [text and translation) [65)-127.-Dasaveyaliya-suttam: chapters 1-6: notes (130)-240b [ic. 241).- Chapters 7-12: notes [242]-352. RW 1942 *[Dasave. text with Haribhadra's cty.) Bambai: Lala Manasukhalala Hiralala, V.S. 1999. [1942). [Alsdorf 1962 Itthiparinna, 116. JSBI 2, 179 item i] <1942- > Sridasavaikalikasutram : Samskrta-Hindi-Gurjara-bhasasamalankstam / vyttiracayita Ghasilalaji; niyojaka Samiramallaji tatha Kanhaiyalalaji. Avrtti 1. Limadi, Pancamahala : Sthanakavasi Jaina Srisangha, Vira samvat <2469- >; Vi. samvat <1998->; I. san <1942>. v. <1->; 25 cm. Prathamo bhagah Adhyaya 1-5. 7,551 p. ; 3 leaves of plates (portraits). "Prati 501." Reprint Dasave. 1957-60; 5 -1974>. ANU PK5003.A58D3 1942 v. 1 (only held] 1943 *[With Hindi translation / by Muni Amaracandra Panjabi.] Macchivara Vilayatirama Agravala, Vi. sam. 2000 (1943). [JSBI 2, 180 item el *LD 2724, 2725, 12 859 and 128 560 1945 or 1946 Sri Dasavaitalika sutram : culika sahitam : samsodhita mula patha tatha anvaya sahita sarala Hindi sabdartha / samyojakah Bhairadana Sethiya ; anuvadaka aura samsodhakah Ghevaracandra Barhthiya Viraputra.' 1. avitti. Bikanera : Agaracanda Bhairodana Sehiya Jaina Paramarthika Samstha, Vikrama samvat 2002 [1945] ; Vira samvat 2472 [1946). 118 p. ; 15 x 23 cm. (Sethiya Jaina granthamala ; 109). Contents: Dasavaikalika Sutra ki sanksipta visayanukramanikah (back of title-page]. - Sri Dasavaikalika sutram 1-118 p. Some pages unreadable because of the bleeding through of the printing on the reverse side. *500 (copies)." LD 6263 1946a Dasavaikalikasutram : Samskrtacchaya-padarthanvaya-mularthopetam Atmajnana prakasikahindi-bhasa-tikasahitam ca/anuvadaka Atmarama; sampadakah Amaracand[r]a. Prathamavstti. Lahaura : Jaina Sastramala Karyalaya, Mahavirabda 2472, Vikramabda 2003, Isavi san 1946. 3, 7 leaves of plates (portraits), 14, 10, 680 p. ; 24 cm. (Jainasastramala caturtha ratnam). Contents: Atha sacchastra paratantryamadhikrtyaha (quotation from Haribhadra Suri's Yogabindu, 221-30) [1]-3.-plates of portraits, family members of donors?]. - Prastavana / Atmarama [1]-14. -- Visaya-suci [1]-10.-Dasavaikalikasutram [1]680 p. *1000 [copies)." 209
Page #231
--------------------------------------------------------------------------
________________ Mulasutras "The text of this edition is mainly based on that of the Agamodaya Samiti edition Dasave. 1918b?] although the editions of Maksudabada resident Raya Dhanapatisimha Pratapasimha Bahadura Dasave. 1900b) and Jivaraja Ghelabhai [1900z or 1912b?) etc. have been helpful." (Prastavana p. 13) Sutra printed in red, as is the Hindi translation of the main text. First printing 1932 (JSBI 2, 179 item r). ANU PK5003.A58D3 1946 and BL1313.9.D384 H5 1946 1946b *Dasavaikalika tatha Uttarajjhayana / Pandit Munisri Harsacandji. Kallol, Kathiawad, 1946. 188 p. [Secondhand book catalogue; another catalogue "Dallol, 1949. 186 p."] *[With Hindi translation / Muni Trilokacandra.] Dehali : Jitamala Jaina, Vi. sam. 2007 [1950). [JSBI 2, 179-80 item el 1950 1953 Mula suttani : Sri Dasavaikalika sutra, Sri Uttaradhyayana sutra, Sri Nandisutra tatha Sri Anuyogadvara sutra ka Suddha mulapatha / sampadaka Kanhaiyalalaji Maharaja 'Kamala'. Prathamavrtti. 52, 588 p. ; 20 cm. Byavara, Gurukula Printinga Presa, Vira samvat 2479 [1953). Bare text, Dasavaikalika, p. [1]-72. Is this the same as an edition printed: Byavara, santilala Va. Setha. Vi. sam. 2010 (JSBI 2, 179)? "1000 (copies)." ANU PK5003.A58 1954 [sic] 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie ; (sutthuruvena] Pupphabhikkhuna sampadio. 1. avstti. Gudagatva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354.2 v. ; 19 cm. v.2 Dasaveyaliyasuttam [947]-976. ANU BL1310.58 1954 2 v. 1954a * Sridasa vaikalikam / Prathamasamskaranam. Bhavanagara (Saurashtra) : Mahodaya Printing Press, 1954. 30, 243 p. ; 13 x 27 cm. 1954b *Dasave. Text with Sumatisadhu's Vrtti. Surata : Devacanda Lalabhai Jaina Pustakoddhara, 1954. [JSBI 2, 180 item o 1957-60 Sridasavaikalikasutram = Shreedashavaikalikasootram/Ghasrlalaji-Maharaja-viracitaya Acaramanimanjusakhya vyakhyaya samalankstam Hindigurjarabhasanuvadasaahitam ; niyojaka Srikanhaiyalalaji. Dvitiyavstti. Rajakota, Saurastra : A[khila). Bha[rata). Sve[tambara). Stha[nakavasi). Jainasastroddhara-samiti, Vira samvat < -2487 >; Vi. samvat <-2017>; I. san <1957-60 >. 2 v. ; 25 cm. First edition <1942- >. Reprint. < -1974>. v. 2 only seen. [v.2 RW] 1958 Sri Dasavaikalika sutram : mula, Samskrtachaya, sabdartha, bhavartha sahita/sampadakasamyojaka Bhadrankaravijayaji. Palitana : Somacandra Di Saha, Vira sam. 2485; Atma sam. 64; Vikrama sam. 2015 (1958). 4, 360 p. ; 19 cm. Text with Gujarati translation. ANU BL1313.9.D384 G8 1958 1960z 1963a Sri Dasavaikalika sutra mula. Sabaramati, Amadavada : Sri Ramanagara Jaina Sve. Bhu. Sangha, (no date). 72 p. ; 18 cm. (no date, but back-cover advertises Dasave.1958 ] Verses numbered consecutively 1-517. ANU NBC 2 118 348 Sri Acaranga sutram tatha Sri Dasavaikalika sutram. Thanagarha, Saurastra : Saha Thakarasi Karasanaji, Vira samvat 2489. Vi. sam. 2019. Sane 1963. 8, 200, 68, 87-91 p.; 18 cm. Contents: Acar. [1]-197.- Suddhipatraka (198-200.).--Dasave. [1]-68. Suddhipatraka 187-91). ANU BL1312.3.A93 1963 1963b *[Text with Hindi translation.] Sailana : Sadhumargi Jaina Samsketiraksaka Sangha, Vi. sam. 2020 [1963). (Samsksti Raksaka Sangha sahitya ratnamala ; 12). [JSBI 2, 180 item el 210
Page #232
--------------------------------------------------------------------------
________________ 1963c 1966 1973a 1973b 1974a 6.2 Dasaveyaliya *[Text with Hindi meaning and comments / Acarya Tulasi.] Kalakatta : Jaina Svetambara Terapanthi Mahasabha, Vi. sam. 2020 [1963] [JSBI 2, 180 item am] 2. samskarana. 1974 (Devendra Muni 1977, 718). Dasavealiyam taha Uttarajjhayanani/ vacana pramukha Acarya Tulasi; sampadaka Muni Nathamala. Kalakatta: Jaina Svetambara Terapanthi Mahasabha, samvat 2023 [1966]. [5], 3, [35], 46, dha, 349, 352 p. ; 23 cm. (Agama-sutta granthamala; grantha 1). Contents: Granthanukrama [1].-Antastosa [5].-Prakasakiya [1]-3.-Sampadakiya 'eka'-'paintisa'.-Bhumika [1]-46.-Bhumika mem prayukta granthom ki talika [47]52. Dasavealiyam: visaya-suci ['ka'] 'na.'-Uttarajjhayanam: visaya-suci ['ca']'dha. Dasavealiyam [text only] [1]-84.-Uttarajjhayanam [87]-349.-Parisista 1. Dasave. sabdasuci [1]-90.-2. Utt. sabdasuci [93]-330.-3. Namanukrama [333]-340.Suddha aura apuraka patra 1, 2, 3 [341]-352. Sources for text of Dasave. described on pages "untisa-ekatisa": Five MSS of the text: (1-3) Sanghiya-sangraha: MS Ka. 17 leaves, samvat 1506.-MS Kha. 19 leaves, samvat 1496. Ga. 16 leaves, samvat 1400.-(4) MS Gha. Gadhaiya-sangrahalaya, Sardarasahara 32 leaves, about 14th cent. [samvat?].-(5) MSS A. and ACu. Photoprint of Jaisalmere MS with Agastyasimha's Curni.-(6) Printed edition DasaveCu.1933 and (7) Ha. Dasave.1918b for Haribhadra's cty. Cf. Dasave. 1987, apparently a reprint (at least in part) of this edition. Univ of Poona Q31:2163/1516/J6/132 831 Dasakaliyasuttam: Sirisejjambhavatheraviraiyam: Siribhaddabahusamiviraiyae Nijjuttie Sirivairasamisahubbhavasiriagatthiyasimhatheraviraiyae Cunnie ya samjuyam / samsodhakah sampadakasca Munipunyavijayah. Varanasi : Prakrta Grantha Parisad, Virasamvat 2499. Vikramasamvat 2029. Isvisan 1973. 17, 296 p. [1 plate]; 27 cm. (Prakrtagranthaparisad granthanka 17). Contents. Prastavana / Dalasukha Malavaniya 1-17.-Granthanukramah-[NijjuttiCunnisamjuyam Dasakaliyasuttam] 1-272.-1. parisittham Dasakaliyasuttagahanukkamo 273-77.-2. Dasakaliyanijjuttigahanukkamo 278-80.-3. Dasakaliyacunniantaggayaganthantaravatarananukkamo 281-82.-4. Dasakaliyasuttam Cunniantaggayavisesanamanukkamo 283-84.-5 Dasakaliyacunniantaggayavakkhataavakkhatavisitthasaddanumanukkamo 285-94.-Suddhipattayam 295-96. "[Agastyasimha's Cunni] apparently goes back to a version not recognized at the codification council at Valabhi (5th cent. C. E.) but nevertheless preserved" (W. B. Bollee, DasaveNi. 1995, 31). ANU MENZIES LARGE BOOK PK5003.A58D3 1973 Arya Sayyambhava's Dasavaikalika sutra (Dasaveyalia sutta): translation and notes/by Kastur Chand Lalwani. [1st. ed.] Delhi: Motilal Banarsidass, 1973. xx, 268 p. ; 22 cm. Contents: Text and translation. 1-223.-Index of terms [ie. words] 225-68. ANU MENZIES PK5003.A58D3 1973 Dasavealiyam: Niggantham pavayanam: mulapatha, Samskrta chaya, Hindi anuvada tatha tippana/sampadaka aura vivecaka Muni Nathamala. 2. samskarana. Ladanum, Rajasthana: Jaina Visva Bharati, 1974. Vikrama samvat 2031. 2500 vam Nirvana divasa. 48, 579 p. ; 27 cm. Contents: Prakasakiya / Sricanda Ramapuriya 11.--Sampadakiya / Muni Nathamala 13-14.-Bhumika / Acarya Tulasi [dated Vi. sam. 2013 [1962] 15-35.-Visaya-suci 37-48.-Text 1-531.-Parisista. 1. Tippana-anukramanika 535-50.-2. Padanukramanika 551-68.-3. Sukta aura subhasita 569-75.-Prayukta grantha evam sanketasuci 577-79. "1. samskarana 1964. [ie. 1963c above]" Word-index of the first edition not reprinted here. (Sampadakiya, p. 14). ANU MENZIES LARGE BOOK PK5003.A58D3 1974 211
Page #233
--------------------------------------------------------------------------
________________ Mulasutras 1974b Reprint of Dasave. <1942- >=1957-60. v. 1: Vira samvat 2500. Vikrama samvat 2031. Isvisan 1974. 32, 440 p. ; 5 leaves of portraits. RW 1975a Mula-suttani: Dasaveyaliyam, Uttarajjhayanam, Nandi-suttam, Anuogaddaram/nirdesaka Muni Kanhaiyalalaji 'Kamala'; samyojaka Vinaya Muni Vagisa'. Sanderava, Rajasthana: Agama Anuyoga Prakasana, Vira samvat 2503 [1975]. 730 p. ; 14 cm. Dasaveyaliyam, p. (1)-86. ANU PK5003.A51 1975 1975b 1977a Dasavaikalika aura Uttaradhyayana / sampadaka Muni Nathamalaji. Ladanum: Jaina Visvabharati, 1975. 'ja', 267 p. ; 21 cm. Unclear how this relates to Utt.1966. No details taken. LD 20 089 Dasaveyaliyasuttam / Sirisejjambhavatherabhadantaviraiyam: Uttarajjhayanaim, Avassayasuttam ca / anegatherabhadantaviraiyaim : sampadakau Punyavijayo Munih ; Pandita Amstalala Mohanalala Bhojaka iti ca. 1. samskarana. Bambai: Sri Mahavira Jaina Vidyalaya, Vira sam. 2503 [1977]. 91, 664 p. ; 25 cm. (Jaina-Agama-granthamala ; 15) Contents: Prakasakiya nivedana [10]-11.-Prastavana [Gujarati] / Amftalala Mo. Bhojaka. 15-37.- Introduction (English translation of the preceding] [39]-58.-Detailed analyses of the contents of each of the three texts. [59]-88.--Sanketasuci [89]-91.Dasaveyaliyasuttam 1-81.-Uttara'jjhayanani (83]-329.-Avassayasuttam [331]358.-1. parisittha Dasaveyaliyasuttassa suttanukkamo [359]-368.-2. Dasaveyaliyasuttantaggayanam saddanukkamo (369)-443.-3. Dasaveyaliyasuttantaggayanam visesanamanam anukkamo [4441-4. Uttarajjhayanasuttassa suttanukkamo (445)-470.5. Uttarajjhayanasuttantaggayanam saddanukkamo (471)-630.-6. Uttarajjhayanasuttantaggayanam visesanamanam anukkamo (631)-634.-7 Avassa ya suttassa suttanukkamo (635)-636.-8. Avassayasuttantaggayanam saddanam anukkamo (6371657.-9. Avassayasuttantaggayanam visesanamanam anukkamo (658).-Vaddhipattayam [659]--Suddhipattayam [660]-664. ANU BL1313.83 1977 1977b Dasaveyaliya sutta = The Dasaveyaliya sutta / edited by Ernst Leumann, and translated, with introduction and notes, by Walther Schubring. Ahmedabad: The Managers of Sheth Anandji Kalianji, 1932. ix, 130 p. ; 24 cm. (Reprinted. Walther Schubring. Kleine Schriften / herausgegeben von Klaus Bruhn. Wiesbaden : Franz Steiner, 1977. xvii, 496 p. ; 22 cm. (Glasenapp-Stiftung; Band 13). p. [109]-248.] Reprint of Dasave. 1932a ANU BL1355.S37 1977 1977c Svadhyaya-sudha/ nirdesaka Kanhaiyalalaji 'Kamala', samyojaka Vinaya Muni Vagisa'. Bakhatavarapura Sanderava, Pali, Rajasthana : Agama Anuyoga Prakasana, Vira samvat 2503 [1977). 12, 480 p. ; 15 cm. Contents: 1. Vira-stuti 10-13.-2. Mulasuttani (1) Dasavedaaliyasuttam 1-86.-3. Mulasuttani (2) Uttarajjhyayana suttam 87-335.-4. Nandi suttam 337-419.-5. Tattvartha sutra 421-43.-6. Bhaktamara stotram 444-53.-7. Sri Kalyana-mandirastotram 445-62.-8. Mahavirastaka stotram 463-64.-9. Sri Cintamani-Parsvanathastotram. 465-67.-10. Sri Ratnakarapancavimsatih 467-69.-11. Acarya Amitagati Suriksta dvatrimsika 470-76.-12. Subhasita 476-78.-13. Tirthankarastotram 479--14. Satistotram 479-80.-15. Uvasa ggahara stotra 480. Compendium of bare texts. ANU BL1310.2. 585 1977 1980 or 1981 Sri Dasava ikalikasutram : tarkasamrat Sriharibhadra surikstatikopetam. Pindavada, Rajasthana : Bharatiyapracyatattvaprakasanasamiti, Vi. sam. 2037 [1980 or 1981). 191 p.; 28 cm. Reprint in standard bound format of an earlier loose leaf edition, [1918b?). No variant readings. ANU LARGE BOOK BL1313.9.D38 1980 212
Page #234
--------------------------------------------------------------------------
________________ 6.2 Dasaveyaliya 1984 1987 Dasavaikalikasutra : mulapatha, Hindi anuvada, vivecana, parisista yukta / Sri Sayyambhavasthaviraviracita ; adyasamyojaka-pradhanasampadaka Misrimalaji Maharaja *Madhukara'; anuvadaka-vivecaka-sampadaka Mahasati Puspavati. Byavara, Rajasthana : Sri Agamaprakasana Samiti, 1984. 25 cm. (Jinagama-granthamala, granthanka 23). Reprint. 1993. Navasuttani: Avassayam, Dasavealiyam, Uttarajjhayanani, Nandi, Anuogadaraim, Dasao, Kappo, Vavaharo, Nisihajjhayanam / vacana pramukha Acarya Tulasi ; sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana: Jaina Visva Bharati, Vikrama samvat 2044. I[svi san). 1987. 140, 812, 29, 320 p.: 4 pages of plates; 25 cm. Dasavealiyam [25)-88. "Original text critically edited" on the basis of five MSS-four from the "order's collection, Ladnun" two undated and two dated samvat 1503, and 1496 plus a photoprint of the DasaveCu. MSS from the Sethia Library, Sajangarh--and two printed editions: DasaveCu. 1933 and Dasave. 1918b, described on p. 18-20 = 72-74 (1st group). Forms v.5 of a complete edition of the Jaina Agama. Note that DasaveCu.1973 seems not to have been used. In part at least this seems to be a reprint of Dasave. 1966. ANU NEW BOOKS COLLECTION 1 484 435 Dasavaikalikasutra : mulapatha, Hindi anuvada, vivecana, parisista yukta / Sri Sayyambhavasthaviraviracita ; adyasamyojaka-pradhanasampadaka Misrimalaji Maharaja *Madhukara'; anuvadaka-vivecaka-sampadaka Mahasati Puspavati. Byavara, Rajasthana : Sri Agamaprakasana Samiti, Viranirvana samvat 2519. Vikrama sam. 2041. I. san 1993. 80,452 p. ; 25 cm. (Jinagama-granthamala ; granthanka 23). Contents: Prakasakiya. [7].--Sampadakiya / Jaina Sadhvi Puspavati [9]-17.- Prastavana : Dasavaikalika : eka samiksatmaka adhyayana / Devendra Muni (18]-76.Visayanukrama 77-80.-Dasaveyaliyasuttam 1-420.-1. Parisista. Dasavaikalikasutra ka sutranukrama [421)-429.-2. Katha, drstanta, udaharana (430)-440.-3. parisista Prayukta grantha-suci. [441]-445.-Anadhyayakala. [Atmaramaji dvara sampadita Nandisutra se uddhrta) (446)-448.- [Donor details 449] 452. Reprint. First published 1984. RW 1993 1997 *Illustrated Dashavaikalik sutra : the basic compendium of Shraman conduct : complete with original text, Hindi and English translations elaborations and illustrations / editor-inchief Amar Muni ; editor Shrichand Surana 'Saras.' Ist. ed. Delhi : Padma Prakashan, 1997. 34, 411 p. ; [24] p. of plates: col. ill. ; 25 cm. (Illustrated Agam series). [DK-110305, DK booklist CIR-1818/98-99 item 125] Selections, partial editions: 1923 Jain, Banarsi Das. Ardha Magadhi reader. Lahore, 1923. Ixv, 178 p. ; 22 cm. Extract 13. Ayarappanihi (Dasave.8] 74-78. Translation (13.] The treasure of right conduct/B. D. Jain p. 167-72. Reprint. Delhi : Sri Satguru Publications, 1982. ANU PK 1255.J34 1982 1937 1962 *Dasaveyaliyasuttam: the second Mulasutra of the Jain Canon : chapters I-VI"with English translation" /N. V. Vaidya). Poona, 1937. [JSBI 2, 179 item u; also listed on the back of N. V. Vaidya's 1954 Srimadbhagavatisutram. Out of print even in 1940 (back cover of N. V. Vaidya's Naya. 1940) Alsdorf, Ludwig. Uttarajjhaya studies IIJ 6 (1962) 110-36. [Reprinted. Kleine Schriften 1974, 225-51] Includes text of Dasave.10. Dasavaikalika-cayanika / sampadaka Kamalacanda Sogani. 1. samskarana. Jayapura : Prakrta Bharati Akadami ; Mevanagara : Sri Jaina Sve. Nakora Parsvanatha Tirtha, 1987. xxiv, 81 p. ; 20 cm. (Prakrta Bharati puspa : 37) Based on Dasave.1977 (Prastavana p. xxiii). ANU BL1313.9.D38685 1987 1987 213
Page #235
--------------------------------------------------------------------------
________________ Mulasutras 1997 Translations: English: 1932a 1932b 1940 1973 1983 *Illustrated Dashavaikalik sutra: the basic compendum of Shraman conduct / Shrichand Surana editor, Delhi, 1997. 412 p. [MLBD Newsletter March 1998, p. 15, Rs500] 1924 1930 1935 Walther Schubring (Dasave. 1932a[=1977b]) K. V. Abhyankar (Dasave.1932b) A. T. Upadhye (Dasave.1940b) K. C. Lalwani (Dasave.1973b) 1997 Gujarati: 1900 (Dasave.1900b) 1912 Jivaraja Ghelabhai Dosi (Dasave.1912b) 1939 *Self-purification: Dashavaikalika Sutra / Arya Shayambhava. London: Concord Grove Press, 1983. 130 p. : ill. ; 23 cm. No translator is cited, however the introduction and opening quotation suggest this version has been produced from a Theosophical background. The absence of any indication of the sources for the text or translation also suggest the contents are derived from secondary sources. RW (Dasave.1997) 1921-30 Dasavaikalika sutra : mula sutra Niryukti bhasya tatha tikanum bhasantara. / [lekhaka Muni Maneka]. Sayana [?]: Chotalala Nathalala, 1921-30; samvat 1978-87. 3 v. 17 cm. Text with translation and comments in Gujarati based on a number of commentaries. Bhaga 1. Prathama adhyayana. 12, 176 p. ; Bhaga. 2. 2. thi 4 adhyayano sam. 1978; 1922. 8, 216 p. "Prathamavrtti Prati 700" Bhaga 3 le. [5-7]/lekhaka Muni Maneka. Samvat 1978. Sane 1921. Prati 700. Prathama avrtti. 4, [1 portrait plate] 160, 158 p. (Sriman Mohanalalaji Jaina Svet. Jnana Bhandara granthanka 4). Contains Bhaga 4 lo. [8-10] Samvat 1978. Sanne 1921. (Sriman Mohanalalaji Jaina Svet. Jnana Bhandara granthanka 5) ANU BL1313.9.D386M3 1922 v.1,2,3 (Dasave.1924) (Dasave.1930b) *[Gujarati translation.] Sabarmati : Mahavirasahityaprakasanamandira, 1935. [BORI Cat. 17:3, 92]. *[Gujarati translation / Gopaladasa Jivabhai Patela.] Ahamadabada: Jaina Sahitya Prakasana Samiti, 1939. [JSBI 2, 180 item ah] <1942-> Ghasilala (Dasave.<1942-> [=1957-60] 1958 Bhadrankaravijayaji (Dasave.1958) Hindi: 1919 1932 1936 Amolaka Rsi (Dasave.1919a) Atmarama (Dasave.1932c [=1946a) Sri Dasavaikalika sutra ka Hindi anuvada / mula anuvadaka Saubhagyacandraji. 1. avrtti. Mumbai: Sri Sthanakavasi Jaina Kanpharansa, 1993 [1936]. 37, 190 p.; 18 cm. (Sri Hamsaraja Jinagama Vidya-pracaraka Phanda Samiti ; grantha 2). "2000 pratiyam." Editor has used Dasave.1900a; 1900z; 1932; 1938; 1946a. Saubhagyacandra is a pupil of Nanacandaji. (t.p.) <1942-> Ghasilala (Dasave.<1942-> [=1957-60] Muni Amaracandra (Dasave.1943) 1943 1945 or 1946 Ghevaracandra Bamthiya (Dasave. 1945 or 1946) 1950 Muni Trilokacandra (Dasave.1950) 214 ANU PK5003.A58D34
Page #236
--------------------------------------------------------------------------
________________ 6.2 Dasaveyaliya 1963 1963 (Dasave.1963b) Acarya Tulasi (Dasave. 1963c (=1974) 1974 Dasavaikalika aura Uttaradhyayana / vacana pramukha Acarya Tulasi ; sampadakaanuvadaka Muni Nathamala ; sahayogi Muni Mithalala, Muni Dulharaja. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2031 [1974). "ja,' 267 p. Contents: Prakasakiya [1].-Sampadakiya (3).-Sva kathya ['ka'-'na.'-Visaya-vastu ['ca'l-ja. Dasavaikalika (1)-70.-Uttaradhyayana (72)-255.-Parisista. Iktisvem adhyayana mem ae hue kucha-eka visayom ka vivarana [257]-267. BORI 28 611 X.B(Jainism) 1984 1997 Mahasati Puspavati (Dasave.1984). Reprinted Dasave. 1993. (Dasave. 1997) Partial translations: English: 1923 B. D. Jain (Chapter 8) (Dasave.partial edition. 1923) 1937 N. V. Vaidya (Dasave.partial edition. 1937, Chapters 1-6 only?) 1981 N. Tatia and Muni Mahendra Kumar. Dasave. chapter 10 only. (Tatia 1981, 90-95) German: 1892 E. Leumann (Chapters 1-3) (Dasave.1892) Studies: Caillat, Colette. 1980-81. Notes sur les variantes dans la tradition du Dasaveyaliya-sutta. Indologica Taurinensia 8-9 (1980-81) 71-83. Caillat, Colette. 1982. Notes sur les variantes grammaticales dans la tradition du Dasaveyaliya-sutta. Indological and Buddhist studies: volume in honour of Professor J. W. de Jong on his sixtieth birthday / edited by L. A. Hercus ; F. B. J. Kuiper ; T. Rajapatirana : E. R. Skrzypczak. Canberra : Faculty of Asian Studies, 1982. 692 p. ; 25 cm. p. 69-94. Caillat, Colette. 1991. The Rules concerning speech (bhasa) in the Ayaranga- and Dasaveyaliya suttas. Aspects of Jainology v.3: Pt. Dalsukh Bhai Malvania Felicitation volume 1/editors M. A. Dhaky ; Sagarmal Jain. Varanasi: P. V. Research Institute, (1991), p. 1-15. Dhaky. M. A. 1993. "The earliest portion of the Dasavaikalika-sutra. In Ram Karan Sharma (ed.) Researches in Indian and Buddhist philosophy : essays in honour of Professor Alex Wayman. Delhi : Motilal Banarsidass, 1993. [Dundas, Paul. 1998. The meat at the wedding feasts : Krsna, vegetarianism and a Jain dispute. Toronto: University of Toronto, Centre for South Asian Studies, 1998. 28 p. ; 23 cm. (The 1997 Roop Lal Jain Lecture). p. 26] Dixit, K. K. 1978. A historical evaluation of Uttaradhyayana and Dasavaikalika. In, Early Jainism. Ahmedabad : L. D. Institute of Indology, 1978. 8, 99 p. ; 25 cm. (LD series ; 64), p. [22]-33. Ghatage, A. M. 1938. The title Dasava ikalika sutra. Indian historical quarterly 14 (1938) [232]-239. Ghatage, A. M. 1938-39. Parallel passages in the Dasavaikalika and the Acaranga. New Indian antiquary 1 (1938-39) 130-37. *Kapadia, Hiralal Rasikdas. 1935. [Article]. Jaina prakasa 22 (1935). [BORI Cat. 17:3, 94] Patwardhan, M. V. 1933-36. The Dasavaikalikasutra : a study. Sangli, 1933-36. 2 v.; 19 cm. Contents v. 1 (with special reference to chapters I-VI): Preface [1].-I. The author of the Dasave.: his life and time. 1-8.-II. The significance of the title Dasave. 9-10.-III. The sources of the Dasave. 10--13.- IV. The place of the Dasave. in the Jaina canon 13-17.-[V. not used?]--VI. The meaning of the word sutra as applied to Jain canonical works. 17-20.-VII. Metrical survey of the Dasave. (Chapts. I-VI) 20-27.-VIII. The two culikas of the Dasave. 27-29.-IX. The Dasave.: a synoptic survey of its contents (I-VI) 29-47.-X. General remarks on the first six chapters of the Dasave. 48-60.XII. General estimate of the Dasave. as a manual of Jainism 60-62.--XIII. The Ardha 215
Page #237
--------------------------------------------------------------------------
________________ Mulasutras magadhi Language of the Jain sutras. 63-79.-XIV. History of the transmission of the Svetambara Jaina Canon. 79-84.--XV. The authorship of the various branches of the Jaina canonical literature and an estimate of its age 84-87.--XVI. The historicity and authenticity of the Svetambara Jaina Canon 87-91.--XVII. The problem of the Purvas. 91-99. Contents v. 2 (Chapters VII-XII): Preface [il-ii.-I. Metrical survey of the Dasave. (Chapters VII-XII). [102]-106.-II. A synoptic survey of ... contents VII-XII. 107-19.III. General remarks on the last six chapters of the Dasave. 120-45.-IV. Traditional account of the origin of the Culikas 145-52.-V. General remarks on the plan and arrangement of the chapters in the Dasave. 152-53. BORI 6175, 51 310, 51 311 Schubring, Walther. 1955. 150 Strophen Niryukti : ein Blick in die Jaina-Scholastik. In Studia Indologica : Festschrift fur Willibald Kirfel zur Vollendung seines 70. Lebensjahres / herausgegeben von Otto Spics. Bonn: Selbstverlag der Orientalischen Seminars der Universitat Bonn, 1955.375 p. ; 21 cm. (Bonner Orientalistische Studien. Neue Serie. Band 3). p. 297-319. [Reprint. Kleine Schriften 321-43.] ANU PK 102.25K5 Tulasi, Acarya. 1966. Dasavaikalika : eka samiknatmaka adhyayana / vacana pramukha Acarya Tulasi ; vivecaka aura sampadaka Muni Nathmal. Kalakatta: Jaina Svetambara Terapanthi Mahasabha, 2023 (1966). 'ga,' 'cara,' v, 226, 29,7 p. ; 22 cm. (Agama-anusilana granthamala ; 1). Contents: Samarpana (1).-Antastosa [3]. Prakasakiya 'ka'-'ga.'-Sampadakiya / Muni Nathmall'cka'l-'cara.'-Visayanukrama (il-v.-Adhyaya 1. Bahiranga paricaya 1-80.-2. Antaranga paricaya 83-108.-3. Mahavrata [111]-122.-4. Carya-patha (12552].-5. Vyakhya-granthom ke sandarbha mem (155)-226.-Parisista 1. Curni ki paribhasacm (1)-29.-Prayukta granthom ki talika (1)-7. BORI 29 419 X.B(Jainism) 12 / Tulasi Indexes: 1928 Nandyadigathadyakaradiyuto visayanukramah : Srinandi-Anuyogadvara-Avasyaka Oghaniryukti-Dasavaikalika-Pindaniryukti-Uttaradhyayananam sutrasutra gathaniryuktimulabhasyabhasyanam akaradikramah arkasuddhih laghubhams ca visayanukramah = An Alphabetical index of the aphorisms etc. occuring in Nandisutra, Anuyogadvara, Avasyaka, Oghanir[y]ukti, Dasavaikalika, Pindaniryukti and Uttaradhyayanasutra : along with detailed lists of subjects treated in these seven Agamas. Mumbayyam: Sri Agamodayasamiteh karyavahakah Jivanacandra Sakaracandra Jhaveri, Virasamvat 2454 [1928). f. 183 [ie. 366 p.) ; 12 x 26 cm. (Sri- gamodayasamiti Granthoddhara, granthakah 55). ANU BL1313.89.N25 1928 1966 1973a (Dasave.1966): Parisista 1. Dasave. sabdasuci p. [1]-90. (Dasave. 1973a): 1. parisittham Dasakaliyasuttagahanukkamo p. 273-77.-2. Dasakaliyanijjuttigahanukkamo 278-80.-3. Dasakaliyacunniantaggayaganthantaravatarananukkamo 281-82.-4. Dasakaliyasuttam-Cunniantaggayavisesanamanukkamo 283-84.-5 Dasakaliyacunniantaggayavakkhata-avakkhatavisitthasaddanumanukkamo 285-94. (Dasave.1973b): Index of terms [ie. words) p. 225-68. 1973b 1974 (Dasave.1974): Parisista. 1. Tippana-anukramanika p. 535-50.-2. Padanukramanika 55168.-3. Sukta aura subhasita 569-75. 1977 (Dasave. 1977a): 1. parisittha Dasaveyaliyasuttassa suttanukkamo. p. 13591-368.-2. Dasaveyaliyasuttantaggayanam saddanukkamo [369]-443.-3. Dasaveyaliyasuttantaggayanam visesanamanam anukkamo (444). 1987 (Dasave.1987): combined index of: Nandi. (including JogNa. and LahuNa.) AnuOg., Utt., Dasave., Av., Dasa. (including AyarDas.), BrhKapp., Vava. and Nis.: Parisista 3. Navasuttani saddasuci [15 505 words). p. [1]-319. 216
Page #238
--------------------------------------------------------------------------
________________ 6.2 Dasaveyaliya 1994 Dasaveyaliya : pada index and reverse pada index / Moriichi Yamazaki, Yumi Ousaka and Masahiro Miyao. Tokyo: The Chuo Academic Research Institute, 1994. iii, 92 p. ; 30 cm. (Philologica Asiatica : Monograph Series ; 1). Pada indexes based on Dasave. 1932. Index integrated into A Pada index and reverse pada index to early Jain Canons : Ayaranga, Suyagada, Uttarajijhaya, Dasa veyaliya, and Isibhasiyaim / by Moriichi Yamazaki and Yumi Ousaka. Tokyo : Kosei Publishing Co., 1995. 537 p. 23 cm. Review: BEI 11-12 (1993-94), 467-68. 1995 A Pada index and reverse pada index to early Jain Canons : Ayaranga, Suyagada, Uttarajjhaya, Dasaveyaliya, and Isibhasiyaim/ by Moriichi Yamazaki and Yumi Ousaka. Tokyo : Kosei Publishing Co., 1995. 537 p. 23 cm. RW Includes the separate index Dasaveyaliya : pada index and reverse pada index/Moriichi Yamazaki, Yumi Ousaka and Masahiro Miyao. Tokyo : The Chuo Academic Research Institute, 1994. iii, 92 p. ; 30 cm. (Philologica Asiatica : Monograph Series ; 1). Pada indexes based on Dasave. 1932. Review: "Les editions de la Jaina-Agama-Series ne sont toujours pas prises en compte et aucune explication n'est fournie a ce fait ... On continue aussi a regretter qu'aucune indication abregee ne figure pour caracteriser le metre des pada. Toutefois, tel qu'il est, ce volume fait un instrument de travail extremement utile." Nalini Balbir BEI 13-14 (1995-96), 543.. 1996 Dasaveyaliya : word index and reverse word index/Moriichi Yamazaki and Yumi Ousaka. Tokyo: The Chuo Academic Research Institute, 1996. i, 110 p. ; 30 cm. (Philologica Asiatica : Monograph Series ; 6). RW Word indexes based on Dasave. 1932. Review: Nalini Balbir BEI 13-14 (1995-96) 544. 1999 A word index and reverse word index to early Jain canonical texts : Ayaranga, Suyagada, Uttarajjhaya, Dasaveyaliya, and Isibhasiyaim / Moriichi Yamazaki and Yumi Ousaka. Tokyo : The Chuo Academic Research Institute, 1999. iii, 410 p.; 30 cm. (Philologica Asiatica : Monograph series ; 15). The 1996 index integrated with those for other texts, plus additional material from Alsdorf's work on chapter 10 (Dasave.partial edition.1962) (see p. iii). RW 217
Page #239
--------------------------------------------------------------------------
________________ 218
Page #240
--------------------------------------------------------------------------
________________ 6.3 AVASSAYASUTTA (Av.) Remarks: The Avassayasutta and its associated literature form a complex corpus which is not yet fully documented. I have therefore limited the information given below to that necessary to provide a context for the publications held in the ANU Library. I have taken as a base the information given by Balbir (1993). Title: Avasyaka (Skt). It is best to distinguish between two texts bearing the name Avassayasutta, the first being a brief canonical text commented on by Haribhadra and Malayagiri (Av), the second a less ancient text still in liturgical usage, more frequently called Sad-Avasyakasutra (SadAv). The entries in JRK and BORI Cat. do not separate these two texts. Content: The Av. exists only in conjunction with the Nijjutti and the prose ctys of Haribhadra and Malayagiri. It has six sections corresponding to the six "essential" daily duties obligatory for a religious Jain: desisting from all evil, obtained by equanimity, samaiya glorification of the twenty-four Tirthakaras, cauvvisa-tthaya veneration (of the teacher) vandana confession, padikkamana asceticism, kausagga renunciation of sensual pleasures, paccakkhana Attached to the formulas with which the six duties are performed are stories that have come down in the old commentaries (Winternitz 1933:2, 470). References: JRK 35-39; BORI Cat. 17:3, 132-480; Schubring 1935 $55. Outline of the entries given here: Exegesis: as embodied in Bhadrabahu's Niryukti and its commentaries 1 Bhadrabahu, Niryukti . . p. 220 Commentaries on the Niryukti alone . . . 1.1 Jinabhadra Gani, Visesavasyakabhasya. . . . Editions of Visesavasyakabhasya Translations of Visesavasyakabhasya Index of Visesavasyakabhasya - .. p. 220 p. 222 p. 224 . p. 225 Commentaries on the Sutra and the Niryukti Avasyakacurni Haribhadra Malayagiri Tilakacarya Jnanasagara Manikyasekhara Editions . . . . . . . . . . p. 226 Studies P. 229 1 Leumann Ubersicht 1934, p. 2a-6b, (reference drawn to my attention by Klaus Bruhn).
Page #241
--------------------------------------------------------------------------
________________ Mulasutras Exegesis: Av. as embodied in Bhadrabahu's Niryukti and its commentaries. References: Balbir 1993, 38-75; BORI Cat. 17:3, 371-84; JSBI 3, 71-96. Bhadrabahu, Niryukti, The Av. is only preserved with the Niryukti, most editions give the Niryukti verses. 1 1.1 1981 or 1982 *Avasyakaniryuktih / Bhadrabahusvamisugrathita; Haribhadrasuriviracitatikalankrta. Mumbai: Sri Bherulala Kanaiyalala Kothari Dharmika Trasta, 2038 [1981 or 1982]. 2 v. ; 30 cm. [CRL catalogue] Includes Avassaya in Prakrit. Contents v. 1: Samayikadhyayana sampurnam. v. 2 Sesadhyayanapancakarupa. Commentaries on the Niryukti alone 1.1.2 1989 Niryukti-sangrahah / Bhadrabahusvamiviracitah; sampadakah samsodhakas ca Srijinendrasuri. Prathamavrttih. Lakhabavala, Santipuri, Saurastra: Sri Harsapuspamrta Jaina granthamala, Vira sam. 2515. Vikrama sam. 2045. San 1989. 20, 600 p. ; [1] plate; 19 cm. (Sri Harsapuspamrta Jaina granthamala ; 159). 1.1.3 Avasyakaniryuktih. 1-189. "750 Pratayah." Printed. Av.1916-17 [= 1981 or 1982]; 1928-29; 1928-36; 1939-49. Also printed with Jnanasagara's Avacurni 1965. Commentaries on the ViAvBha. 1.1.1 ANU BL1310.4 B432 1989 Jinabhadra Gani, Visesavasyakabhasya, (ViAvBha.) 3 603 Prakrit gathas, a commentary on the AvNi. rather than the Av. itself. It covers only about half of the verses that contains (Balbir 1993, 75). [BORI Cat. 17:3, 464-80]. Reference: JSBI 3, 138-201. Printed ViAvBha.1911-14. Jinabhadra and Kotyacarya, Visesavasyakabhasyavrtti (JRK 431). This text survives as a single MS in Patan. [JSBI 3, 355-58] Printed. ViAvBha. 1966-68; <1972->. Kotyacarya (Leumann prefers to name this author Silanka). [BORI Cat. 17:3, 467-69; JSBI 3: 378-79] Printed. ViAvBha. 1936-37; ViAvBha. 1972 (partial edition) Hemacandra Maladharin, Sisyahita [JSBI 3: 444-46; Balbir 1993, 80] pupil of Abhayadeva Suri of the Harsapuriya Gaccha, Bhasyavrtti-tika, 28 000 granthas, composed samvat 1175 [1118]. Begins: srisiddharthanarendra. [BORI Cat. 17:3, 470-80]. Printed. ViAvBha. 1911-14; ViAvBha. 1963 [=ViAvBha. 1982 or 1983]. Extracts printed in ViAvBha.Partial edition. 1941-51. It seems a Gujarati translation based on this was published in ViAvBha. 1924-27. 1963 *[Hemacandra's cty]. Ahmedabad: Divya Darsana Karyalaya, Vi. samvat 2489 [1963]. An uncritical edition, with no indication of sources used. Three volumes with separate pagination: prathama bhaga anka 1; prathama bhaga anka 2; dvitiya bhaga (Balbir 1993, 81). Editions (ViAvBha): 1911-14 Srijinabhadraganiksamasramanapadaviracitam Visesavasyakabhasyam Maladharisrihemacandrasuriviracitaya Sisyahitanamnya Brhadvrttya vibhusitam / HaragovindadasaBecaradasabhyam samsodhita. Benares: Dharmabhyudaya Press, Vira 2437-41 [191114]. 8 v. [1360, 263 p.]; 14 x 24 cm. (Yasovijaya-Jaina-grantha-mala ; 25, 27, 28, 31, 33, 35, 37, 39). [CLIO 1, 243; Schubring 1935 $55; JSBI 3, 138; Tripathi 1975, 106]2 2 The volume held in the BORI (call number 29 183), which has no title-page, seems to be just the final 263 pages of this edition: Srijinabhadraganiksamasramanaviracitam Srivisesavasyakabhasyam. p.1-263; 18 x 28 cm. Colophon: iti mulabhagasahitam Visesavasyakabhasyamulam samaptam. Pages 1-208 have a vertical border down each side of the page of small repeated dark ovals each containing a figure like a white 'x' with a dot above and below it. From p. 209 onwards this changes to black diamonds with a white ring enclosing a black dot. Occasional footnotes eg. p. 1 "I. 'daraim' /2 'avassaya" ... ": p. 262 "1. "thiya' /2. 'gijjho'/..." 220
Page #242
--------------------------------------------------------------------------
________________ 6.3 Avassayasutta Used for the edition of 1966-68. Yasovijaya Jaina granthamala edition, Vira samvat 2441 (1915) edited by Hara govindadasa. "It is well printed. This edition is almost without any misprint. The editor has given no description of the MSS utilized. But it seems that he has utilized five MSS. Again, it is almost certain that before him there was no Jaisalmer) MS which we have used for the first time." (D. Malvaniya, ViAvBha.1966- 68:1, 4]. The ViAvBha. text follows Hemacandra's version (Tripathi 1981, 328). 1924-27 Sriman purvadhara Acaryavarya Jinabhadraganiksamasramanaksta Srimalladhari Acaryasri Hemacandracaryaksta vrtti sahita Srivisesavasyaka bhasantara. Bombay : Agamodaya Samiti, San 1924-27. Vira samvat 2450-53. Vikrama samvat 1980-83.2 v. ; 27 cm. Contents Bhaga 1: Gatha 1-1548 / bhasantara karta Saha Cunilala Hakamacanda : Sri Visesavasyakana purvardhano upodghata [1]-3.--Sri Visesavasyakani anukramanika [4]-16.-Visesavasyakabhasya (1)-616. Contents Bhaga 2: gatha 1549-3603: Sri Visesavasyaka bhaga bijani anukramanika (1)-22.-Prastavana [23)-24.-Visesavasyakabhasya [1]-527. (Agamoda ya-Samitigranthamala ; 48). Text with Gujarati translation based on Hemacandra's cty (JRK 431b). "Prata 1000." BORI 2696 (v.1), 3892 (v.2) 1936-37 Sri-Jinabhadraganiksamasramanadrbdham Srikotyacaryakrtapracinatamavivaranavetam Srivisesavasyakasutram[/Sagarananda Suri]. Ratalama : Srissabhadevajikesarimalajinamakasvetambarasamstha, Virasamvat 2463. Vikramasamvat 1993. Kraista san 193637.2 v. ; 13 x 27 cm. [Devendra Muni 1977, 723; Tripathi 1981, 326; Balbir 1993, 20] Contents 1. bhagah: 9, 499 p.-Uttarabhagah: 8,501-987 p. Used for ViAvBha. 1966-68. "(ViAvBha.1936-37) edited by Suri Shri Anandasagaraji. It is to be noted that the name of the editor has not been mentioned there. This edition also is correct. Even the editor of this work has neither given the variant readings nor mentioned the MSS utilized. Moreover this editor too seems not to have utilized the MS from Jaisalmer)" (D. Malvaniya, ViAvBha.1966-68:1, 4). BORI 5520 (v.1), 5340 (v.2) 1963 Jinabhadragani. Sri Visesavasyakabhasyam: Pujyapadasrijinabhadraganiksamasramanaviracitam ; Pu. Maladharisrihemacandra suriviracitaya Sisyahitananamnya Brhadvrttya vibhusitam/sampadakah Muni Sri Rajendravijayaji. Ahamadabada : Bai Samaratha Jaina Sve. Mu. Jnanoddhara Trasta, Vi. sam. 2489 (1963). 2 v. ; 19 x 28 cm. Contents 1. bhagah, amsa 1: Prakasakiya nivedana 3-4.-Visesavasyakabhasyavisayankramah (bhagah 1) 1-12. Sri Visesavasyakabhasyagatha 1-tah 186-nam chayah 13-17.-Sri Visesavasyakabhasya-suddhipatrakam (bhagah 1) 18-21.-Visesavasyakabhasyasyakaradyanukramanika 1-25.-Srivisesavasyakabhasyam Maladharisrihemacandra suriksta-Sisyahitakhya-Bhadvyakhya-samalankstam 1-340. amsa 2. 12, 4, 341765. [v. 1-2179). "Pu. Acaryadevasrimadvijayapremasurijisisyaratna-Pam. Sri Bhanuvijayajigaoivaryamargadarsananusarena tatsisyaratna Pu. Sri Rajendravijayaji Maharajah" t.p. Contents 2. bhagah: Vi. sam. 2489) Sri Visesavasyakabhasya-visayanukramah bhagah 2. 1-10--Visesa. bhagah 2 Suddhipatrakam 11-15.-Sri-Visesavasyaka-bhasyam bhagah 2 (Maladhariyatikasametam) 1-379 [v. 2180-3603, prasasti). Reprinted 1982 or 83. ANU BL1313.9.A836 S5 1963 v. 1 and 2 1966-68 Visesavasyakabhasyam svopajnavrttisahitam : Srijinabhadraganiksamasramanaviracitam/ sampadaka Dalasukha Malavaniya. Amadavada : Lalabhai Dalapatabhai Bharatiya Samskyti Vidyamandira, 1966-68. 3 v. ; 24 cm. (L.D. series 10, 14, 21). Contents v. 1: Preface 1-6.-Visayanukramah 1-7.-Visesavasyakabhasyam 1-278 [start to v. 1528]Suddhipatram 279-281. [v. 1-1528]. (Reprint. 1993 (DK 5304)). Contents v. 2: Preface [1].-Visayanukramah 6-7.-Visesavasyakabhasyam [283] - 610 [v. 1529-3161). Contents v.3: Preface [1].-Introduction / Dalsukh Malvania [1]-19.-Visayanukramah [20]-22.-Visesavasyakabhasyam [611]-865.-Visesavasyakabhasyagataniryukti 221
Page #243
--------------------------------------------------------------------------
________________ Mulasutras gathanam akaradyanukramah [867]-938.-Suddhipatram [v.1-3]. [939]-941. [v.31624329] "500 copies." ANU BL1316.J53V5 pt. 1, pt. 2 [v.3 BORI] <1972-> Visesavasyakabhasyam: Srimajjinabhadraganiksamasramanaviracitam Srimatkotyacaryakrtavrttivibhusitam/ edited by Nathmal Tatia. Vaishali, Bihar : Research Institute of Prakrit, Jainology and Ahimsa, 1972. xii, 427 p. ; 25 cm. (Prakrit Jaina Institute Research Publications series; v. 6). [No further volumes published] Contents: General editor's note v-vii.-Contents ix-xii.-Visesavasyakabhasyam 1427. [Start to v. 2080] Text based on ViAvBha. 1936-37; and the printed editions of the ctys of Jinabhadra and Hemacandra. ANU BL1316.J53V5 1972 1982 or 1983 * Jinabhadragani. Sri Visesavasyakabhasyam : PujyapadasrijinabhadraganiksamaSramanaviracitam; Pu. Maladharisrihemacandrasuriviracitaya Sisyahitananamnya Brhadvrttya vibhusitam / sampadakah Muni Sri Rajendravijayaji. 31 x 25 cm. Bombay : Divya Darshan Trust, Vira sam. 2509 [1983] Vikrama samvat 2039 [1982]. [Balbir 1993, 18] Reprint of ViAvBha. 1963 in normal book format with continuous pagination, 1-680. Bombay, 1979 [?] (Balbir 1993, 81). Translations of ViAvBha: Gujarati: 1924-27 (ViAvBha.1924-27) Partial editions of ViAvBha [ic. Ganadharavada]:3 1942-51 Sramana Bhagavan Mahavira. Ahmedabad: Sri Jaina Siddhanta Society, Vira samvat 2468-77. Vikrama samvat 1998-2007. 1942-51. 5 v. in 8; 25 cm. (Commemoration volume; 1-8). First edition in 4 v. 1941-42 (v.1, pt. 1. Preface to second edition). Full details of this publication are given under Selections in the first section of this bibliography dealing with the canon as a whole. v.3: Ksamasramana Jin[a]bhadra Gani's Ganadharavada, along with Maladharin Hemacandra Suri's [Sanskrit] commentary edited by Muni Ratna-prabha Vijaya : with translation, digest of commentary and introduction/by Dhirubhai P. Thaker. Ahmedabad: Sri Jaina Grantha Parakasaka Sabha, Virasamat 2468. Vikram samvat 1998. 1942. Contents: Introduction [3]-36.-Ksamasramana Jin[a]bhadra Gani's Ganadharavada [text and English translation] [1]-538.-Corrections [534]-[Advertising, 6 p]. Cover-title: "Sramana Bhagavan Mahavira : v.3 Ganadhara-vada." Reprint. Vira samvant [sic] 2470. Vikrama samvat 2006. 1950. Slight differences in pagination plus index p. 537-46. v.4: Ksamasramana Jinabhadra Gani's Nihnava-vada: along with Maladharin Hemacandra Suri's comme[n]tary edited by Muni Ratna-prabha Vijaya : with translation, digest of Sanskrit commentary and introduction / by Dhirubhai P. Thaker. Ahmedabad: Sri Jaina Grantha Parakasaka Sabha, Virasamat 2473. Vikram samvat 2003. 1947. Contents: Preface: the text of the Nihnavada / Dhirubhai P. Thaker [1]-19.Nihnavavada [text and English translation] [1]-340.-Corrections [341].-Index [343]347-Advertising. 32 p.) 3 "The Ganadharavada ... is a part of the ViAvBha. (gathas 1549-2024) of Jinabhadra and describes the controversies between Lord Mahavira and Indrabhuti and other Brahmanical thinkers who after much intellectual discussion were convinced of the truth of Mahavira's teaching and joined him as his faithful and devoted disciples and preached his teachings and philosophical views. A number of philosophical topics come up for discussion here and different views and speculations about them are discussed; all the possible alternatives are explained and refuted, and the Jaina view is established. Thus the Ganadharavada gives an insight into a number of problems of Indian philosophy from different points of view" (E. A. Solomon, ViAvBha.partial translation. English. 1966, p. v). 222
Page #244
--------------------------------------------------------------------------
________________ 6.3 Avassayasutta Cover-title: "Sramana Bhagavan Mahavira : v.4 Nihnava-Vada." ANU BL1371.V5 1952 1982 First edition of the partial edition of 1985 listed below. Gujarat Vidya Sabha, 1952. Text of ViAvBha. portion based on:- 1. Maladhari He's cty on the ViAvBha.-2. Kotyacarya's cty on the ViAv.-3. Copy of a palm-leaf MS of the ViAvBha. found in Jaisalmer Bhandara (Muni Punyavijaya had it copied by Pandit Amrtial) (E. A. Solomon, ViAvBha.partial translation.English p. 267). Ganadharavada ka Gujarati se Hindi anuvada: samvadatmaka anuvada, tippana aura tulanatmaka prastavana / Gujarati lekhaka Dalasukhabhar Malavasiya ; Hindi anuvadaka Prthviraja Jaina ; samsodhaka cvam sampadaka Vinayasagara ; saha-sampadaka Othkaralala Menariya. Prathamavitti. Jayapura : Rajasthana Praksta Bharati Samsthana evam Samyagjnana Pracaraka Mandala, 1982. [2], 18, 160, 264 p ; 23 cm. (Prakrta Bharati ; puspa 10). Contents: Prakasakiya (1-2).-Prathamavrtti mem lekhaka ka nivedana 1-2.Ganadharavada ki Hindi avrtti ke avasara para / Dalasukha Malavaniya 3.Bhasantarom mem visista vidha ka grantha / Muni Punyavijaya. 4.Subha samapti/ Sukhalala 5-8. Sandarbha-grantha-sanketa suci. 9-12.-Visayanukrama 12-18.Prastavana /Dalasukha Malavaniya [dated July 1952.11-160.--Ganadharavada 1-179: [1. Indrabhuti 1-28.-2. Agnibhuti 29-48.-3. Vayubhuti. 49-66.-4. Vyakta 67-93.5. Sudharma 94-102.-6. Mandika 103-20.--7. Mauryaputra 121-27.-8. Akampita 128-33.-9. Acalabhrata 134-51.-10. Metarya 152-58.-11. Prabhasa 159-79.- Tippaniyam 180-210.-Viddhi patra 211-12.-Visesavasyakabhasyantargata Ganadharavada ki gathaem 213-52.-Tika ke avataranom ki suci 253-54. Sabdasuci 255-64. First edition 1952. Translation of v. 1549-2024 of Jinabhadra's Visesavasyakabhasya based on Maladhari Hemacandra's extensive commentary. Jinabhadra's text is a detailed commentary on the Samayika chapter of the Avasyaka-sutra (Prastavana, p. 1). These are the conversion conversations between Mahavira and his ganadharas. Not necessarily a literal translation. Text based on the versions in Malayagiri's cty, Kotyacarya's cty and the transcription of the Jaisalmer palm-leaf MS of the Visesavasyakabhasya by Punya vijaya and Amrtalala (Bhojaka). The Jaisalmer readings have been taken as authoritative (p. 213). ANU BL1313.9.A836 B483515 1982 1985 Jinabhadra-krta Ganadharavada nam samvadatmaka anuvada, tippana ane tulanatmaka prastavana : Acarya / lekhaka Dalasukhabhai Malavaniya. Avrtti 2. Amadavada : Setha Bho. Je. Adhyayana Samsodhana Vidyabhavana, Gujarata Vidyasabha, Vi. sam. 2041. I. sa. 1985. 16, 148, 212,52 p. [1] leaf of plates (portrait); 24 cm. (Samsodhana granthamala; granthanka 40 lo). First edition 1952. Translated into Hindi 1982. Includes text of gathas 1549-2024, (p. 1-40, 4th group), see the listing for the Hindi edition (1982) for details of the sources of the text. ANU BL1313. 9.A83613 1985. Partial translations of ViAvBha: English: 1942-51 (See ViAvBha.Partial edition.1942-51) v.3: Ganadharavada / Dhirubhai P. Thaker.v.4: Nihnava-vada / Dhirubhai P. Thaker. 1966 Ganadharavada / translation and explanation by Esther A. Solomon. Ahmedabad : Gujarat Vidya Sabha, 1966. vi, 75, 310 p. ; 25 cm. (Sheth Bholabhai Jeshingbhai Institute of Learning and Research. Research Series no. 62). Contents: Publisher's note / Hariprasad G. Shastri, Ahmedabad, 28 Feb. 1966 [iii]-iv.Preface / E. A. Solomon, Ahmedabad 19 June '66 (vl-vi.-Introduction : What is the Ganadharavada (1)-6.-Bhadrabahu 6-7.Jinabhadra and his ViAvBha. 7-14.Acarya Maladhari Hemacandra, the author of ViAvBha.vivarana (or-bhasya-brhadvrtti). 14-19.-Ganadharavada - its location in the ViAvBha. 19-22.--The Ganadharas 22 223
Page #245
--------------------------------------------------------------------------
________________ Mulasutras 32.--Style 32-34.-A philosophical essay on the Ganadharavada 35-46.-Bondage and emancipation of the soul 47-54.-The doctrine of karman 54-69.-Realism vs Idealism 69-71.--Soul in different darsanas 71-73--Corrigenda (75).--Ganadharavada : translation and explanation. Translation 1-65.-- Explanation 67-223.-Notes 22565.--Ganadhara : Prakrit text (reprinted from ViAvBha.partial edition. 1952) 267-304.Index 305-10. Main source of information for the introduction is the Gujarati introduction by Dalsukh Malvania to his 1952 edition and translation. (Introduction, p. 7n). "Copies 750." ANU NBC +2 118 263 1989 The essentials of Bhagavan Mahavir's philosophy ; Ganadharavada: a treatise on the question and answers between eleven brahmin scholars and Mahavir Bhagavan relating to the soul, karmas, panch bhuta, heaven, hell and salvation/translated by] Acharya Vijay Bhuvanbhanusuri. Delhi : Motilal Banarsidass, 1989. xx, 150 p. ; 22 cm. (Lala Sundar Lal Jain Research series ; v. 4). English translation of part of an earlier Gujarati book, Jain dharmano sarala paricaya which was also translated into Hindi (Preface, p. xiii). No bibliographic details traced about either of those versions. RW Gujarati: 1952 Dalasukhabhas Malavaniya (ViAvBha.partial edition. 1952) Reprint: 1985. Translated into Hindi 1982. 1985 Dalasukhabhas Malavaniya (Reprint of ViAvBha.partial edition. 1952) Hindi: 1982 Prthviraja Jaina (ViAvBha.Partial edition.1982). Index of ViAvBha: 1923 Agamodayasamitau parisiste prathame vibhago dvitiyah Visesavasyakagathanamakaradih kramah : tatha dvitiye parisiste dvitiyo vibhagah Visesavasyakavisayanamanukramah. Amadavada : Agamodayasamitih, Virasamvat 2479. Vikramasamvat 1979. Kraistasan 1923. [2], [63] [ie. 126) p. ; 12 x 27 cm. Contents: Visesavasyakamule gathankasthanabodhah la-lb.-Akaradyanukramasuddhipatram 2a-2b.-Visesavasyakabhasyasyakaradyanukramanika 3a-32a.--Srivisesavasyakasya laghuh kramah 32b-33a.--Srivisesavasyakasya bhan kramah 336-63a. Index to ViAvBha. 1924-27? ANU BL1313.9.A839 1923 1963 (ViAvBha.1963) v.1: Visesavasyakabhasyasyakaradyanukramanika p. 1-25.- v.2: Sri Visesavasyakabhasya-visayanukramah bhagah 2. p. 1-10. 1966-68 (ViAvBha.1966-68) v.3: Visesavasyakabhasyagataniryuktigathanam akaradyanukramah p. [867)-938. 224
Page #246
--------------------------------------------------------------------------
________________ 6.3 Avassayasutta Commentaries on the Satra and the Niryukti Avasyakacurni, attributed to Jinadasa, Curni, 13 600 granthas, (JRK 37). (Ref. JSBI 3, 297-305.] Printed Av.1928-29. Extracts published by Leumann (Av.Studies. 1897) subsequently translated by Balbir (1993). See also Mette (1983). Haribhadra, 700-770, Laghutika (BORI Cat. 17:3, 429-36). Printed Av.1916-17 [ = Av.1981 or 1982). AvNi.1981 or 1982. Also printed with Jnanasagara's Avacurni 1965 (see below). 3.1 Hemacandra Maladharin, pupil of Abhayadeva, Avasyakasutravittipradesavyakhyatippanaka, (BORI Cat. 17:3, 460-62] 1920 *srimanmaladharagacchiyasrimaddhemacandrasurisutritam Haribhadriyavasyaka vrttitippanakam. Bombay : Nirnayasagara Press, 1920. 118 [ie. 236] p. (Sheth Devchand Lalbhai Jain Pustakoddhar Fund series ; 53). Emeneau 3963] With Hemacandra's Pradesavyakhya (JSBI 2, 173 item i). Reprint. 1988. 1988 Srimanmaladharagacchiyasrihemacandra surisutritam Haribhadriyavasyakavrttilippanakam : Mumbai : Sri Jinasasana Aradhana Trasta, Vikrama samvat 2045 (1988). [8], 117 [ie. 234) p. ; 12 x 27 cm. Reprint. Originally published: Bombay : Nirnayasagara Press, [1920). Prakasakiya states original edited by Kumudavijaya, pupil of Manivijaya Gani. Published "Vikrama samvat 1976 (1919)." (p. 7 (1st group) = 1920 edition above?). ANU NEW BOOKS COLLECTION 1 862 016 Malayagiri, his cty on the AvNi. / Av. is incomplete, 18 000 granthas. Begins: patu nah Parsvanathasya. Printed. Av. 1928-36. Other commentators (who follow Haribhadra almost entirely): Tilakacarya, pupil of Sivaprabha Suri, pupil of Cakresvara of the Candra Gaccha. Laghuvitti, 12 325 granthas, composed samvat 1296 [1239). Seems to be in two versions: the smaller is called Gamanika (begins: Srivirajina varendram) of only 200 granthas. The larger one, which begins: devah srinabhisunuh, extends over 12 355 granthas (JRK 38). [BORI Cat. 17:3, 332-34; 439-46; photocopy of a MS of the larger version in the library of the Institut fur Indische Philologie und Kunstgeschichte, Berlin, letter from Klaus Bruhn, July 1997] Extracts edited by Balbir in 1993, 441-67. Jhanasagara, pupil of Devasundara of the Tapa Gaccha, an avacurni, 7885 granthas, samvat 1440 [1383). [BORI Cat. 17:3, 452-54; JRK 371 1965 Sri-Haribhadrasuri-krta-vrtty-anusarena Bhattaraka-Sri-Jnanasagarasuri-viracita Srutakevali-Sri-Bhadrabahusvami-sutrita-Niryukti-yuta-Srimad-Avasyakaniryukter Avacurnih / samsodhakah ... Manavijayah. Surat, Virasamvat 2491. Vikramasamvat 2021. Kraista san 1965. 2, 452, 12, 286, 40 p. (Devcand Lalbhai-Jaina-Pustakoddhara ; 108). [Tripathi 1981, 305) "The verses are called Niryukti-Verses (1-1637) or Bhasya-verses (1-253); which are numbered serially. The so-called praksipta-verses (total 496) are numbered separately for each block of occurrence" (Tripathi 1981, 305). "Pratyah 500." RW (v. 1: p. 2, 452) Manikyasekhara, pupil of Merutunga Suri of the Ancala Gaccha, a dipika, 11 750 granthas, 15th cent. samvat (Balbir 1993, 89). But JRK says, composed samvat 1771 [1714). In this cty the author also mentions his ctys, all called Dipikas, on the Acaranga, Uttaradhyayana, Oghaniryukti, Dasavaikalika, Navatattva and Pindaniruykti. [BORI Cat. 17:3, 456-57; JRK 37). Printed. Av.1939-49. 225
Page #247
--------------------------------------------------------------------------
________________ Mulasutras Av. Editions: 1916-17 Srimadacaryabhadrabahutataniryuktiyutam : Purvadharacaryavihitabhasyabhusitam Sri madbhavavirahaharibhadrasurisutrita vrttyalarkrtam Srimadavasyakasutram / edited by Sagarananda. Mehesana : Agamodaysamiti (sic), Virasamvat 2442-43. Vikramasamvat 1972-73. Kraistasya 1916-17.4v.; 12 x 27 cm. ; [Agamodaya-samiti-siddhanta-sangraha ; no. 1, 2, 3, 4]. [CLIO 1, 244; JRK 35; DLJP series list] Part 1: p. 1a-252b-pt. 2: 253a-490b.-pt. 3: 4, 491a-762b.-pt.4: 764a-865b. Reprinted Av.1981 or 1982. BORI 19194 *Avasyaka sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919. 47 p. ; 13 x 23 cm. (JSBI 2, 173 item u] 1928-295 * Srimad Ganadhara-Gautama-Svami-sandrbdham ... Srimad-Bhadrabahu-Svami-sutrita Niryukti-yutam srimaj-Jinadasa-Gani-Mahattara-krtaya Curnya sametam SrimadAvasyaka-sutram / edited by Sagarananda. Indore : Jaina-bandhu Press, 1928-29.2 v. ; 12 x 27 cm. [DLJP series list] Part 1 1928. [2], 617, p.- Part 2 [1], 325, [1]. [CLIO 1, 244]. Ratlam (Schubring 1955, 297 = Kleine Schriften 321] This is the only printed edition of the Cu. and is not critically constituted. Balbir regards it more or less equivalent to a MS (Balbir, 1993, 82). "In this edition the Niryukti-verses are presented in more than one form: (1) full verse with or without a number, (2) pratika with or without a number, (3) a number only. The numbering of the verses is manifold but not very clear." (Tripathi 1981, 304). 1928-36 Srimanmalayagiryacaryakytavivaranayutam, Srutakevalisrimadbhadrabahusvamisutrita niryuktiyuta-Sriavasyakasutram. Bombay : Sriagamodayasamitch, Virasamvat 2454-62. Vikramasamvat 1984-92. [1928-36). 3 v.; 12 x 28 cm. (Sriagamodayasamitigranthoddhare, granthanka 56, 60. Sresthi Devacandra Lalabhai Jaina pustakoddhare; granthankah 85). [Emeneau 3961; CLIO 1, 243] Purvabhagah, "Pratayah 1250." Virasamvat 2454. Vikramasamvat 1984. [1928). 1-300 [ie. 600] p.- verses. 1-542. Dvitiyabhagah, "Pratayah 1250." Virasamvat 2458. Vikramasamvat 1988. Khristabda 1932. 301-449 sie. 602-898) p.--verses 543-829. Titiyo bhagah edited by Sagarananda (DLJP list) "Pratayah 1000." Gopipura : Sheth Devchand Lalbhai Jain Pustakoddhar Fund, Srivirat 2462 [1936). 451-611 [ie. 9021222) p. ; 2 plates (portraits). "Prathamadvitiyavibhagau purvam Srimatyagamodayasamitidvara mudrapitau prakasitau ca, asya trtiyavibhagasya tu."--verses 830-1099. v.1: f. 3a-5a Srimalayagirisutritaya Avasyakavrtterupakramah" / Anandasagarah ... [dated] 1992 [1935).-56-6b Amukha / Jivananda Sakaracanda Jahveri [dated 1936). Two plates, Sresthi Devacanda Lalabhai Jahveri (b. 22 Nov. 1852, d. 13 January 1906). Not a critical edition but of reasonable quality, in places quotations are identified in parenthesis (Balbir 1993, 89). ANU BL1313.9.A836 1928 v.1, 2, 3 1939-49 Srimadavasyakaniryuktidi pika / Srimadbhadrabahusvamipranitaniryuktiyutabhasya sankalita Srimanmanikyasekharasurisvaraviracita ; samsodhakah Srimanavijayah. Gopipura, Surata : Acarya Srimadvijayadanasurisvaraji Jainagranthamala, Vira samvat < -2475>. Vikrama samvat < -2005>. Kraistasana 1939-49. 3 v. ; 12 x 27 cm. (Acaryasrimadvijayadanasurisvaraji-Jainagranthamala ; 16, 29, 42). [JSBI 2, 173 item i; Tripathi 1981, 305] Description from v. 3:6, 46 [ie. 12, 92] p.: Vancakone sadara vijnapti / Manavijaya, Linca, Vi. sam. 2005 1b-2a.- Prakasakiya nivedana / Srivijayadanasurisvaraji Jainagranthamala vyavasthapakah Mastara Hiralala Ranachodabhai, Surata, 2005 2a4 A second edition of this work is mentioned on the back cover of the Hindi prose version (by Kalyana Rsi) of Amolaka Rsi's earlier work Pradyumnakumaracarita (4th ed. 1980). No further details traced. 5 Muni Jambuvijayaji has prepared a new edition of the Curni (Mayurbhai Shah, personal communication October 1998). 226
Page #248
--------------------------------------------------------------------------
________________ 1951 1953-54 Suttagame /carimatitthayara-pancamaganahara-Suhammayariyaviraie; [sutthuruvena] Pupphabhikkhuna sampadio. 1. avrtti. Gudagamva-chavani, Purvapanjaba: Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354. 2 v.; 19 cm. 1958 1977 6.3 Avassayasutta 2b.-Prastavana / Manavijaya 3a-5a. Suddhipatrakam 5b-6b.- [Series listing 7a-b].-- Avasyakaniryuktidipika trtiyo vibhagah [v. 1550-1617 and Prasasti v. 1-4] 1a-46b. ANU NBC 2 118 369 v. 3 only Sri Avasyakasutram: Ghasilalaji-viracitamunitosinyakhyaya vyakhya samalankrtam Hindi Gurjara-bhasasahitam/niyojako Muniratna Gabbulalaji; Munisri Samiramallaji; Mun[i]sri Kanhaiyalalaji. Rajakota, Saurastra: Sri Sve. Stha. Jainsastroddhara Samitih, Vira samvat 2478. Vikrama samvat 2007. Isvisana 1951. 4, 341 p. ; 3 leaves of plates (portraits); 24 cm. Reprinted 1958. ANU BL1313.9.A836 G4 1951 1987 Text without Niryukti, Avassayasutta v.2: [1164]-1172 and 2. parisittham Savayavassae Samaiyasuttam [43]-45. ANU BL1310.S8 1954 2 v. *[Reprint of Av. 1951 (Ghasilala). Rajakota: Jainasastroddhara Samiti, 1958. [JSBI 2, 173 item el Dasaveyaliyasuttam / Sirisejjambhavatherabhadantaviraiyam: Uttarajjhayanaim. Avassayasuttam ca / anegatherabhadantaviraiyaim: sampadakau Punyavijayo Munih; Pandita Amrtalala Mohanalala Bhojaka iti ca. 1. samskarana. Bambai: Sri Mahavira Jaina Vidyalaya, Vira sam. 2503 [1977]. 91, 664 p. ; 25 cm. (Jaina-Agama-granthamala ; 15). Avassayasuttam [p. 331]-358. ... 7. parisittham Avassayasuttassa suttanukkamo [635]636.-8. parisittham Avassayasuttantaggayanam saddanam anukkamo [637]-657.-9. parisittham Avassayasuttantaggayanam visesanamanam anukkamo [658]. ANU BL1313.83 1977 1981 or 1982 Avasyakaniryuktih : Samayikadhyayana sampurna : Srimadharibhadrasuriviracitatikalankrta: Caturdasapurvadhara Suripurandara Srimad Bhadrabahusvamisugrathita. Mumbai : Sri Bherulala Kanhaiyalala Kothari Dharmika Trasta, Vira sam. 2508 [1982]. Vi. sam. 2038. [1981]. 2 v. ; 29 cm. Contents Bhaga 1: Prakasakiya nivedana / Bherulala Kanaiyalala Kothari Dharmika Trasta (reverse of t.p.)-Avasyakasutra bhaga 1 suddhisuca [2]. Avasyakaniryuktivisayanukramah 1-6.-Sriavasyakasutram [v. 1- 1055] 1-327. Contents Bhaga 2: Prakasakiya nivedana / Bherulala Kanaiyalala Kothari Dharmika Trasta (reverse of t.p.)-Avasyakaniryukti-dvitiyabhage visayanukramah 1-5.Srimadavasyakasutrasyottarardham [v. 1056-1623] 1-250. Srimad Vijaya Premasurisvaraji Maharaja, his pattadhara, Acarya Srimad Vijaya Bhuvanabhanusurisvaraji Maharaja and his pupil Srimad Jayaghosavijaya Maharaja. (Prakasakiya nivedana). Reprint. Original edition by Sagarananda. Agamodaya Samiti, [1916-17]. Here reprinted with a page of corrections listed. ANU FBL1313.9.A836 B48 1981 v. 1 and v. 2 Navasuttani: Avassayam, Dasavealiyam, Uttarajjhayanani, Nandi, Anuogadaraim, Dasao, Kappo, Vavaharo, Nisihajjhayanam/vacana pramukha Acarya Tulasi ; sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana: Jaina Visva Bharati, Vikrama samvat 2044. I[svi san]. 1987. 140, 812, 29, 320 p. ; four pages of plates; 25 cm. "The texts of this sutra have been constituted on the basis of the AvNi., Av.Cu., Haribhadra's cty on the Av. and the MSS available to us." Text without Niryukti, Avassayam [1]-23. Forms v.5 of a complete edition of the Jaina Agama. 227 ANU NEW BOOKS COLLECTION 1 484 435
Page #249
--------------------------------------------------------------------------
________________ Mulasutras 1994 Avasyakasutra : mulapatha, Hindi anuvada, vivecana, tippana yukta / adyasamyojaka tatha pradhana sampadaka Misrimalaji ; anuvadaka-vivecaka-sampadaka Suprabha 'Sudha'. Byavara, Rajasthana : Sri Agama Prakasana Samiti, Viranirvana samvat 2520. Vikrama samvat 2051. I. san 1994. 2. samskarana. 68, 130 p. ; 25 cm. (Jinagama-granthamala ; granthanka 24.) Misrimala d. 1983 [Prastavana, 65 (1st group)]. Date of original printing not established. RW Translations: Hindi: 1919 Amolaka Rsi (Av.1919) 1951 Ghasilala (Av.1951) 1994 Suprabha "Sudha' (Av.1994) Indexes: 1928 Nandyadigathadyakaradiyuto visayanukramah : Srinandi-Anuyogadvara-AvasyakaOghaniryukti-Dasavaikalika-Pindaniryukti-Uttaradhyayananam sutrasutragathaniryuktimulabhasyabhasyanam akaradikramah arkasuddhih laghubrhams ca visayanukramah = An Alphabetical index of the aphorisms etc. occuring in Nandisutra, Anuyogadvara, Avasyaka, Oghanir[y]ukti, Dasavaikalika, Pindaniryukti and Uttaradhyayanasutra : along with detailed lists of subjects treated in these seven Agamas. Mumbayyam : Sri Agamodayasamiteh karyavahakah Jivanacandra Sakaracandra Jhaveri, Virasamvat 2454 [1928). f. 183 [ie. 366 p.) ; 12 x 26 cm. (Sri Agamodayasamiti Granthoddhara , granthakah 55). ANU BL1313.89.N25 1928 1987 (Av.1987): combined index of: Nandi. (including JogNa. and LahuNa.) AnuOg., Utt., Dasave., Av., Dasa. (including AyarDas.), BphKapp., Vava. and Nis.: Parisista 3. Navasuttani saddasuci [15 505 words). p. [1]-319. (Av.studies.Oberlies 1993): a selective glossary drawing on Leumann's 1897 publication, see also Balbir 1993 below). 1993 Studies: Balbir, Nalini. 1986. Etudes d'exegese jaina : les Avasyaka. 976, 111 p. (These de Doctorat d'Etat. Paris, 1986). [Balbir 1993, 10; Bruhn 1993, 32 item 38]. Developed into Balbir 1993. 1990. Stories from the Avasyaka commentaries : translated into English). In, The Clever adulteress and other stories: a treasury of Jain literature / edited by Phyllis Granoff. Oakville, Ontario : Mosaic Press, 1990. 290 p. ; 23 cm. 17-74. ANU PK5045.E1C54 1990 1993. Avasyaka-Studien [1] : Introduction generale et traductions. Stuttgart : Franz Steiner, 1993. 482 p. ; 24 cm. (Alt- und Neu-Indische Studien ; 45, 1). Reprint of Leumann. 1897 below, with translation of the cited passages, explanations and overall introduction to the literature surrounding the Avasyaka. v. 2, glossary by Oberlies, 1993. Developed in part from Balbir 1986 above. Review. Ticken, Herman Asiatische Studien = Etudes asiatiques 48 (1994) 1415-25. ANU NEW BOOKS COLLECTION 2 013 674 Bruhn, Klaus 1981. Avasyaka studies I. In, Studien zum Jainismus und Buddhismus Gedenkschrift fur L. Alsdorf. Wiesbaden, 1981. (Alt- und Neu-Indische Studien, Universitat Hamburg ; 23) p. 11-49. [Balbir 1993, 16] 1998. Bibliography of studies connected with the Avasyaka-commentaries. In, Catalogue of the papers of Ernst Leumann in the Institute for the Culture and History of India and Tibet, University of Hamburg/compiled by Birte Plutat. Stuttgart : Franz Steiner, 1998. (Alt- und Neu-Indische Studien ; 49). p. 119-136. "The title and the idea of this bibliography have been taken from a list published several 228
Page #250
--------------------------------------------------------------------------
________________ 6.3 Avassayasutta years ago by N. Balbir (Balbir 1990 above], 73-74). My $3 [Avasyaka bibliography) is an extended version of that list." (Bruhn 119). This is the most recent and most comprehensive listing of published studies. Butzenberger, K. 1989. Beitrage zum Problem der personalen Identitat in der indischen Philosophie : die jinistischen Beweise fur die Existenz eines jiva im Visesavasyakabhasya. Inauguraldissertation zur Erlangung des Doktorgrades der philosophischen Fakultat der Ludwig-Maximilians Universitat zu Munchen, 1989. iii, 496 p. [Balbir 1993, 16; Bruhn 1993, 35 item 48 Leumann, Ernst. 1895. Uber die Avacyaka-Literatur. Actes, 10th Congress Internationale des Orientalistes. Leiden, 1895. v. 2:1, 125f. [BORI Cat. 17:3, 143] 1897. Die Avasyaka-Erzahlungen /: nach der Curni und nach Haribhadra's Tika, nebst den ubrigen inhaltlich wichtigen Stellen aus beiden Werken]: erstes Heft/ herausgegeben von Ernst Leumann. Leipzig : F. A. Brockhaus, 1897. 48 p. (Abhandlungen fur die Kunde des Morgenlandes ; Band 10, No. 2). [Reprint. Nendeln, Liechtenstein : Kraus Reprint, 1966. 22 cm.] Review. Barth, A. Revue d'Histoire des Religions 45 (1902) 179-80 = Oeuvres, 1914:2, 381-82). Reprinted and translated in Balbir (1993 above) with much explanatory and additional information. Oberlies (1993 below) has created a glossary of important words with meanings. "Far from being an "Ubersicht" in the usual acceptance of the term, the book is a loosely connected aggregate of highly technical studies ... directed to a ... reader who is already familiar with the main facts." Bruhn (1998, 121) ANU MENZIES PJ5.D5 Bd.10, Nr.2 1934. Ubersicht uber die Avasyaka-Literatur von Ernst Leumann aus dem Nachlass herausgegeben / von Walther Schubring. Hamburg : Friederichsen, de Gruyter and Co., 1934. d sie. 4), iv, 56 p. : 41 cm. (Alt- und Neu-Indische Studien ; 4). "[A] loosely connected aggregate of highly technical studies ... the work is unfinished and the print ended after the first two words of a new sentence (removed by W. Schubring in the publication ... '[(p. 5-6), Klaus Bruhn, Bibliography of studies connected with the Avasyaka-commentaries (1998 study above)). ANU LARGE BOOK PK5001.A3L4 Mette, Adelheid. 1983. The Tales belonging to the Namaskara-vyakhya of the Avasyaka-curni : a survey, Indologica Taurinensia 11 (1983) 129-44. [Balbir 1993, 21] Oberlies, Thomas. 1993. Avasyaka-Studien [2] : Glossar ausgewahlter Worter zu E. Leumann's >> Die Avasyaka-Erzahlungen<<. Stuttgart : Franz Steiner, 1993. 203 p. ; 24 cm. (Alt- und NeuIndische Studien ; 45, 2). v. 1 by Balbir, 1993. ANU NEW BOOKS COLLECTION 2 013 675 Verclas, Katrin. 1978. Die Avasyaka-Erzahlungen uber die Upasargas des Mahavira im Vergleich mit den Versuchungen des Bodhisattva in der buddhistischen Literatur. Diss. Zur Erlangung der Wurde des Doktors der Philosophie der Universitat Hamburg vorgelegt von ... Hamburg, 1978. iv, 278 p. Balbir 1993, 25; Bruhn 1993a, 27 item 20) 229
Page #251
--------------------------------------------------------------------------
________________ 230
Page #252
--------------------------------------------------------------------------
________________ 6.4 SAD-AVASYAKASUTRA (SadAv.) Content: The SadAv. is known in several versions of variable extent, it includes material foreign to its predecessor the Av. (Balbir 1993, 33-34). This seems to be the same text referred to by Leumann in his Ubersicht as Av. Exegesis:1 1 Editions: 1935 1951 Tarunaprabha Suri, pupil of Jinacandrasuri of the Kharatara Gaccha, Tika (Gujarati) composed in samvat 1411 [1354]. Extracts from this were published by Jinavijaya in his Pracina Gujarati-gadyasandarbha, Ahmedabad (JRK 39). [BORI Cat 17:3, 349-52] 1976 1969 Sadavasyakabalavabodhavrtti/Settarunaprabhacaryakrta: caturdasakatakagujaratibhasayah visesadhyayanam evam upayuktisabdasucisamanvitam/granthasampadaka Prabodha Becaradasa Pandita. Bambai : Bharatiya Vidya Bhavana, Vi. sam. 2032. I. san 1976. xxxii, 38, 233, 62 p. ; 2 leaves of plates; 27 cm. (Singhi Jaina granthamala; granthanka 71). 1 Contents: Contents [ii]. Publishers' note [iv]. General editor's foreword / Muni Jinavijaya [v] Homage [to] Munishri Jinavijayaji [viii]. [Paryalocana] / Muni Jinavijaya [ix]-xxxii.-Preface / P. B. Pandit. [1]. -Abbreviations [2]. A study of the Gujarati language in the 14th century / P. B. Pandit. [3]-38. -Sadavasyakabalavabodhavrtti [1]-233.-Index [1]-62. The complete text of Tarunaprabha's work, with a linguistic study and a comprehensive etymological word-index. The text was composed in samvat 1411 [1354]. One MS is dated samvat 1412 [1355]. Text established here on the basis of four MSS: (1) Bikaner, Mahima-Bhakti Bhandar. 199 folios. (2) Pune, BORI, no. 797 of 1895-1902 342 folios. (3) Limbdi Bhandar 154 folios, dated samvat 1419 [1362]. (4) Patan, Sri Sangha no Jain Jnana bhandar no. 691 196 folios, samvat 1508 [1451]. 1931 or 1932 Sravaka sastha Avasyaka sutra : dusara bhaga / Sri Amarasimha ji Maharaja ki sampradaya ke samvegi mata Vijayi Gani Srisvami Udayacanda ji Maharaja ke sisya Sthanakavasi samaja ke parama hitaisi Srimansvami Ratnacandra ji Maharaja Jainamuni Panjabi krta. Jalandhara Nagara: Vikramo samvat 1988 [1931]. Vira Nirvana samvat 2458 [1932]. 8, 66 p.; 13 x 22 cm. Contents: Prastavana 1-8.-Lokottaraveda Sri samutthanasutra ke sasthavasyakanga ka dvitiya bhaga 1-66. ANU BL1305.S5 no. 71 ANU PAMPHLET BL1313.9.A832 $5 1932 *Sri-sadhu-sadhvi yogya avasyaka kriya ke sutra | sampadaka Samudravijayagani. Prathamavrtti. Bhavanagara : Sri Jaina Atmananda Sabha, 1951. 6, 48, ; 13 x 28 cm. Further Avasyaka literature Samayikastra *Sadhusadhvidaivasikaratrikapaksikacaturmasikasamvatsarika pratikramanani prakirnakavidhisamyutani Sadavasyakasutrani. Ratlam : Sresthi Rsabhadevaji Kesarimalaji Samstha, samvat 1992 [1935]. [BORI Cat 17:3, 134n] Samayika-sutra : pravacana, mula, artha evam vivecana sahita / lekhaka Upadhyaya Amaramuni. Agara : Sanmati Jnanapitha, 1969. 16, 319 p. ; 22 cm. Contents: Prakasakiya [5-6].-Antardarsana [7]-14.-Anukranika [1]-16.-Pravacana] 1-132. Samayika sutra 133-287.-Parisista 284-304. Text and cty. University of Poona Q31:21x/152 J9/200459 Mainly works held by the ANU Library are listed here, an extensive literature is listed in BORI Cat 17:3, JRK and CLIO under such titles as: Samayika, Cauvisatthaya, Caityavandana, Guruvandana, Pratikramanasutra, Sraddhapratikramanasutra, Sadhupratikramanasutra, Kausagga, Pratyakhyanasutra.
Page #253
--------------------------------------------------------------------------
________________ Mulasutras Caityavandanasutra Exegesis: 1 2 Haribhadra, 700-770, Lalitavistara (LVi.) Vitti, 482 granthas, said to have been composed for Siddharsi, author of the Upamitibhavaprapanca (JRK 125). 1977 1.1 Municandra, 12th cent. pupil of Vinayacandra and Guru of Vadidevasuri. Lalitavistarapanjika, 1800 granthas, a commentary on Haribhadra's Vrtti. (JRK 125-26) Printed LVi.1915; 1965. 1.1.1 Bhadrankara Suri, Bhadrankari, super-commentary on Municandra's Lalitavistarapanjika. Printed in edition of Municandra's cty, 1990 below. Editions: 1915 *[Lalitavistara (cty on Caityavandanasutra) with Municandra's Panjika / edited by Sagarananda. (Sresthi-Devacandra-Lalabhai-Jaina-Pustakoddhara series; 29). [BORI Cat 17:3, 225; DLJP series listing] 1934 *[Lalitavistara]. Ratlam: Rsabhadevaji Kesarimalaji Samstha, 1934. [BORI Cat 17:3, 225] 1965 Sri Lalita-vistara tadiya ca svaparatantrakusala-"caryavarya-Sri Municandrasurigumphita "Panjika-vyakhya" / sampadakah Sri Rajendravijayo Munih. Ahmadabada: Sri Divyadarsana Sahitya Samiti, Vira samvat 2462. Vi. sam. 2022. I. sam. 1965. 1. avrtti. 'ka'-'ga', 5, 2, 120 p. ; 25 cm. ANU NBC 2 118 355 1990 * Lalitavistara : tikakara Bhadrankarasurisvaraji Maharaja/sampadaka Vikramasena. Madrasa Bhuvanabhadrankara Sahitya Pracara Kendra; Gujarata: Praptisthana. Labdhibhuvana Jaina Sahitya Sadana, 2047 [1990]. 48, 288, 8, 197 p. ; 24 cm. (Sri Bhuvanatilakasuri granthamala; 54). Includes Bhuvanatilakasuri's Bhadrankari super commentary. Dharmaghosa Suri, his earlier name was Dharmakirti, pupil and successor of Devendra, the author of the Bhasya on the Caityavandanasutra. Bhasyasanghacara-vrtti, 8 500 granthas, composed before samvat 1327 [1270]. Copy in Jaisalmer dated 1329 [1272], probably the author's own copy (JRK 126). Editions: 1988 or 1989 Tapogacchadhurandharasrimaddevendrasuripranitam tadantevasisrimaddharmakirtisutritasrisanghacaravidhyakhyavrttiyutam: Sri Caityavandana bhasyam. Mumbai : Sri Jinasasana Aradhana Trasta, Vikrama samvat 2045 [1988]. Vira samvat 2515 [1989]. 27, 462 p. ; 12 x 27 cm. Contents: Prakasakiya [4-6].--... brhad visayanukramah 9-27. [Srisanghacaradirstantah Stutasthanani) Srisanghacarabhasyam [1]-462. Originally published: Ratlam : Sri Rsbhadeva Kesarimalaji Jaina Svetambara Pedhi (p.5 (1st group)). Last pages says end of first adhikara. Not listed in Emeneau or CLIO. (JRK 1264) ANU NEW BOOKS COLLECTION 1 862 020 Pratikramanas@tra: Jayavijaya, Muni. fl. 1693. Sadavasyaka Balavabodha [Pancapratikramana sutra] : Tapagacchiya Srivinayasenasurisantaniya Muni Srijayavijayaji viracita: sutrono mulapatha, Gujarati Balavabodha, kathao tatha Mumbaimam citaraelam ekaso sudatalisa citro sahita / sampadaka tatha samsodhaka Sarabhar Manilala Navaba. 1. samskarana Amadavada: Mesarsa Sarabhai Manilala Navaba, Vi. sam. 2033. I. sa. 1977. 27, 143 p. [31] leaves of plates : ill. (some col.); 26 cm. (Srijaina kala-sahitya samsodhana; puspa 17mum). ANU BL1313.9.A835 J3 1977 "Prati 1000." 232
Page #254
--------------------------------------------------------------------------
________________ 6.3 Sadavassayasutta 1982 *Sri do pratikramana sutra : sarala vidhi sahita/ sampadaka Ratnakaravijayaji Ganivarya. Majera, Jila Udayapura : Sri Ajitanatha Jaina Chatravasa, 2039 (1982). 4, 100 p. ; 19 cm. 1986 Pratikramana sutra : Hindi-Angreji / lipyantaraka, sangrahaka, anuvadaka [Muni] Nirvanasagara 1. avitti. Koba, Bharata : Sri Mahavira Jaina Aradhana Kendra, Vira samvat 2512, Isvi san 1986. 43, 266 p : ill. ; 19 cm. Numerous short sutras, stotras, stutis, stavas, vandanas etc. In Prakrit and Sanskrit with transliteration. No translations. One series of photographs of the postures for pratikramana (p. 28-38), as well the padilehana of the muhapatti (p 34-38). Errata page facing p. 266. "Prati 3 000." ANU NEW BOOKS COLLECTION 1 778 581 Sraddhapratikramanasutra: 1975 Sri-sraddha-pratikramana-sutra : Prabodha tika : saptanga vivarana / samsodhaka Bhadrankaravijaya , Kalyanaprabha ; sampadaka Narottamadasa Naginadasa Saha. Mumbai : Jaina Sahitya Vikasa Mandala, Vi. sam. 2032-34 (1975-77). 3 v. ; 19 cm. Bhaga 1. sutra 1-25: 16, 82, [2], 832 p. Suddhipatraka 825-32. Bhaga 2. sutra 26-45:15, 12, 671 p. Suddhipatraka 1-12 (2nd group). "Samsodhita bijum avstti" Vikrama samvat 2033 (1976). Bhaga 3. sutra 46-62: 16,972, 20 p. (Suddhipatraka) 1-20 (4th group) "2. avrtti. Sa[m]sodhita parivardhita." Vi. sam. 2034. Isa. 1977. ANU BL1314.2.5734 G8 1976 [sic]2 2 Some pages are misbound, but the text is complete. 233
Page #255
--------------------------------------------------------------------------
________________ 234
Page #256
--------------------------------------------------------------------------
________________ 6.5 PINDANIJJUTTI (Pind Ni.) Author: attributed to Bhadrabahu. Title: Pindaniryukti (Skt). Content: About 700 gathas divided into eight chapters dealing with regulations about food for monks and nuns (JRK 249). References: Schubring 1935 $55; JRK 249-50; JSBI 2, 195-98; BORI Cat. 17:3, 481-92. Exegesis Malayagiri, Tika 6 700 granthas (JRK 249). Printed in PindNi.1918; translated into Gujarati, PindNi.1962. Haribhadra and Viragani, pupil of Devacarya, Vrtti called Sisyahita. composed partly by Haribhadra (1 350 granthas) and partly by Viragani (1 750 granthas). Begins: namramaresvara. Kapadia says the author is also known as Samudraghosa Suri, pupil of Isvara Gani or the Saravala Gaccha (BORI Cat. 17:3, 484). Kapadiya also gives a long "prasasti of the Vrtti. From this, the (extent of Viragani's portion alone would be 7 671 [granthas). The date of composition given here is samvat 1160 [1103]. The name of the author's guru is Isvara Gani, who belonged to the Saravalaka Gaccha according to the prasasti. Mahendra Suri, Devacandra Gani and Parsvadeva Gani helped him. It was corrected by Nemicandra Suri and Jinadatta Suri at Anhilwad" (JRK 249). The introduction to PindNi.1958 contains different information (p. 3). Extracts from the beginning and end printed in PindNi.1958, p. 136b-160b. Manikyasekhara,' pupil of Merutunga of the Ancala Gaccha. Dipika, 2832 granthas. Based on Malayagiri's cty and mentioned in the author's Avasyakadipika (JRK 249). Extracts from the beginning and end printed in PindNi.1958, p. 161a-177b. Ksamaratna, pupil of Jayakirti Suri of the Ancala Gaccha, Avacuri, based on the Brhadvitti to PindNi (JRK 249; BORI Cat. 17:3, 489). Printed in Pind Ni.1958. Pindaniryuktivisamapadaparyaya, part of the Pancavastukaparyaya (BORI Cat. 17:3,49192). Pindaniryuktivisamagathavivarana (BORI Cat. 17:3, 491-92). Vivstti or Laghuvetti, 2 950 granthas. Begins: prarabhyate Pindaniryuktih (JRK 249). Vitti (JRK 250). Editions: 1918 Srimadbhadrabahusvamipranita-sabhasya-srimanmalayagiryacaryavivrta Sripinda niryuktih / [edited by Sagarananda. Suratasiti : Devacandra Lalabhai Jainapustakoddharaphanda, Bhagavadvirasya 2444. Vikramanrpasya 1974. Isukhriste 1918.2, 179, [1] p. ; 1 leaf of plates ; 12 x 27 cm. (Sresthi Devacandra Lalabhai-Jainapustakoddhara ; no. 44). CLIO 3: 1916; DLJP series list) "Pratayah 1000." This edition is the same as PindNi.1958 according to Bollee (1991-94 1:xi, however he does not restate that in 2, 394). BORI 38 135 1958 Sripindaniryuktih : Srimadbhadrabahusvamipranita sabhasya Srijayakirtisurisisyasriksamaratnasutrita 'vacuryupeta : Sriviraganiracitayah Sisyahitayah Srimanekasekhara 1 His works are listed in BORI Cat 17:3, 457.
Page #257
--------------------------------------------------------------------------
________________ Mulasutras surikstaya Dipikaya adyantabhagau ca / sampadakah Muni Kancanavijayah. 1. samskaranam. Surata : Sresthidevacandralalabhaijaina pustakoddharakosasya, Virasam. 2484. Vikramah 2014. Sake 1880. Khristabdah 1958. 19, 177 [ie. 38, 354) p. ; 1 plate ; 13 x 28 cm. (Sresthidevacandra-Lalabhai-Jaina pustakoddharake granthankah 105). Content:. Prakasakiya nivedana / Moticanda Maganabhai Coksi 3a-5a.--Sampadakiya nivedana /Muni Kancanavijaya 5b-9b.-Visayanukramah 10a-14b.Suddhipatrakam 15a-19a. Sripindaniryukti 1a-120b.-1. Parisistam Sabhasya pindaniryukter gathanam akaradikramah 121a-130a.-2. Pindaniryuktigatabhasyagathanam pratikani 1300131a.-3. Avacuriksta saksyaditvena dhrtanam granthanam akaradi. 131a.-4. Saksidhrtanam pathanam akaradi 131b.-5. Vyakaranadinirdesah. 132a.-6. *Anne'ityadi 132a.-7. Namnam akaradikramah 132-134a.-8. Avacurigatany udaharanani 1346-136a.-9. Sriviracaryakstayah Pindaniryuktitikayah adyantabhagau. 136b-160b.-10. Manikyasekharasurikrta Pindaniryuktidipika 161a-177b. "Pratayah 500." ANU LARGE BOOK BL1313.9.P566 K3 1958 1962 Srutakevali Bhagavanta Sri Bhadrabahusvamiji viracita Sripindaniryukti grantharatnano: Malayagiriji viracita tikarthayuta suvisuddha anuvada / anuvadaka Hamsasagaraji. Bhavanagara : Sri Sasanakantoddharaka Jnanamandira : Virasam 2488. Vi. sam. 2018. Sane 1962. Sake 1883. Agamoddharaka sam 12. 396 p. ; 25 cm. (Sasanakatakoddharaka granthamala ; 9). Contents: Amukha [5)-14.-Visayanukramanika [15]-20.-Suddhipatraka [21]. --Sri Pindaniryuktisutrano anuvada [1]-396 p. Reprint of an earlier edition, since it is referred to in PindNi.1958, 4a. "Kopi 500." LD 12 301. 1989 Niryukti-sangrahah / Bhadrabahusvamiviracitah ; sampadakah samsodhakas ca Srijinendrasuri. Prathamavrttih. Lakhabavala, Santipuri, Saurastra : Sri Harsapuspamsta Jaina granthamala, Vira sam. 2515. Vikrama sam. 2045. San 1989. 20,600 p. ; [1] plate ; 19 cm. (Sri Harsapuspamrta Jaina granthamala; 189). Sripindaniryuktih [266]-327. *750 Pratayah ANU BL1310.4 B432 1989 1991-94 Bollee, Willem B. Materials for an edition and study of the Pinda- and Oha-nijjuttis of the Svetambara Jain tradition. Stuttgart : Franz Steiner, 1991-94.2 v. ; 24 cm. (Beitrage zur Sudasienforschung Sudasien-Institut Universitat Heidelberg : Band 142, 162). v.1 [Pada index of the Pinda- and Oha-Nijjutti], xv, 160 p. v.2 Text and glossary, xiii, 418 p. Contents v.1: Preface. vii-viii. -Abbreviations. x-xi.-Introduction xiii-xiv.-The order of the Prakrit letters used in this book. xv.-Pada index of the Pinda-and Oha-Nisjutti. 1-160. Contents v.2: Preface vii-ix.-Abbreviations xi-xiii.- Pinda-and Ohanijjutti with Bhasya 1-104. Glossary 105-388.-Bibliography 389-96.-Appendix: Index to R. N. Shriyan Mahapurana of Puspadanta. Ahmedabad, 1969. 397-418. ANU BL1313.9.P569 B64 1991 [v.1].[ v.2. on order] Review v. 1: Nalini Balbir BEI 9 (1991) 283-84: *A. Mette WZKS 36 (1992) 236-37 [BEI 11-12 (1993-94), 472] Review v. 2: Nalini Balbir BEI 11-12 (1993-94) 472-74. Review article v. 1-2: K. R. Norman The Jain nijjuttis, Acta Orientalia 58 (1997) 52-74. Corrigenda published p. 194-97 in, The Nijjuttis on the seniors of the Svetambara Siddhanta : Ayaranga, Dasaveyaliya, Uttarajjhaya and Suyagada : text and selective glossary / Willem B. Bollee. Stuttgart : Franz Steiner, 1995. ix, 197 p. 24 cm. (Beitrage zur Sudasienforschung Sudasien-Institute Universitat Heidelberg : Band 169). *This volume is intended as an aid for further studies of the Pinda- and Oha-Nijjuttis as begun by Adelheid Mette with her Pind'esana (Mainz 1974. [= Ogha Ni.Partial edition. 1974]). It lists for the first time the quarter stanzas of two Nijjuttis dealing with 236
Page #258
--------------------------------------------------------------------------
________________ 6.5 Pindanijjutti the Jain ascetics' daily alms-round (OhaNi.) and the transgressions they may incur during these (Pinda Ni.) in order to facilitate a comparison of these two texts with each other and with other Nijjuttis of a similar content ... and ... to facilitate the identification of quotations" (Bollee 1991-94:1, vii). "[C]ontains the metrically and sometimes graphically corrected pothi text [from Pind. 1918; 1958; OhaNi.1957; 1974). Some errors in the former have been removed, and the stanzas critically edited by Adelheid Mette (Pindesana =Ogha Ni.Partial edition. 1974, p. 11 n. 35; 29) have, for the most part, been adopted. As a "computercompatible" working text it is meant to be a reference basis for the glossary, the latter only being the main object here" (v.2, vii). Partial edition: Jain, Rajendra P. 1983. * Pindasuddhi : das sechste Kapitel von Vattakeras Mulacara und der ahakamma-Abschnitt der Pinda-nijjutti. New Delhi, 1983. ii, 147 p. Bollee 1991-94:2, 392). "Dissertationsdruck." Doctoral thesis, Hamburg. Chapter six of Vattakera's Mulacara and vs. 94-217 of PindNi., introduction, text, translation, notes (Bruhn 1993a, 30 item 30). Translation: Gujarati 1962 Muni Hamsasagara (PindNi.1962) Partial translation: German: 1983 Rajendra P. Jain. (PindNi.Paritial edition. 1983) v.94-217 Studies: 1978 or 1979 Sri Pindaniryukti paraga / lekhaka Pujya Panyasaji Maharaja, Sri Nityananda Vijayaji Ganivara. Khambhata : Jaina Dharmika Trasta, Vira samvat 2505 [1979]. Avrtti 2. Vikrama samvat 2035 [1978]. 23, 312 p. ; 19 cm. "Prati 1000." Contains about 100 verses of the Pinda Ni. with Gujarati commentary. ANU NBC 2 118 350 Indexes: 1928 Nandyadigathadyakaradiyuto visa yanukramah : Srinandi-Anuyogadvara-Avasyaka Oghaniryukti-Dasavaikalika-Pindaniryukti-Uttaradhyayananam sutrasutragathaniryuktimulabhasyabhasyanam akaradikramah ankasuddhih laghubshams ca visayanukramah = An Alphabetical index of the aphorisms etc. occuring in Nandisutra, Anuyogadvara, Avasyaka, Oghanir[y]ukti, Dasavaikalika, Pindaniryukti and Uttaradhyayanasutra : along with detailed lists of subjects treated in these seven Agamas. Mumbayyam: Sri Agamodayasamiteh karyavahakah Jivanacandra Sakaracandra Jhaveri, Virasamvat 2454 [1928). f. 183 [ie. 366 p.) ; 12 x 26 cm. (Sri- gamodayasamiti Granthoddhara , granthakah 55). ANU BL1313.89.N25 1928 1991-94 (PindNi. 1991-94) v.1: Pada index of the Pinda- and Oha-Nijjutti. p. 1-160. 237
Page #259
--------------------------------------------------------------------------
________________ 238
Page #260
--------------------------------------------------------------------------
________________ 6.6 OGHANIJJUTTI (Ogh a Ni.) Author: attributed to Bhadrabahu. Title: Oghaniryukti (Skt). Content: "General explanation" of the details of a monk's life: checking (for life forms), food, confession, atonement and so on. 1164 gathas (JRK 46), 1149 gathas (Schubring 1935 $55). References: JRK 63-64; Schubring 1935 $55; JSBI 2, 201-10; BORI Cat. 17:3.493-511. Exegesis: Bhasya, 2 570 granthas (JRK 63). Malayagiri, Vrtti, 8 850 granthas (JRK 63). Dronasuri or Dronacarya, Avacuri, 6 825 granthas, composed samvat 1149 [1092] (JRK 63). Printed OghaNi.1919; Ogha Ni.1957. Jianasagara, pupil of Devasundara Suri of the Tapa Gaccha, Avacuri, composed in samvat 1439 [1382]. He also wrote ctys on Utt. and Nandisutra (JRK 63). Printed OghaNi.1974. Manikyasekhara Suri.2 pupil of Merutunga of the Ancala Gaccha. Dipika, mentioned by the author in his Prasasti to his Avasyakaniryukti-dipika (JRK 63). Gunaratna Suri, Uddhara, 140 gathas extracted from the text itself (JRK 63). Uddhara 177 gathas (JRK 63). Avacuri (JRK 63). Tika (JRK 63). Oghaniryuktiparyaya see Pancavastukaparyaya (BORI Cat. 17:3, 510-11). Editions: 1919 Srutakevalisrimadbhadra bahusvamiviracitaniryuktisrimatpurvacaryaviracitabhasyayuta : Navangivrttisodhakanirvittikulabhusanasrimaddronacaryasutrita vrttibhusita Srimati-Oghaniryuktih. Mehesana : Agamodayasamiti, Virasamvat 2445. Vikramasamvat 1975. Kraista 1919. 227 sie. 454) p. ; 12 x 27 cm. Edited by Saha Venicandra Surcandra. This edition is based on Poona MS 1872/73 No. 94 see BORI Cat. 17:3, 493f. No. 1124 (Mette Ogha Ni.partial edition. 1974, 150). "Pratayah 1000." BORI 38 158 / *LD 6269-72 1957 *Srimad-Bhadrabahusvami-viracita-Niryukti-Srimat-purvacarya-viracita-bhasya-yuta: Srimad-Dronacarya-sutrita-vrtti-bhusita Srimati Oghaniyukti. 38, 516 p. (Vijayadanasurisvaraji Jaina granthamala ; 56). [Tripathi 1981, 317] Bhavnagar (Bollee 1977-88:1, 174). Based on five MSS and Ogha Ni.1919 (Bollee 1991 94:1, xi). 1974 *[Ogha-niryukti with Jnanasagara's avacuri). Surat (Sresthi Devacandra Lalabhai Jaina pustakoddhare granthankah ; 121). [Bollee 1991-94:2, 393] "The 1974 pothi, which is not free from printing errors ... by means of the siglum pra.... indicates the corrections of the spurious readings of [OghaNi.1919]" (Bollee 1991-94:2, viii). 1989 Niryukti-sangrahah/Bhadrabahusvamiviracitah; sampadakah samsodhakas ca Srijinendra suri. Prathamavrttih. Lakhabavala, Santipuri, Saurastra : Sri Harsapuspamsta Jaina grantha| Drona, also worked on Abhayadeva's Vitti on the Uvavaiya. See Uvav. 1882, 198. (Schubring 1935, 83 n.2). 2 His works are listed in BORI Cat 17:3, 457.
Page #261
--------------------------------------------------------------------------
________________ Mulasutras mala, Vira sam. 2515. Vikrama sam. 2045. San 1989. 20, 600 p. ; [1] plate ; 19 cm. (Sri Harsapuspamsta Jaina granthamala ; 189). "750 Pratayah." Srimati Oghaniryuktih [190]-265. ANU BL1310.4 B432 1989 1991-94 Bollee, Willem B. Materials for an edition and study of the Pinda- and Oha-nijjuttis of the Svetambara Jain tradition. Stuttgart : Franz Steiner, 1991-94.2 v. ; 24 cm. (Beitrage zur Sudasienforschung Sudasien-Institut Universitat Heidelberg : Band 142, 162). v. 1 Pada index of the Pinda- and Oha-Nijjutti), xv, 160 p. v.2 Text and glossary, xiii, 418 p. Contents v.1: Preface, vii-viii.-Abbreviations. x-xi.- Introduction xiii-xiv.-The order of the Prakrit letters used in this book. xv.-Pada index of the Pinda- and Oha-Nijjutti. 1-160. Contents v.2: Preface vii-ix.-Abbreviations xi-xiii. Pinda-and Ohanijjutti with Bhasya 1-104. Glossary 105-388.--Bibliography 389-396.-Appendix: Index to R. N. Shriyan Mahapurana of Puspadanta. Ahmedabad, 1969. 397-418. ANU BL1313.9.P569 B64 1991 [v.1). Propose v.2. Review v. 1: Nalini Balbir BEI 9 (1991) 283-84; *A. Mette WZKS 36 (1992) 236-37 [BEI 11-12 (1993-94), 472] Review v. 2: Nalini Balbir BEI 11-12 (1993-94) 472-74. Review article v. 1-2: K. R. Norman The Jain nijjuttis Acta Orientalia 58 (1997) 52-74. Corrigenda published p. 194-97 in The Nijjuttis on the seniors of the Svetambara Siddhanta : Ayaranga, Dasaveyaliya, Uttarajjhaya and Suyagada : text and selective glossary / Willem B. Bollee. Stuttgart : Franz Steiner, 1995. ix, 197 p. 24 cm. (Beitrage zur Sudasienforschung Sudasien-Institute Universitat Heidelberg : Band 169). "This volume is intended as an aid for further studies of the Pinda- and Oha-Nijjuttis as begun by Adelheid Mette with her Pind'esana (Mainz 1974 [ = Ogha Ni.Partial edition.1973]). It lists for the first time the quarter stanzas of two Nijjuttis dealing with the Jain ascetics' daily alms-round (OhaNi.) and the transgressions they may incur during these (Pinda Ni.) in order to facilitate a comparison of these two texts with each other and with other Nijjuttis of a similar content ... and ... to facilitate the identification of quotations" (Bollee 1991-94:1, vii). *[C]ontains the metrically and sometimes graphically corrected pothi text [from Pind.1918; 1958; Oha Ni.1957; 1974]. Some errors in the former have been removed, and the stanzas critically edited by Adelheid Mette (Pindesana =Ogha Ni.Partial edition. 1973, p. 11 n. 35; 29) have, for the most part, been adopted. As a "computercompatible working text it is meant to be a reference basis for the glossary, the latter only being the main object here" (v.2, vii). Partial editions: 1974 Pind'esana: das Kapitel der Oha-nijjutti uber den Bettelgang: ubersetzt und kommentiert / von Adelheid Mette. Mainz : Akademie der Wissenschaften und der Literatur, 1974. 242 p. ; 24 cm. (Abhandlungen der Geistes- und Sozialwissenschaftlichen Klasse, Jahrgang 1973, Nr. 11). Text edition of v. 331-595 (bha. 192-298). Based on OghaNi.1919 and OghaNi.1957, a handwritten compilation by Leumann (based on 3 MSS from Berlin-Berl. Ms. or.fl. 1067, Berl. Ms.or.f1.720, Berl. Ms.or.fl. 1068--and one from Poona-Poona Ms. 1880/1 No. 9 see Kapadia, 1.1.p. 494f. No. 1125.); 2 palmleaf MSS from Patan (Cat. p. 378, no. 61; p. 385, no. 28); 1 palmleaf from Jaisalmer, samvat 1491; 1 paper MS from the collection of Punyavijaya, Ahmadabad, samvat 1572. (p. 150). Text established here taken into Ogha Ni. 1991-94. ANU PK5003.A58P5 1974 Indexes: Nandyadigathadyakaradiyuto visayanukramah : Srinandi-Anuyogadvara-AvasyakaOghaniryukti-Dasavaikalika-Pindaniryukti-Uttaradhyayananam sutrasutragathaniryukti 240
Page #262
--------------------------------------------------------------------------
________________ mulabhasyabhasyanam akaradikramah ankasuddhih laghubrhams ca visayanukramah = An Alphabetical index of the aphorisms etc. occuring in Nandisutra, Anuyogadvara, Avasyaka, Oghanir[y]ukti, Dasavaikalika, Pindaniryukti and Uttaradhyayanasutra : along with detailed lists of subjects treated in these seven Agamas. Mumbayyam : Sri Agamodayasamiteh karyavahakah Jivanacandra Sakaracandra Jhaveri, Virasamvat 2454 [1928]. f. 183 [ie. 366 p.]; 12 x 26 cm. (Sri-Agamodayasamiti Granthoddhara ; granthakah 55). 6.6 Ohanijjutti 1991-94 (OhaNi.1991-94) v.1: Pada index of the Pinda- and Oha-Nijjutti. p. 1-160. 241 ANU BL1313.89.N25 1928
Page #263
--------------------------------------------------------------------------
________________ 242
Page #264
--------------------------------------------------------------------------
________________ Chedasutras 242
Page #265
--------------------------------------------------------------------------
________________ 7 CHEDASOTRAS 7.1 AYARADASAO (Ayar Das. / Dasa.) Author: ascribed to Bhadrabahu. Title: Acaradasah (Skt); or Dasasuyakkhandha; Dasasrutaskandha (Skt); Dasao. Content: Dasa 1-7 deal with monastic discipline. Dasa 8 is the Kalpasutra (Kapp.) (or Paryusanakalpa). It is composed of three parts--the Jinacaritra, the biography of Mahavira; the Theravall (Sthaviravali) list of schools (gana), their branches (sakha), heads of schools (ganadhara); the Kalpasutra which contains the Samacari, rules for ascetics (this text is treated separately below).Dasa 9 describes thirty types of karma that delude the self (mohathana). Dasa 10 description of various nidanas. References: Winternitz 1933 2:462-64. Schubring 1935 $51; JSBI 2, 215-34; BORI Cat 17:2 60-78; JRK 171-72. Exegesis (of complete text] Bhadrabahu, Niryukti / Dasasrutaskandhaniryukti, 144 gathas [JRK 172a; JSBI 3, 120-22]. 1989 Niryukti-sangrahah / Bhadrabahusvamiviracitah ; sampadakah samsodhakas ca Srijinendrasuri. Prathamavsttih. Lakhabavala, santipuri, Saurastra : Sri Harsapuspamsta Jaina granthamala, Vira sam. 2515. Vikrama sam. 2045. San 1989. 20, 600 p.;[1] plate ; 19 cm. (Sri Harsapuspamsta Jaina granthamala; 189). 8. Sridasasrutaskandhaniryuktih (476) 481.-9. Paryusanakalpadhyayananiryuktih 481-90. ANU BL1310.4 B432 1989 Printed Dasa. 1954. Curni, 2225 granthas, 4321 including sutra and Niryukti (JRK 172a). Printed Dasa.1954 or 1955? Brahmarsi / Brahmamuni, pupil of Parsvacandra of the Tapa Gaccha, Tika 5150 granthas. Begins: yathasthitasesa (JRK 172a; BORI Cat 17:2, 74-77). Tika (JRK 172b). Paryaya see Pancavastukaparyaya (JRK 172b; BORI Cat 17:2, 77-78). Editions of the complete text: 1919 *Dasasrutaskandha sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919. 148 p. ; 13 x 23 cm. [LC] "Dass diese Bemuhungen samtlich unkritisch sind, in [1919) und [1936] das Prakrit von Fehlern wimmelt und uber Stock und Stein hinweg interpretiert wird, ist der ubliche Zustand" (Schubring Ayar. 1966, 5). LD 11 605 1936 Dasasrutaskandhasutram : Samskrtacchaya-padarthanvaya-mularthopetam Ganapatigunaprakasikahindi-bhasa-tikasahitam ca / anuvadaka Upadhyaya Atmarama. Prathamavitti. Lahaura : Jaina Sastramala Karyalaya, Mahavirabda 2462. Vikramabda 1993. Isavi san 1936. 6, 8, 11, 16, 15, 496, 7, 34 p. ; 25 cm. (Jainasastramala ; prathamam ratnam). Contents: Visaya-suci. 1-6.-Dhanyavada 1.-Svadhyaya (1)-11.- Prakkathana [1]16.-Bhumika / Atmarama [1]-15.- [Text] 1-486.-Sutranukramanika [1]-7.Dasasrutaskandhasutra-sabdartha-kosa [1]-34. "1000 copies)." Sumptuous edition. With cty of Sri 1008 Upadhyaya Atmarama (Panjabi), who has also written a popular tika in Hindi. Life of Atmarama (he died in samvat 1971 [1914) is given in the foreword to his Muktisopana. Daksina Haidarabada, 1915. (Alsdorf 1966, 5). | There are brief studies of some of the dasas in Tatia 1981: Dasa 1 (p. 11-13); Dasa 3 (p. 27-30); Dasa 4 (p. 31 35); Dasa 5 (p. 36-40).
Page #266
--------------------------------------------------------------------------
________________ Chedasutras 1954 1960 1966 1977 1987 1992 "Dass diese Bemuhungen samtlich unkritisch sind, in [1919] und [1936] das Prakrit von Fehlern wimmelt und uber Stock und Stein hinweg interpretiert wird, ist der ubliche Zustand" (Schubring 1966, 5). JSBI includes this with editions of complete Dasasrutaskandha [2:216 item 'a']. ANU MICROFICHE BL1313.3.D372 H5 1936 *LD 2683 *Sri Dasasrutaskandha : mula-niryukti-curni. Bhavnagar: Vi. sam. 2011 [1954]. (Manivijayaji Gani granthamala). [JSBI 2, 216 'item i'; Tripathi 1981, 309] Dasasruta skandha sutram = Dashashrutskandhsutram / Ghasilalaji-viracitaya 'Muniharsini tikaya samalankrtam Hindigurjarabhasanuvadasahitam ; niyojakah Srikanhaiyalala. 2. avrtti. Rajkota, Saurastra: A[khila]. Bha[rat]. Sve[tambara]. Sthanakavasi Jaina Sastroddhara Samiti, Vira samvat 2486. Vikramasamvat 2016. Isvisan 1960. 44, 451 p. ; 25 cm. "Prata 1000." LD 12 863/RW Drei Chedasutras des Jaina-Kanons: Ayaradasao, Vavahara, Nisiha/bearbeitet von Walther Schubring; mit einem Beitrag von Colette Caillat. Hamburg: Cram, de Gruyter, 1966. 106 p. ; 28 p. (Alt- und Neu-Indische Studien ; 11). Contents: [Die Cheyasutta] 1-4.-Ayaradasao [mit Kommentar] 5-28.-Vavahara. [Text] 29-47.-[Ubersetzung und Kommentar: Uddesa 1-3 into French/Colette Caillat] 48-69. [Comments on 1-3/Schubring] 69-70.-Uddesa 4-10 translated into German/ Walther Schubring] 70-89. Varianten aus H. 89-91.-Nisiha [Einfuhrung und Analyse] 92-103.-Auswahl aus dem Wortschatz 104-106. Ayar Das. text based on three MSS in Berlin, variants from AyarDas. 1919; AyarDas. 1936; AyarDas. 1953-54 listed on page 28. Review Colette Caillat. JA 256 (1968) 150-54. ANU LARGE BOOK PK5003.A55 1966 Chedasuttani: Ayaradasa : padhamam Cheda suttam/sampadaka Kanhaiyalalaji 'Kamala.' Sanderava, Rajasthana: Agama Anuyoga Prakasana, Vira Nirvana samvat 2506. Vi. sam. 2034. I. san 1977. 8, 138 p. ; 14 cm. (Agama Anuyoga Prakasana ka 12. puspa). Contents: Prakasakiya [4]. Sampadakiya [5]-8.-Ayaradasa [1]-138. University of Poona Q31:2144/1516K7/218273 Navasuttani: Avassayam, Dasave aliyam, Uttarajjhayanani, Nandi, Anuogadaraim, Dasao, Kappo, Vavaharo, Nisihajjhayanam/vacana pramukha Acarya Tulasi; sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana: Jaina Visva Bharati, Vikrama samvat 2044. I[svi san]. 1987. 140, 812, 29, 320 p.: four pages of plates; 25 cm. "Original text critically edited", the Acar. on the basis of two MSS one from Laadanum, c. 17th cent., the other from "Jaisalmer collection," described on p. 24 = 81 (1st group). The Kapp. from four MSS-from Ladanum and Jaipur 16th and 17th cent.--and from the "Curni, Avacuri and Kalpa-kiranavali" (no details about MSS of these or indeed printed editions given), p. 24-25 = 82. Dasao [423]-560.-Kappo [561]-595. Forms v.5 of a complete edition of the Jaina Agama. 244 ANU NEW BOOKS COLLECTION 1 484 435 Trini chedasutrani: Dasasrutaskandha. Brhatkalpa. Vyavaharasutra : mulapatha, Hindi anuvada, vivecana, tippana yukta/samyojaka tatha adya sampadaka Misrimalaji Maharaja 'Madhukara'; anuvadaka-vivecaka-sampadaka Kanhaiyalalaji Ma[haraja]. 'Kamala.' 1. samskarana. Byavara, Rajasthana: Sri Agamaprakasana Samiti, Vira nirvana sam. 2517. Vikrama sam. 2048. 1992 I. 81, 462 p. ; 25 cm. (Jinagama-granthamala ; 32). Contents: Prakasakiya 7-8.-Sampadakiya : Cheda-sutra : samiksatmaka vivecana / Muni Kanhaiyalala 'Kamala'. [9]-34.-Prastavana: Trini Chedasutrani: eka samiksatmaka adhyayana / Upacarya Devendra Muni 35-72.-Visaya suci 73-81.-- Dasasuyakkhandho 1-124.-Brhatkalpasutra [125]-258.-Vyavaharasutra [259]-458.
Page #267
--------------------------------------------------------------------------
________________ 7.1 Ayaradasao / Dasasrutaskandha and Kalpasutra Anadhyayakala [Nandi.1966c, 7-9 se uddhrta [459]-461. Each of the three texts is given with Hindi translation. ANU NEW BOOKS COLLECTION 2 036 711 Translations: Hindi 1919 Amolaka Rsi (AyarDas. 1919) 1936 Atmarama (AyarDas. 1936) 1960 Ghasilala (AyarDas. 1960) 1992 Kanhaiyalala Kamala' (Kapp.1992) Gujarati 1960 Ghasilala (AyarDas. 1960) Indexes: 1936 (AyarDas.1936): Dasasrutaskandhasutra-sabdartha-kosa p. [1]-34. 1966 (AyarDas. 1966): Auswahl aus dem Wortschatz p. 104-106. 1987 (Avardas. 1987): combined index of: Nandi. (including JogNa. and LahuNa.) AnuOg., Utt., Dasave., Av., Dasa. (including AyarDas.), BIhKapp., Vava. and Nis.: Parisista 3. Navasuttani saddasuci (15 505 words). p. [1]-319. 245
Page #268
--------------------------------------------------------------------------
________________ Chedasutras Exegesis of Kalpasutra (Kapp.) alone (this text with cty is also known as the Barsa-sutra (see Cort 1989 Liberation and wellbeing : a study of the Svetambar Murtipujak Jains of North Gujarat. PhD dissertation, Harvard University. p. 176):2 References: BORI Cat 17:2, 79-218; JRK 74-79; JSBI 2, 226-34. Bhadrabahu, Niryukti, 68 gathas (JRK 75b). Punyavijaya (Kapp. 1952, 83-111) may have printed this in Kapp.1952 (p. 83-111). where "Kalpasutrasya Curni Niryuktigarbha" = "Dasasuyakkhamdhasuttathamajjhayanassa Nijjuttigabbha Cunni." It contains 67 verses embedded in Prakrit prose. Begins sambodho--sattamasiyam phasetta; verses begin Pajjosamanae akkharaim. Curni. (1) Punyavijaya cites a Kalpacurni (separate from the Dasasrutaskandhacurni?) which ends: tao ya arahanato chinnasamsari bhavati samsarasamtatim chettum mokkham pavatiti. Kalpacurni samapta. granthagram 5300 pratyaksaragananaya nirnitam. (sarvagranthagram 14 784) (Nandi 1966a, Prastavana, 7). (2) Punyavijaya also cites a Kalpavisesacurni ending: Kappavisesacunni samatteti. (3) The (Bhadrabahu?) Niryukti embedded in a Curni published by Punyavijaya in Kapp.1952 (p. 83-111) does not end like either of these and so is presumably a third curni. (4) Nannasuri, Curni "Is it on the BIhatkalpa?" (JRK 75b). JRK (p. 75b) also lists a Curni (700 granthas) but I am unable to link it to any of those listed already. Niryukti-Vrtti composed in sam. 1164 [1107] (JRK 75b). Malayagiri, Pilhika (JRK 75b). Vinayacandra, pupil of Ratnasimha, pupil of Municandra, Durgapadanirukta, composed in samvat 1325 [1268), 418 granthas (JRK 76a). [BORI Cat 17:2, 197-99] Jinaprabha, pupil of Jinasimha of the Kharatara Gaccha, Sandehavisa usadhi, composed in sam 1364 113071, 2268 granthas (JRK 76a). Completed in Ayodhya in samvat 1364 [1307). Jacobi assumes this author has copied from earlier commentaries in Sanskrit. Begins: dhyatva Srisrutadevim (Jacobi 1879, 25; BORI Cat 17:2, 90-94). Printed Kapp.1913. Jnanasagara Suri, Avacuri, composed samvat 1443 (1386), no MSS known (JRK 76a). Gunaratna Suri, pupil of Devasundara Suri of the Tapa Gaccha. Antarvacana, composed samvat 1457 [1400) (JRK 78b). Ramacandra Suri, of the Madahada Gaccha, Stabaka (a single MS dated samvat 1517 [1460] (JRK 79a). Udayasagara, pupil of Dharmasekhara of the Ancala Gaccha, Avacuri, 2085 granthas samvat 1551? [1494) (JRK 78a-b; BORI Cat 17:2, 192-95). Somavimala Suri, pupil of Hemavimala of the Tapa Gaccha, Stabaka, composed in samvat 1625 [1568] (JRK 79a). Dharmasagara Gani, pupil of Vijayadana Suri of the Tapa Gaccha, (or pupil of Hiravijaya Suri), Kirana vali, composed sam 1628 [1571). Begins: pranamya pranatasesam (Jacobi 1879, 26. JRK 76b). Also called Kalpavyakhyanapaddhati (BORI Cat 17:2, 102-13). Printed Kapp. 1922; 1933a. 3 A text entitled Sridasasrutaskandha-mulaniryukticurnih was published in 1954 or 1955 (see Kapp.1954 or 1955 below). I have not yet had a chance to identify which curni has been printed in it. "A sort of indirect commentary narrating the legends suggested in the text and explaining the ritual connected with the reading of the Kalpasutra" (JRK 78b). 246
Page #269
--------------------------------------------------------------------------
________________ 7.1 Ayaradasao / Dasasrutaskandha and Kalpasutra Amarakirti, Avacuri, composed samvat 1644 [1587] (JRK 76b). 13.1 Nagarsi Gani, Kalpantaravacya, samvat 1657 [1600). Vijaya Pradyumna Suri has published an edition of this in the late 1990s (?) (Ahmedabad: Sharadaben Chimanbhai Educational Research Centre), 122 p. (email, J. B. Shah 29.7.00). Subhavijaya, pupil of Hiravijaya Suri, Tapa Gaccha, Kalpalata, composed in samvat 1671 [1614), it was corrected by Kirtivimala (JRK 76b). Sanghavijaya Gani. pupil of Vijayasena Suri, Pradipika, 3 200 granthas, composed in samvat 1674 [1617), during the reign of Vijayadeva Suri of the Tapa Gaccha. It was again examined by Dhanavijaya Gani, pupil of Kalyanavijaya, in 1680 [1623] (JRK 760-77a; BORI Cat 17:2, 113-17). Printed Kapp.1935a. Jayavijaya Gani, pupil of Vimalaharsa, pupil of Vijayadana Suri, of the Tapa Gaccha, during the reign of Vijayananda Suri, Dipika, composed in samvat 1677 [1620). The first copy was prepared by Vyddhivijaya Gani (JRK 77a; BORI Cat 17:2, 117-21). Sahajakirti and Srisara, pupils of Hemanandana Gani, of the Kharatara Gaccha, Manjari composed samvat 1685 [1628), 3 432 granthas (JRK 77a; BORI Cat 17:2, 122-27). Vinayavijaya, pupil of Kirtivijaya Gani of the Tapa Gaccha, Subodhika, 5 400 granthas, composed samvat 1696 [1639). Composed at the request of Srivijaya, pupil of Ramavija and corrected by Bhavavijaya (JRK 77b; BORI Cat 17:2, 139-52). Jacobi dates it to samvat 1616 [1559) (Jacobi 1879, 26) while Winternitz gives the date as 1649 (1933:2, 593). This is the version recited nowadays at Paryusan (Folkert 1993, 193). Printed Kapp.1911; Kapp. 1915; Kapp.1918; Kapp.1923. Perhaps Kapp.1939a? Ajitadeva Suri, of the Pallivala Gaccha, Dipika, composed samvat 1698 [1641] (JRK 77a). Samayasundara, pupil of Sakalacandra Upadhyaya of the Kharatara Gaccha, Kalpalata, 7 700 granthas. Composed during the reign of Jinaraja Suri of the Kharatara Gaccha who died samvat 1699 [1642] (JRK 77a). Samayasundara states that his own guru, lived in the time of Akbar (Jacobi 1879, 26; BORI Cat 17:2, 127-39). The Dictionary of Prakrit proper names / Mohanlal Mehta, 1970-72 (v. 1 p. 7) cites an edition of this cty published by Bombay and Surat : Jinadattasur Jnanabhandar, 1939. Santisagara, pupil of Srutasagara, pupil of Dharmasagara of the Tapa Gaccha, Kaumudi, 3 707 granthas, composed samvat 1707 [1650] (JRK 77b; BORI Cat 17:2, 152-58). Printed Kapp.1936a. Budhavijaya, pupil of Santivijaya, pupil of Devavijaya of the Tapa Gaccha, Balavabodha, composed samvat 1707 (1650) (JRK 77b). Ksamavijaya, (Ksemavijaya?), Balavabodha, composed in samvat 1707 [1650] (JRK 79b). Meruvijaya, Balavabodha, samvat 1707 [1650] (JRK 79b). Khimavijaya Gani, Balavabodha, samvat 1707 [1650). Printed Kapp.1959. Translation according to this cty in Kapp.1924-25; 1973 Danavijaya, pupil of Suravijaya, pupil of Kirtivijaya Gani of the Tapa Gaccha, during the reign of Vijayaraja Suri, Danadipika (also called Jnanadipika), composed samvat 1722 [1665] (JRK 77b; BORI Cat 17:2, 158-63). Next entry in JRK gives date samvat 1750 (1693] for a work of the same name by an author of the same name and Gaccha. Vidyavilasa Gani, pupil of Kamalaharsa of the Kharatara Gaccha, Stabaka, composed samvat 1729 [1672] (JRK 79b). Sukhasagara, Balavabodha, composed samvat 1733 [1676] (JRK 79b). Mangalikamala (bhasya-tika, ie. in Hindi) composed samvat 1763 [1706] (JRK 796). 247
Page #270
--------------------------------------------------------------------------
________________ Chedasutras 30 Nyayasa gara, pupil of Uttamasagara of the Tapa Gaccha, Kalpabodhini, composed samvat 1788 [1731] (JRK 78a). Printed Kapp.1942? Laksmivallabha Gani, pupil of Laksmikirti of the Kharatara Gaccha, during the reign of Jinasaubhagya Suri, successor of Jinaharsa, successor of Jinacandra, successor of Jinakusala. Jinasaubhagya became Suri in samvat 1892 [1835). Kalpadrumakalika, 4109 granthas (JRK 78a; BORI Cat 17:2, 163-76). Printed Kapp.1918a; 1918b; 1918c; 1933c; 1947 or 1948. Vijayarajendra Suri (1826-1900), of the Tristutika Gaccha, (1) In samvat 1944 [1887] composed a Kalpasutra Balavabodha. (no details, Srimad Rajendrasuri smaraka-grantha, 1957, 487). In samvat 1954(1897) he composed a Kalpasutrarthabodhini (JRK 78a; Srimad Rajendrasuri smaraka-grantha, 1957, 89, 488). *Srikalpasutrarthaprabodhinih. Khurala, Rujasthana : Sri Rajendra Pravacana Karyalaya. 391 p.: "super-Royal 8". [Srimad Rajendrasuri smaraka-grantha, 1957, 89] *Sri Kalpasutrabalavabodha. 478 p. "super-Royal 8". [Srimad Rajendrasuri smarakagrantha, 1957, 90]. Price Rs4. Undated commentaries Antarvacanikamnaya, composed during the reign of Jinasagara Suri, successor of Jinasimha Suri of the Kharatara Gaccha, 3066 granthas (JRK 79a). 33 Antarvacya (JRK 79a). Bhaktilabha, pupil of Ratnacandra, Antarvacya (JRK 79a). Gunavijaya Gani, pupil of Kamalavijaya, pupil of Amaravijaya, pupil of Subhavimala Gani of the Laksmibhadrasakha of the Tapa Gaccha, Kalpalata (JRK 78a). Jayasagara Suri, Ancala Gaccha, Sukhavabodhavivarana (Sanskrit) (JRK 76b). Jayasundara Suri, Antarvacya (JRK 79a). Jinahamsa, Antarvacana (JRK 79a). Jinasimha Suri, Panjika, 3500 granthas (JRK 76a). Kalpalataviveka (JRK 78b). Kulamandana Sari, Antarvacana (JRK 78b). Laghu-tika, 1000 granthas (JRK 78b). Mahimeru Upadhyaya, Avacuri, 700 granthas (JRK 78b). Manikyasekhara Suri, Niryukti-Avacuri (JRK 78a). Merutunga Suri, Vrtti 2 229 granthas (JRK 78b). Nandalala, Paryusanastahnikavyakhyana (BORI Cat 17:2, 216-218). Nayavijaya, Kalpoddyota (JRK 78b). Niruktanirukti, 790 granthas (JRK 78b). Parsvacandra Suri, Stabaka (JRK 79a). Prthvicandra, pupil of Devasena, pupil of Yasobhadra, Tippanaka, 640 granthas (JRK 75b76a) [BORI Cat 17:2, 195-97] Printed Kapp.1952. Ratnasekhara, Antarvacana (JRK 79a). Sarksepavyakhya (JRK 78b). 248
Page #271
--------------------------------------------------------------------------
________________ 7.1 Ayaradasao / Dasasrutaskandha and Kalpasutra Somasundara Suri, Antarvacya, 1 800 granthas (JRK 79a). Tika or Avacuri (JRK 78b). Vijayatilaka, Kalapradipika, gram. 4500 (Jacobi 1879, 26). Yasovijaya, Sakhabadha, mentioned by Stevenson (Kapp.Translation English.1848, p. ix; Jacobi 1879, 26). Editions of the Kalpasutra (Kapp.) alone: 1875 *Kalpasutra with cty of Laksmivallabha / Belaj Sivaj, 1875. [An Illustrated AMg. dictionary 1923-38:1 n. 13, although it could be in fact an edition of the whole Ayaradasaol. 1879 Jinacaritra in The Kalpasutra of Bhadrabahu edited with an introduction, notes and a PrakritSamskrit glossary / by Hermann Jacobi. Leipzig : F. A. Brockhaus, 1879. viii, 173 p. ; 21 cm. (Abhandlungen fur die Kunde des Morgenlandes; 7,1). Sources: (1-3 from Jacobi's personal collection): (1) MS A., dated Vikrama 1484 [1427).- (2) B. dated samvat 1521, Asvina su. di. 11, Tuesday (=Tuesday, 11 September 1464).--(3) C. dated samvat 1761 [1704).--(4) Berlin MSS.or.fol.647 (undated),--(5) an undated, but modern, MS in the India Office Library, no. 1599.-(6) "a modern MS. in the Bombay collection" (Sources described, Introduction p. 28-29). Contents: Preface vii-viii.-Introduction 1-30.-Kalpasutra (Jinacaritra, Sthaviravali, Samacari) 33-96.-Notes (chiefly extracts from the commentaries] 97-126.-Glossary Sanskrit equivalents used by the commentaries for the Prakrit original] 127-73.Additions and corrections [175-76). Reprints. Nendeln, Liechtenstein: Kraus, 1966; 1980 (CCDPL 1, iii) Review. H. Oldenberg *ZDMG 34, 748-757. ANU PJ5.D5 B4.7, Nr.1 *Kalpasutra / Bhadrabahu. Calcutta, 1887. [Guerinot 1906 $243) 1887 1894 1911 *Kalpasutrah: trtiya chedasutrantargata dasasrutaskandhasya astamadhyayanam/Srimadbhadrabahusvami viracitam. Kalikata : Sriraya Dhanapatisimha Bahadura, 1894. 148 p.; 10 x 30 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 36). Univ. of Chicago Library catalogue] *Upadhyayasrimadvinayavijayagaoiviracita Kalpasutravrttih Subodhikabhidhana [/edited by Sagarananda). Suryapura : Gopipura Jaina Printing Works, 1911. 2, [2], 600 p. ; 1 plate ; 13 x 28 cm. (Sresthi-Devacandra-Lalabhai-Jaina-pustakoddhara ; no. 7). [Emeneau $3943. CLIO 2, 1232; DLJP list) Reprint or re-edition Kapp.1923 [DLJP list). Also samvat 1995 [1938]? [Alpaparicitasaiddhantikasabdakosah 1954-79:39] 1913 *[Kalpasutra with Jinaprabha's Sandehavisa usadhi. Jamnagara : Hiralal Hamsaraj, 1913. [JRK 746] 1914a * Dasa-sruta-skandhe Paryusana-Kalpakhyam Bhadrabahu-Svami-viracitam Kalpa-sutram, Yuga-pradhana-Kalikacarya-katha-samyuktam [ / edited by Sagarananda). Bombay : Nirnaya-sagara Press, 1914.2, 1,68, [1], 5, [1], p. ; 1 plate: 12 x 26 cm. (Sresthi-DevacandraLalabhar-Jaina-pustakoddhara ; no. 18). [CLIO 2, 1231; DLJP list Second edition Kapp.1933a. *Kalpa-sutra : Praksta mula sutrano Samskrta sabda ane Gujarati bhasantara sahita/HariSankara Kalidasa. Bombay : Nirnaya-sa gara Press, 1971 [1914). 2, 250 p. ; 19 x 27 cm. [Unclear whether this is the Kapp. or the Brh Kapp. CLIO 2, 1231] 1914b 1915 *Srimadvinaya vijaya ganiviracita ya Subodhikabhidhaya vrttya samalankstam Srikalpasutram. Bhavnagar : Sri Jaina Atmananda Sabha, 1915. [1], 6, 303, [1], p. ; 1 plate; 14 x 28 cm. (Atmananda-Jaina-grantha-ratna-mala , no. 31). [Emeneau $3944; CLIO 2, 1232] 1916 *[Kalpasutra with Manika Muni's Hindi translation. Ajamera: Sobhagamala Harakavata, Vi. sam. 1973 [1916). [JSBI 2, 217 item 'e'l 249
Page #272
--------------------------------------------------------------------------
________________ Chedasutras 1918a 1918 *[Text with Vinayavijaya's Subodhika, and Laksmivallabha's Kalpadrumakalika). Bhavnagar : Jaina Atmananda Sabha, samvat 1975 [1918). [JRK 74b] *Sri-Kalpasutram : Arya-Sri-Bhadrabahu-Svami-samuddhrtam : Sri-Laksmi-vallabhopadhyaya-viracita-Kalpa-druma-Kalikakhya-vyakhyaya vibhusitam. Bombay : Nirnayasagara Press, 1918.2, 286 [ie. 4, 572] p. ; 11 x 26 cm. [CLIO 2, 1232] Mandavi, Bombay : Velji Shivji, 1918. (JRK 74b) Introduction and edition by Muni Manisagara. [BORI Cat 17:2, 168] 1918c * [Kalpasutra with Kalpalastja cty. of Laksmivallabha. Bombay : Velaji Sivaji Company, 1918] [Nagraj 1986, 410 n. 28; An Illustrated AMg dictionary 1923-38:1, xxxiii, n.13 gives publication dates as 1875, should be Vikram 1975] 1922 Srimadsagaraganiviracitakirana valivritya yuktam Sribhadra bahusvamipranitam Srikalpasutram. Bhavanagarastha : Sriatmanandasabha, Virasamvat 2448. Atmasamvat 26. Vikramasamvat 1978. San 1922. 6, 203 p. ; 13 x 28 cm. (Sriatmananda Jaina grantha ratna mala ; no. 71). Contents: Prastavana / Muni Ramavijayah 1a-7a.-Kalpasutram (1a)-[204a] BORI 38 187 X.B. 1923 * Srutakevalisribhadrabahupranitam Srikalpasutram (dasasruta-skandhastamadhyayanam) Srivinayavijayopadhyayaviracitasubodhikakhyavrtti-yutam / edited by Sagaranandal. Bombay : Nirnaya-sagara Press, 1923. [12], 7, [2], 195 [ie.14 and 390], [2] p. ; 12 x 27 cm. (Sresthi-Devacandra-Lalabhai-Jaina-pustakoddhara ; no. 61). [Emeneau $3945; CLIO 2, 1232) Pagination description differs: CLIO's version is given above, Emeneau's is: 8, 186 folios. Re-edition or reprint of Kapp.1911. 1924-25 *Sri Kalpa-sutra : Srimad-Bhadrabahu-Svami-viracita: (Gujarati-)bhasantara sahita, Sri Khimatrijayaji Gani krta Balavabodha anusare bhasantara. Bombay, Kathiawar : Nirnayasagara Press, 1924-25. 2 v. ; 12 x 27 cm. (CLIO 2, 1231] Part I: [2), 229 sie. 458], [2] p.-Part II: [i], 230-1-370, 2, 1 folios (the description is unclear). 1933a Sridasasrutaskandhantargatam Sriparyusanakalpakhyam Sribhadrabahusvamiviracitam Sri kalpasutram : anekasundaratara vividhavarnakacitrakalitam : yugapradanakalikacaryakathadvayasamyuktam/samsodhakah Srivijayameghasurivipadah. Rajanagare : Sriagamodayasamiti, Virasamvat 2459. Vikramasamvat 1989. Kraistasya san 1933.91 [ie. 182] p.; 15 x 29 cm. (Sresthi-Devacandra-Lalabhai-Jainapustakoddhare ; granthankah 82). Contents: Srikalpa (barasa)sutragatacitranam anukramanika [la-2b).--Samarpanapatram 4a-5b). Srikalpasutrasya prathamasamskaranasyopodghatah (6a-6b).-Kincit nivedana [Gujarati] 7a-7b.-Plate of Anandasagara-[Preface to the first edition Kapp.1914a]] 8a-9a. Text with colour illustrations la-89b.-[Kalakasurikatha] 90a[92b). "Prati 2000." Includes: Vinayavijaya, 17th cent. Subodhika.- Dharmasagaragani, 16th cent. Kalpakiranavali. Kalikacarya. Kalakacaryakatha. [LC catalogue] BORI 38 174 1933b *Kalpasutra Prabodhini / Vijaya Rajendra suri. Khudala, Phalana : Rajendra Pravacana Karyalaya, 1933. [Devendra Muni 1977,721 item 25] 1933c *[Kalpasutra with Laksmivallabha's Kalpadrumakavytti and Hindi translation (bhavartha)] Kota: Chabada's Jaina Svetambara Sangha, 1933. [Nagraj 1986, 740n27; JSBI 2, 217 item 'o'] 1935a *[With Sanghavijaya's Vrtti.] Ahamadabada : Vadilala Cakubhai, san 1935. [JSBI 2, 217 item 'ah') 250
Page #273
--------------------------------------------------------------------------
________________ 7.1 Ayaradasao / Dasasrutaskandha and Kalpasutra 1935b *Kalpasitra kalyapradipika. Ahmadabada, 1935. (Mukti Vimala Jaina granthamala) [Devendra Muni 1977, 721 item 17] 1936 Yugapradhanasrutakevalibhagavacchribhadrabahusvamisutritam Srisantisagarakalpitakalpakaumudyakhyavivaranasamvalitam Srikalpasutram. Prathamasamskarane. Ratnapuriya (Ratlam] : Srirsabhadevaji Kesarimalaji namni Svetambarasamstha, Vira samvat 2462 ; Vikrama samvat 1992 ; Kraista san 1936.4, 240 p. ; 12 x 27 cm. Contents: Srikalpaka umudya upakramah Sanskrit / Anandasa gara 1-4.Srikalpasutram 1-240 [p. 1. ksane 1-28.-2. ksane 29-53.-3. ksane 54-75.-4. ksane 76-95.-5. ksane 96-119.6. ksane 120-156.-7. ksane 157-189.-8. ksane 190-208.9. ksane 209-38.-Prasastih 239-40). "Pratayah 500." ANU BL1313.3.K366736 1936 1938 Reprint of Kapp.1911? [Alpa. 1954-79:3,9) 1939a *[With Vijayavijaya's Vrtti = Vinayavijaya?]. Jamanagara : Hiralala Hamsaraja Jaina, 1939. [JSBI 2, 218 item 'kha'] 1939b *[Kalpasutra Kalpalata, with Samayasundara Gani's Kalikacarya katha). Bombay : Jinadattasuri Pracina Pustakoddhara, 1939. 4, 196 p. [Devendra Muni 1977, 721 item 21) Review by A. N. Upadhye Oriental literary digest (Pune) 3 (1940) 140-41. [Bibliography of the works of Dr. A. N. Upadhye. Sholapur : Jaina Samskrit Samrakshaka Sangha, 1977. p. 56 item 41] 1941 1942a 1942b *[Kalpasutra with illustrations / Sarabhat Manilala Navaba) Ahamadabada : Jaina Pracina Sahityoddhara, san 1941. (JSBI 2, 217 item 'i'; Nagraj 1986 740 n.25, 741 n.35] *[Mula / Maphatalala Jhaveracandra). Vi. sam. 1999 (1942). [JSBI 2, 217 item 'u] *[Kalpa-sutra : Kalparthabodhini [of Nyayasagara?] / edited by Gani Buddhisagara. Bombay : Jinadatta suri Jnana Bhandara, 1942. [Nagraj 1986, 410 n.29) 1942-51 Sramana Bhagavan Mahavira. Ahmedabad : Sri Jaina Siddhanta Society, Vira samvat 2468-77. Vikrama samvat 1998-2007. 1942-51.5 v. in 8 ; 25 cm. (Commemoration volume ; 1-8). "[A]n effort to supply the English-knowing public with an accurate, comprehensive, and authentic account of the twenty-six previous bha vas (existences) and the twenty-seventh bhava of Sramana Bhagavan Mahavira" (Foreword v.1, pt. 1, p. 21). Sources for the extracts printed and translated are not given. First edition in 4 v. 1941-42 (v.1. pt. 1. Preface to second edition). Contents v. 2, pt. 1-2: Life [of Mahavira, containing 116 sutras of the Kalpasutra with English translation, and additional materiall. Vira samvat 2468-77. Vikrama samvat 1998-2007. 1942-51. 12, 19, 284 p.-pt. 28, 792, 31 p. v.5, p. 1:Ahmedabad: Sri Jaina Grantha Prakasaka Sabha, Virasamat 2474. Vikrama samvat 2004. 1948. Contents: Introduction (5)-7.-Sthaviravali [text and English translation] [1]-332.Chronology [333]-336.-Appendix no. VI. Yuga-pradhana [337]-347.-Index [348]356.-[Advertising 32 p.) The sources are listed (Introduction p.6) but not clearly identified. Cover-title: "Sramana Bhagavan Mahavira : v.5., p.1., Sthaviravali." ANU BL1371.V5 1947 or 1948 Srikalpasutram : Laksmivallabhopadhyayaviracita-Kalpadrumakalikakhyavyakhya samalarkstam. Surata : Srijinadattasuri Jnanabhandara, Sam. 2004 (1947); VI. sam. 2474 [1948]. 202 [ie. 404) p. ; 12 x 27 cm. (Sri Jinadattasuri Pracinapustakoddhara Phanda (Surata); granthanka 57). Lining of both covers "Setha Devacanda Lalabhai-Jaina Pustakoddhara Phanda, samvat 1976 (1919). [He?ljari bajara, Mumbai. Branca Gopipura, Surata. ...." ANU BL1313.3.K366434 1948 251
Page #274
--------------------------------------------------------------------------
________________ Chedasutras 1948 1952a 1952b *[Kalpasutr with Muni Pyaracandra's Hindi translation. Ratalama : Jainoddhaya Pustaka Prakasana samitia, Vi. sam. 2005 (1948). (JSBI 2, 217 item 'u'] Sridasasrutaskandhasutram : Muniharsini 'tikasamalankrtam Hindi-Gurjarabhasasahitam ca /tikaracayita Ghasilalaji ; niyojakah Gabbulala, Samiramalla, Kanhaiyalala. Rajakota, Saurastra : Sri Sve(tambara). Stha[nakavasi). Jainasastroddharasamitih, Vira samvat 2478. Vikrama samvat 2008. Isvi san 1952. 20, 514 p. (4 leaves of plates) ; 25 cm. Suddhipatram p. (17-20 (1st group) Prati 500." (Pages 512-513 damaged, half missing.) ANU BL1313.3.D374 G8 1952 Reprint 1959. [R. N. Bhattacharya booklist April 1997] Kalpasutra : mala patha, Curni, Niryukti tatha Sri Prthvicandrasuriksta tippana, pathantara Gujarati bhashantara tatha bhasantaramam adhara sabdono kosa / sampadaka Punyavijayaji ; Gujarati bhasantara tatha adhara sabdhono kosa Becaradasa Jivaraja Dosi. Amadavada: Sarabhai Manilala Navaba, Vi. sam. 2008. I, sa. 1952. 16, [116), 27,89 p. ; 27 cm. (Sri Jaina Kala-sahitya samsodhaka karyalaya sirija ; nam 5). Contents: Prastavika [Gujarati] / Muni Punya vijaya (1)-16.-Kappasuttam: Dasasuyakkhandhasutassa atthamam ajjhayanam (with variant readings]. 1-82.Kalpasutrasya Curni Niryuktigarbha tatha Plthvicandrasuriprasitam Tippanakam. (with variants (82)-111.-Kalpacurnyantargatanam visistartharpakanam sabdanam suci. [113]-114.-Kalpasutracurnyah suddhipatram. [115].-Kalpasutratippanakasya suddhipatram [116].-Kalpasutratippanakam [1]-23.-Kalpatippanakantargatanam visistartharpakanam sabdanam suci (24)-27.-Kalpasutra (Gujarati translation] [1]81.-Anuvadamam vaparayela paribhasika sabdono (82)-89. Notes: Edition based on eight MSS, described on pages [1] (1st group), six(?) on palmleaf, one dated samvat 1247 [1190).... [11] list of readings accepted by the Curni writer. [14] language of the Niryukti and Curni. Prastavika reprinted in Jnananjali : Pujya Muni Punyavijayaji abhinandana grantha. Badodara : Sagara Gaccha Jaina Upasraya, 1968, p. 110-21. ANU PK5003.A55K3 1952 1952c *[Kalpasutra) / Basanta Kumara Chattopadhyaya. Calcutta : University of Calcutta, 1952 (or perhaps 1954). Text and Bengali translation. [Personal communication S. R. Banerjee, January 1997] Based on Jacobi's edition. 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie ; (sutthuruvena) Pupphabhikkhuna sampadio. 1. avstti. Gudagamva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354. 2 v. ; 19 cm. Dasasuyakkhandho v.2: [918]-946--1. parisittham Kappasuttam [1]-42. ANU BL1310.58 1954 2 v. 1954 or 1955 Sridasasrutaskandha-mulaniryukticurnih. Bhavanagara : Srimanivijayajiganigrantha mala, Vi. sam. 2011 (1954). Vira samvat 2481 [1955).92 [ie. 1841 p. ; 12 x 27 cm. (Vijayaji Ganivara granthamala ; 14). Contents: Prastavana / Campakasagara 1b-21a.-Life of Manivijaya) 216-22a.Sridasasrutaskandhamulaniryukticurnih la-92b. "Pratayah 500." [Exactly what this publication contains is not clear to me, further study is needed.] LD 6141 1959 Caturdasapurvadhara Sribhadrabahusvamiprasitam pavitra Srikalpasutram Khimasahi : Guriarabhasatika (Gujarati Balavabodha) yuktam. Ahammadabada : Sri Jainasahityavardhakasabha, Vi.ni. samvat 2486. Vikrama samvat 2016 (1959). 12,588 p. ; 13 x 25 cm. (Srivrddhi-Nemi-Amsta-granthamala-granthankah 38). 252
Page #275
--------------------------------------------------------------------------
________________ 7.1 Ayaradasao / Dasasrutaskandha and Kalpasutra 1968 Contents: Prakasakiya 3-6.-[List of donors) 7-12.-Srikalpasutram 1-588. Cover title: Pavitra Srikalpasutra-Khimasahi. "Pandita-Srikhimavijayaganikrta-Gurjara-Balavabodhasamalankstam" final page. Prasasti gives samvat 1707 [1650) as date of Balavabodha (p. 587). ANU BL1313.3.K364 G9 1959 Kalpasutra : Srutakevali Bhadrabahu racita / sampadaka aura vivecaka Devendra Muni. Sivana, Badamera-Rajasthana : Sri Amara Jaina Agama Sodha Samsthana, 1968. 34, 360, 74 p. ; 25 cm. Contents: Prakasakiya-prakasa 7).-Information about donors [8]-12.-Prastavana / Devendra Muni 13-32. Tikaci listed [16-1811-Kalpasutra ka anukrama (33-34.Sri Kalpa sutra upakrama [1]-16.-Sirikappasuttam: mula, artha, vivecana [17]-360.Parisista 1. Upakramantargata tippanani. [31-10.-2. Artha, vivecanantargata tippanani [11]-40.-3. Purva paramparantargata tippanani [41]-48.-4. Sthaviravalyantargata tippanani [49)-53.-5. Samavaryantargata tippanani (54)-58.--6. Vadya, sangita paricaya [59]-63.-7. Kalpasutra ka sanksipta paribhasika sabda-kosa [64]-69.-Kalpasutra vivecana mem prayukta granthasuci [70]-71. Kalpasutra ka suddhi patra [72] 74. ANU PK5003.A55K3 1968 1970-73 Kalpasutram : Ghasilalaji Maharaja viracita sasabdartham : Kalpasutram tatha ca Madanalalaji Maharajena sangrhitasamanyadi sravakadharmasangrahas ca (2. bhaga - samanyatatvadi Mahavirantatirtharkaracaritrasangrahas ca). 1. avstti. Rajakota : A[khila). Bhasrata). Sve(tambara). Stha[nakavasi). Jainasastroddharasamiti, Virasamvat 2496-99; Vikramasamvat 2026-29 ; Isvisan 1970-73.2 v. ; 12 x 24 cm. Contents 1. bhagah: Pujya Tapasviji Maharaja Saheba ka sanksipta paricaya (3). Samanya Grhastha dharma sangraha ki visayanukramanika [4-5).-Sasabdartha Kalpasutra ki visayanukramanika (6-10).-Prastavana / Sastroddhara Samiti 1-2Samanya garadharmavarnanam 3-184.-Kappasuttam [1]-372.- Sri Grhasthadharmasangraha ka suddhipatra [1-8). Contents 2. bhagah: Pujya Tapasviji Maharaja Saheba ka sanksipta paricaya (1-2).Sasabdartha Kalpasutra ki visayanukramanika (3-8]--Kalpasutram : Tirthankarabhisekasya adhikarah. 1-896. "Prati 1000." Prathamo bhagah. (10), 184, 372, [8] P.-Dvitiyo bhagah. [8], 896 p. Tapasviji Muni died 1. Vaisakha sudi 4 Manglavara samvat 2028 [1971?] 2, [2] (1st group) ANU BL1313.3.K366542 1970 v.1, v. 2 1973 Kalpasutra bhasantara : Gurjara bhasa tika Balabodha / Bhadrabahusvamipranita ; bhasantarakara Pam. Khimavijayaji Gani Balabodhodhanusare Pam. Amftalala Amaracanda. Amadavada : Jaina Prakasana Mandira, Vira sam. 2499. Vi. sam. 2029. I. sa. 1973. 2, 330 [ie. 4, 660] p. ; 13 x 25 cm. Includes Pkt. text. ANU NBC 2 118 374 1976 Sri Kalpasutram (Barasa-sutram). 1976. 134 p. (Sri Harsapuspamsta Jaina granthamala ; 73). Reprint 1993. 1977a Kalpasutra : Sribhadrabahusvamiviracita : vividha-varnaka-pracina citrakalita evam HindiAngalabhasanuvada sahita / sampadaka va Hindi-anuvadaka Vinayasagara ; Angalabhasanuvadaka Mukunda Latha ; citra-paricaya Candramanisimha. Jayapura : Prakrtabharati, Vira samvat 2503 ; Isvi san 1977; Vikrama samvat 2034 ; Saka samvat 1988. 1. samskarana. [6], xxiv, 374, xxxii p. 36 colour plates tipped in throughout the book : 15 x 27 cm. (Praksta-Bharati ; granthanka 1). Contents: Visaya-suci (1)--Citra-suci [2]-Amukha [3] = Foreword [41.-Prakasakiya [5] = Publisher's note [6).-Bhumika / Vinayasagara i-xx. = Introduction xxi-xxxi.English translator's note / Mukund Lath xxxi-xxxiv.-Kappasuttam 1-374.-Citraparicaya / Candramani Simha i-x.-Paintings of [the] Kalpasutra / Chandramani Singh 253
Page #276
--------------------------------------------------------------------------
________________ Chedasutras xi-xx.-Kathina paribhasika sabdavali xxi-xxx.-A Select glossary xxxi-xxxiii. *This edition of the Kalpasutra is based mainly upon a single illustrated manuscript in the library of the Rajasthan Oriental Research Institute, Jodhpur (no. 5354). The readings have, however, been collated with the help of two published editions (1952b (cited here as 1954) and 1914a)" (p. xxix). The MSS is dated Vikrama 1563 and is described on p. xxix-xx. "This edition relies essentially on a single manuscript, thus variant readings have not been noted. For these, the reader is referred to Muni Punyavijaya's edition [1952b)" (p. xxxi). **Prathama samskarana 1000." 2. ed. 1984. ANU PK5003.A55K3 1977 1977b Chedasuttani : Ayaradasa: padhama Chedasuttam/ sampadaka evam vyakhyakara Muni Sri Kanhaiyalalaji Kamala.' Sanderava, Rajasthana : Agama Anuyoga Prakasana, Vira Nirvana samvat 2503. Vi. sam. 2033. I. san 1977. (Agama Anuyoga prakasana ka 11-vam puspa). Contents: Prakasakiya (5).-Sampadakiya (61-8.-Acaradasa : eka anusilana / Vijaya Muni Sastri' 19-14.-Anukramanika (15)-16.-Chedasuttani : Ayaradasa [1]-187. Translation has been based on commentaries. Prakrit with Hindi translation and annotations (Shanta 1985, 569). BORI 1979 Kalpa sutra of Bhadrabahu Svami/ [text, translation and notes by Kastur Chand Lalwani. Delhi : Motilal Banarsidass, 1979. xix, 207 p. ; 7 leaves of plates, some colour ; 22 cm. Contents: Foreword /K. C. Lalwani. [ix]-xix.- [Kalpa sutra : text and translation], 1183.-Appendix : Alternative reading on sutras 33-46. [185)-187.-Notes and comments [189]-201.-Index [of proper nouns) [203]-207. Reprinted ANU PK5003.A55K33 1979 *Kalpasutram : Barasasutram : sacitram. Surat : Sri Barasasutra Prakasan Samiti, 1980. [Cort 1989, 516] 1980 1982 Sri Dasasrutaskandhantargatam Sri Paryusanakalpakhyam Sri Bhadrabahusvami viracitam suvarnaksariya Srikalpasutram (Barasasutram) sacitram / preraka, sampadaka Vijayaramasurisvaraji. Ahamadabada : Jaina Tatvajnanasala, [1982]. 26, 139 [ie. 278), 32 p.; col. ill. ; 14 x 28 cm. (Acaryasrivijaya Ramasurisvaraji granthamala granthanka 15). Colour reproduction of a modern illustrated MSS of the Kalpasutra, completed Vi. sam. 2025 [1968] (Prakasakiya nivedana, p. 7). Publication date from Avasarani apurvata : Prakasakiya nivedana p. 9. Last 32 pages give a list of donors. Portraits are given of: Surendra Suri, p. 3 (1st group); repeated p. 1a (2nd group) Dharmavijayaji, p. 5. Ramasurisvaraji (b. Vi. sam. 1973 (1916) p. 15 (1st group); repeated p. 1a (2nd group) ANU BL1313.3.K36 1982 1984 Reprint of Kapp.1977a. Vira samvat 2510; Isvi san 1984 ; Vikrama samvat 2041 ; Saka samvat 1906. Only a short "Preface to the second edition' added, facing p. i. ANU LARGE BOOK BL1313.3.K36 1984 1987 Navasuttani: Avassayam, Dasavealiyam, Uttarajjhayanani, Nandi, Anuogadaraim, Dasao, Kappo, Vavaharo, Nisihajjhayanam / vacana pramukha Acarya Tulast ; sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2044. I svi san). 1987. 140,812, 29, 320 p.: four pages of plates ; 25 cm. "Original text critically edited", the Kapp. from four MSS-from Ladanum and Jaipur 16th and 17th cent.--and from the "Curni, Avacuri and Kalpa-kiranavali" (no details about MSS of these or indeed printed editions given), p. 24-25 = 82. Pajjosavanakappo [ = Kapp.) [492)-560. Forms v.5 of a complete edition of the Jaina Agama. ANU NEW BOOKS COLLECTION 1 484 435 254
Page #277
--------------------------------------------------------------------------
________________ 7.1 Ayaradasao / Dasasrutaskandha and Kalpasutra 1993 *Sri Kalpasutram : Barasa-sutram : sacitram / Bhadrabahusvami-viracitam Sri Paryusanakalpakhyam ; sampadakah samsodhakas ca Vijayajinendra Surisvarah. Lakhabavala, Santipuri, Saurastra : Sri Harsapuspamsta Jaina granthamala, 1993. 8, 117 p.:41 p. of plates : col. ill. ; 15 x 30 cm. (Sri Harsapuspamrta Jaina granthamala, granthankah 73). [DKS-4848. DK Agencies Recent Sanskrit, Prakrit and Pali publications Ref. No. CIR 1378/1994-95, item 173, CIR-1503/95-96 item 41) Reprint of Kapp.1976. Translations: Bengalr 1952 B. K. Chattopadhyaya (Kapp.1952c) English 1848 The Kalpa-Sutra and Nava Tatva: two works illustrative of the Jain religion and philosophy : translated from the Magadhi : with an appendix containing remarks on the language of the original/ by the Rev. J. Stevenson. London: Oriental Translation Fund of Great Britain and Ireland, 1848. xxviii, 144 p. ; 22 cm. [Emeneau 83942] Contents: Translator's preface [vii]-xxviii.-Kalpa sutra [1]-114.-Nava tatva sutra ; or, the nine principles of things 115-29.-Appendix containing remarks on the Magadhi language [131]-144. University of Poona CASS Library Q31:2145 / 111A/7380 *This work, which for a long time has been almost the only, and the standard, publication on Jainism, is, I regret to say it, neither accurate nor trustworthy. In the first instance, it is not what it pretends to be, a translation of the text, but, for the greater part, a carelessly made abstract. The first part has, on the whole, been rendered more faithfully than the more difficult Samacari portion." In the former part when it is hard Stevenson paraphrases instead of translating, in the Samacaris large portions have been left out, or given in condensed form, the meaning has rarely been made out in full (Jacobi, Kapp.1879, 27) "A very faulty translation " (Winternitz 1933:2, 462 n.1). Reprint. Varanasi : Bharat Bharati, 1972. 22 cm. [Folkert 1993, 414] 1884 Gaina Sutras : translated from Prakrit / by Hermann Jacobi. Part I: The Akaranga Sutra. The Kalpa Sutra. Oxford: Clarendon Press, 1884. liii, 324 p. (Sacred Books of the East; 22). Contents: Introduction [ix]. -liii.-Akaranga Sutra [1]-213.-The Kalpa Sutra of Bhadrabahu [215]-311.-Index (313)-320. Reprint. 2. ed. Delhi : Motilal Banarsidass, 1964, 1968 etc. 22 cm. 3rd. ed. New York: Dover, 1968. ANU BL1010.53 v.22 1942-51 Dhirubhai P. Thaker (Kapp.1942-51) v.1, and v. 5. 1977 Mukund Lath (Kapp.1977a [ =1984]) 1979 Kastur Chand Lalwani (Kapp.1979) Gujarati 1888 1914 *Kalpasutrasya Balavabodha. Bombay, 1888. [Guerinot 1906 $244] Harisankara Kalidasa (Kapp.1914) 1924 *[Gujarati translation). Bambai : Meghaji Hiraji Jaina Bukselara, Vi. sam. 1981 [1924). [JSBI 2, 217 item 'i'] Becaradasa Jivaraja Dosi (Kapp.1952b) 1952 1966 Kalpasutrani kathao kimva Bhagavan). Mahaviranum jivana caritra / sampadaka ane lekhaka Jivanalala Chaganalala Sanghavi. Avrtti 1. Amadavada : Sthanakavasi Jaina Karyalaya, Is. sa. 1966. Vi. sam. 2022.8, 152 p. ; 1 plate; port. ; 18 cm. (Ji. Cha. Sanghavi Sanmana Smaraka granthamala, puspa 12). ANU BL1313.3.K365 S35 1966 1973 Amrtlala Amaracanda (translation follows Balabodha of Khimavijaya) (Kapp.1973) 255
Page #278
--------------------------------------------------------------------------
________________ Chedasutras 1976 Srikalpasutra : barasasutra : aneka sundratama vividhavarnana soneri, uperi, angina tatha berangi 168 citro ane 360 sangita ane Natyasastrana vividha rupo sahita / sampadaka Sarabhar Manilala Navaba. Amadavada : Mesarsa Sarabhar Manilala Navaba, sane 1976. [17], 253 p. ; 16 x 29 cm. (Sri Jaina Kala sahitya samsodhana sirija , puspa 16mum). Contents: Prakasakanum nivedana / Sarabhai Manilala Navaba (4)-10.-List of illustrations] 11-[17].-[Gujarati translation of Kalpasutra accompanied by numerous monochrome and colour plates] 1-253. "Prata 1000." ANU LARGE BOOK BL1313.3.K364 G8 1976 Hindi 1875 1916 1919 1933 1936 1948a * Kalpa sutra / Kavi Raycand. Lucknow, 1875. [Guerinot 1906 $241] Manika Muni (Kapp.1916) Amolaka Rsi (AyarDas.1919) (Kapp.1933c) Atmarama (AyarDas.1936) "Hindi translation). Jalandhara Sahara : Atmananda Jaina Mahasabha. san 1948. IJSBI 2. 217 item 'ai'). Reprint of Kapp.1936? Pyaracandra (Kapp.1948) Devendra Muni (Kapp.1968) Vinayasagara (Kapp.1977a) Kanhaiyalala (Kapp.1977b) 1948b 1968 1977 1977 Studies: Brown, W. Norman. 1934. *A descriptive and illustrated catalogue of miniature paintings of the Jaina Kalpasutra. Washington : Smithsonian Institution, 1934. (Freer Gallery of Art Oriental studies ; no. 2). Review. Walter Schubring OLZ38 (1935) 759-61. [Reprinted Kleine Schriften 449-50] Dixit, K. K. 1978. 4. The four old Chedasutras (AyarDas., BhKapp., Vava., Nis.]. [42]-53. In, Early Jainism. Ahmedabad: L. D. Institute of Indology, 1978. 8, 99 p. ; 25 cm. (LD series ; 64). ANU BL1351.2.D53 Huttemann, W. 1914. * Baessler-Archiv 4 (1914) 47 ff. Winternitz 1933:2, 463 n.1 Describes the miniatures in the MS of the Jinacaritra preserved in the Museum fur Volkerkunde, Berlin. Jinendravijaya. 1965 Sri Kalpasutra pujya vyakhyana / lekhaka Muni Jinendravijayaji. Prathamavstti. Jamanagara, Saurastra : Sri Harsapuspamrta Jaina granthamala, Vira samvat 2491. Vikrama samvat 2021. Sane 1965. [8]. 360 p. ; [2] leaves of plates ; illus. ; 18 cm. (Harsapuspamsta Jaina granthamala ; granthanka 49). [In Gujarati "Nakala 1500." Suddhipatraka p. [357]-358. ANU BL1313.3.K366 J5 1965 Nawab, Sarabhai Manilal). 1956. Masterpieces of Kalpasutra paintings. Ahmedabad : Sarabhai M. Nawab, 1956. [Cort 1989, 536] 1978. *The life of lord Sri Mahavira, as represented in the Kalpasutra paintings : 168 paintings with their significance and descriptions in Gujarati and English / by Sarabhai Manilal Nawab. Ahmedabad, 1978. (Sri Jain Kala sahitya samshodana series; no. 13). [R. N. Bhattacharya Catalogue no. 117, April 1998, item 202. Rs 1750] Indexes: 1879 (Kapp. 1879): Glossary [Sanskrit equivalents used by the commentaries for the Prakrit original] p. 127-73. 1952 (Kapp.1952b): Kalpacurnyantargatanam visistartharpakanam sabdanam suci. p. [113]114.-Kalpatippanakantargatanam visistartharpakanam sabdanam suci [24]-27.Anuvadamam vaparayela paribhasika Sabdono (82)-89. 256
Page #279
--------------------------------------------------------------------------
________________ 7.1 Ayaradasao / Dasasrutaskandha and Kalpasutra 1968 (Kapp. 1968): Parisista 6. Vadya, sangita paricaya p. [59]-63.--7. Kalpasutra ka sanksipta paribhasika sabda-kosa (64)-69. 1977 (Kapp.1977a): Kathina paribhasika sabdavali p. xxi-xxx.-A Select glossary xxxi-xxxiii. (Kapp.1979): Index [of proper nouns] [p. 203)-207. 1979 257
Page #280
--------------------------------------------------------------------------
________________ 258
Page #281
--------------------------------------------------------------------------
________________ 7.2 KAPPASUTTA (Cheya) (B sh Kapp.) Title: Bihakappa; Brhatkalpa (Skt); Bihatsadhukalpasutra; Kalpadhyayana; Kappa; Vedakalpa. Content: Six uddesas, 475 granthas. The principal work on the rules and regulations for monks and nuns, including restrictions concerning food, residence, etc. The Vavahara-sutta is a supplement (see the next section). References: Schubring 1935 $51; Weber 2:668f [IA 10:101, 21:214); JRK 283-84; BORI Cat. 17:2, 224-56; JSBI 2:237-83.! Exegesis: Bhadrabahu, Niryukti (JRK 284; JSBI 3, 123-24). Printed in BrhKapp.1933-42. 1998 *Brhatkalpaniryukti and Brhatkalpabhasya : romanized and metrically revised versions, notes from related texts and a selective glossary / Bhadrabahu, Sanghadasa ; von Willem B. Bollee. Stuttgart : Franz Steiner, 1998. 3 v. (Beitrage zur Sudasienforschung, Band 181, 1-3). Contents: Part 1: xxiv, 411 p.- Part 2 xxiv, 421 p.- Part 3 vii, 315 p. The present version in Latin script of the niryukti and bhasya have been provided with an English translation of the canonical text, a detailed account of the contents of the commentarial verses and, in an appendix by Elfrun Linke to vol. 1, the glossary missing in Schubring's Doctrine of the Jainas. Vol. 3 contains also an Index rerum and Additions and Corrections." (Blurb) Review: J. Bronkhorst Asiatische Studien = Etudes asiatiques 53 (1999) 987-92. Sanghadasa, (Laghu-)bhasa, 6540 gathas in six uddesas preceded by a pilhika of 805 gathas. Begins: kauna namokkaram. (Schubring 1935 $51; JRK 284a; JSBI 3,135, 213-51; BORI Cat. 17:2, 230-43). Printed in BrhKapp.1933-42. 1998 *Brhatkalpaniryukti and Brhatkalpabhasya: romanized and metrically revised versions, notes from related texts and a selective glossary / Bhadrabahu, Sanghadasa ; von Willem B. Bollee. Stuttgart : Franz Steiner, 1998. 3 v. (Beitrage zur Sudasienforschung, Band 181, 1-3). (See entry above). Malayagiri, Tika, completed by Ksemakirti, pupil of Vijayendu of the Candrakula, samvat 1332 (1275). (JRK 284b; BORI Cat. 17:2, 237-44; JSBI 3. 454) Schubring states that Malayagiri's work was continued by Balasirahsekhara and gives Ksemakirti as author of a separate Vrtti. (Schubring 1935, 951). Printed in BrhKapp.1933-42. Brhadbhasya, 8 600 granthas (JRK 284a; BORI Cat. 17:2, 254-55). "Not yet published. Some 58 verses are available in (BrhKapp. 1933-42]" (Tripathi 1981, 307). Paryaya, see Pancavastukaparyaya (BORI Cat. 17:2, 255-56). Pralamba Sari, Curni, 14 000 granthas. Begins: bhaddam Sarassatie (JRK 284). Saubhagyasagara, Avacuri (JRK 284b). Tabba (BORI Cat. 17:2, 246-48). Tika (JRK 284b). Visesacurni, 11 000 granthas (JRK 284b). 1 CLIO entries mixed with the Kalpasutra, ie, the Ayaradasao.
Page #282
--------------------------------------------------------------------------
________________ Chedasutras Editions:2 1905 Das Kalpa-sutra : die alte Sammlung jinistischer Monchsvorschriften: Einleitung. Text Roman characters). Anmerkungen, Ubersetzung, Glossar / von Walther Schubring. Inaugural-Dissertation ... Kaiser-Wilhelms-Universitat zu Strassburg. Leipzig : G. Kreysing, 1905. 71 p. [Emeneau 83946). Contents: Einleitung (5)-17.-Kappa-suttam [18]-36.-Anmerkungen zum Text. [371- 47.-Ubersetzung 48-59.--Glossar [60]-69.-Verzeichnis der wichtigeren Worte aus den Prakst-Stellen in den Anmerkungen zum Text. 69-70.-Verzeichnis der haufigeren Abkurzungen 70-71. Edition based on six MSS, described p. 15-16. "A model [edition in all respects" (Ghatage 1942, 166). Separate printing. Leipzig : Otto Harrassowitz, 1905. 71, p. covers ; 14 x 22 cm. Indica 2. [Emeneau 3946. CLIO 2, 1231; Guerinot 1906 9849) Reprinted Schubring, Kleine Schriften 1-69. 1911 1915 Translated into English, see BIhKapp.Translation.1910. Printed in Devanagari in BrhKapp.1923. *Kappasuttam / edited by Walther Schubring ... Nagari transcription (of Bfh Kapp.1905). Ahmedabad : Jivaraja Ghelabhai Dosi, 1911. 23, 4, 40, 7,5; 22 cm. (The Sacred books of the Jains; 4). [Schubring 1935, $51; CLIO 2, 1231] Sri Brhat Kappasuttam (Vedakalpa) : Chedasutra : Suddha mula, Sabdartha, bhavartha sahita / lekhaka tatha prakasaka Jivaraja Ghelabhai Dosr. Amadavada : Da. Jivaraja Ghelabhai Dosi, samvat 1971. Sane 1915. Contents: Prastavana / J. G. Dosi (la) 4b.-Anukramanika 51-11a. Jahera khabara 116-12b. Glossary 13-160.-Brhat Kappasuttam 1a-125a.Suddhipatram 126a126b. "Prata 1000." Gives "a glossary of Prakrit words with Sanskrit equivalents and references about passages common to other agamas" (BORI Cat. 17:2, 25-26). BORI 5918 /LD Pa. 6176 and 16 136 1918 1923 * Brhadkalpa sutra/ Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918.96 p. ; 13 x 23 cm. [LC] Kalpa-Vyavahara-Nisitha sutrani / Valtara Subringa namadheyena vidvadvarena samsodhitanam Jarmanadesastha-Laipjiga-nagare Romanalipyam pustakanam adharena Devana garaksaraih prakatikstani. Punyapattane (Pune] : Jaina Sahitya Samsodhaka Samiti, Viranirvanabda 2449. I. sa. 1923. Vikramabda 1979. 67 p. ; 25 cm. (Jaina Sahitya Samsodhaka granthamala). Contents: Kappasuttam [1]-15.-Vavaharasuttam [16]-34.--Nisihasuttam (35)-62.Kalpasutrasya pahantarani [63).--Vavaharasutrasya pathantarani [63]-65.Nisithasutrasya pahantarani [65)-66. -Asuddhi-samsodhanam 67. BORI 90 (A) and LD 7398 1933-42 Sthavira-Aryabhadrabahusvamipranitasvopajnaniryuktyupetam Brhatkalpasutram : Sri sanghadasaganiksmasramanasankalitabhasyopabrmhitam : Srimadbhir Malayagirisuribhih prarabdhaya Vrddhaposalikatapagacchiyaih Sriksemakirtyacaryaih purnikstaya ca vrttya samalarikstam / tatsampadakau Muni Caturvijaya-Punyavijayau. Bhavanagara : SrijainaAtmanandasabha, Virasamvat 2459-68. Vikramasamvat 1989-98. Isvi san 1933-42. Atmasamvat 36-42.6 v., 4 plates, portraits ; 27 cm. (Sriatmananda-Jainagrantharatnamala ; 82, 83, 84, 87, 88, 90). v.1: Pilhikarupah prathamo'msah v, 1-805. 44, 254, 2 p. 2 [BfhKapp edition with an unknown ctyl: Jodhapura : Samyak Jnana Pracaraka Mandala. [JSBI 2:[237] item 'i'). No further details traced. 260
Page #283
--------------------------------------------------------------------------
________________ 7.2 Kappasutta /Brhatkalpa v.2: 1. uddesah v.806-2124. Virasamvat 2463. Vikramasamvat 1992. Isvi san 1936. Atmasamvat 40. 38, (255)-610, 4 p. v.3: Udd. 1. v. 2125-3289. 44, 611-922 p. 7.4: dvitiva-trtiyav uddesakau v. 3290_4876. Virasamvat 2465. Vikramasamvat 1994. Isvi san 1938. Atmasamvat 42.51, [923-1306 p. v.5: caturtha-pancamav uddesakau v. 4877-6059. Virasamvat 2465. Vikramasamvat 1994. Isvi san 1938. Atmasamvat 42. 38, [13071-1599 p. v.6:sastha uddesah samagragranthasatkatrayodasaparisistaprabhstibhir alankrtas ca v. 6060-6490. 8, 7, 6, 82, 10, [1301)-1712, 198 p. Contents v. 6:- Bhatkalpasutrasamsodhanakste sangrhitanam pratinam sanketah (5).Tikakrta'smabhir va nirdistanam avatarananam sthanadarsakah sanketah [6]-7.Pramanatvenoddhrtanam pramananam sthanadarsakagranthanam pratikrtayah 7-8.Pratahsmaraniya ganaguru punyadhama pujya gurudevanum hardika pujana / Punyavijaya [details about Catura vijaya, d. Vi. sam. 1996 [1939]] 1]-7.Brhatkalpasutrana chattha vibhagana prakasanamam sahayako [list of donors) [1] Amukha / Punyavijaya (2)-6.-Granthakarono paricaya / [Punyavijaya) [1]-29.Bhatkalpasutrani prationo paricaya / [Punyavijaya30-33.--Sampadanapaddhati ane pathabhedono paricaya / 33-54.-Grantha paricaya 54-59.-Antara paricaya / [Punyavijaya] 59-74.-Parisistono paricaya / Punyavijaya 74-75.-Samagrasya Brhatkalpasutrasya suddhipatram [76]-82.-Brhatkalpasutra sastha vibhagano visayanukrama [1]-8.-Trayodasaparisistasya visayanukramah. 191-10.-Bshat Kalpasutram (1601)-1712 Igatha 6060-6490].-Parisistani. 1. Mudritasya Niryuktibhasya-vyttyupetasya Bshatkalpasutrasya vibhagah. (3).-2. Brhatkalpasutrasya Niryukti-bhasya-curni-visesacurni-vittikrdbhir nirdistanam Prakstanamnam sutranamnam canukramanika. [4]-8.-3. Samagrasya Brhatkalpasutrasya Prakrtanamnam sutranamnam tadvisayasya canukramanika [9]-19.-4. Bhatkalpasutracurnivisesacurni-vsttiktdbhir vibhagaso nirdistanam niryuktigatha-sangrahagathapuratanagathadinam anukramanika [20]-29.-5. Brhatkalpasutrasya Niryuktibhasyagathanam akaradivarnakramanukramanika [30]-119.- 6. Bihatkalpasutravyttyantah vrttikrdbhyam uddhstanam gathadipramananam anukramanika (120)-132.7. Bihatkalpasutrabhasya-vittyantargata laukikanyayah [133].-8. Bthatkalpasutrasya vttau vettik dbhyam nirdistani sutra-bhasya-gathapahantaravedakani sthalani[133].9. Bihatkalpasutravrttyantargatanam granthakstam namani (134).-10. Behatkalpasutrabhasya-vittyantah pramanatvena nirdistanam granthanam namani (135)-137.-11. Bshatkalpasutra-Niryukti-bhasya-vrtti-tippanyadyantargatanam visesanamnam anukramanika (138) -- 148.-12. Bshatkalpasutra-tanniryukti-bhasya-vsttyadyantargatanam visesanamnam vibhagaso'nukramanika [149]--154.-Prakkathana / Muni Punyavijaya. [1 folio unnumbered]-13. Bihatkalpasutra-tanniryukti-bhasyatikadigatah puratattvavidamupayogino vibhagaso vividha ullekhah. [155)-195. "Pratayah 500." This edition on the basis of seven MSS, listed v.6, p. 30 (4th group). Described as die fehler freie Ausgabe des Brhatkalpa mit Bhasa und Tika von Caturavijaya und Punyavijaya 1933-42' (Schubring 1966, 29). "The verses are numbered serially, appendix 5 is an index of the verses" (Tripathi 1981, 307). BORI 37554 (v.1-5 only) / ANU LARGE BOOK BL1313.3.K366 B3 1942 v.6 [only] 1936 *[With Atmarama's Hindi tika). Lahaura : Jaina Sastramala Karyalaya, san 1936. [Devendra Muni 1977, 720 item 2] 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie ; [sutthuruvena] Pupphabhikkhuna sampadio. 1. avitti. Gudagamva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354.2 v. ; 19 cm. Bihakkappasuttam v.2: (831)-848. ANU BL1310.58 1954 2 v. 3 The appendices are reprinted from the earlier volumes. 261
Page #284
--------------------------------------------------------------------------
________________ Chedasutras 1954 1960 *[Mula, Niryukti, Curni). Bhavanagara : Vi. sam. 2011 (1954). (Manivijayaji Gani granthamala). [Devendra Muni 1977,720 item 3] *[Brhatkappa with Sanskrit vyakhya and Hindi-Gujarati translation.] / Ghasilala. Rajkota : Jaina Sastroddhara Samiti, 1960. Devendra Muni 1977, 720 item 41 *LD 13 867 1969 Jai nacarya-Jainadharmadivakara-pujya-Sri-Ghasilala vrati-viracita-bhasyasamalankrtam (1) Srivyavaharasutram = Shree Vyavhar sutram : evam Curnibhasyavacurisamalarikstam (2) Sribshatkalpasutram = Shree Bruhatkalpa sutram / niyojakah SrikanhaiyalalajiMaharajah. 1. avstti. Rajakota, Saurastra : Sri A[khila) Bhasrata). Sve[tambara Sthanakavasi Jaina Sastroddhara Samiti, Vira samvat 2495 ; Vikrama-samvat 2025. Isvisan 1969. 7, 15, 272, 40, 10, 156, 23 p. ; 3 leaves of plates ; 25 cm. Contents: Galundiya parivara ka sanksipta jivanacaritra lie. donor details [1]-7.Vyavaharasutrasya visayanukramanika [11-15.-Sri-vyavaharasutram |Text, chaya, *avacuri' (Sanskrit gloss) [1]-272.-Sri-vyavaharasutrasya mulapathah [11-40.-(2) Curnibhasyavacurisamalankstam Sribshatkalpasutram. Brhatkalpasutrasya visayanukramanika (1)-10.--Sribhatkalpasutram [Text, chaya, "curni'][1]-156.--Sribthatkalpasutrasya mulapathah [1]-23. "Prati 1100." Reprint 1990. ANU PK5003.A55V8 1959 [sic] Sri Brhatkalpa sutram : satikam / sampadakah Hastimallo Munih. Jodhapura : Samyak Jnana Pracaraka Mandala, n. d. 'a'-*n' [ie. 27), 119 p. ; 24 cm. Contents: Prabandhaka ke do Sabda (1-2).- Prakasana sahayaka ka sanksipta paricaya 13-4).- Prakkathana (5-10).-Brhatkalpa paricaya [11-16).--Bphatkalpasutrasyanukramanika [17-27).-Sri Brhatkalpa sutram satikam [1]-65.-Parisistani. 1. Sribshatkalpasutrasya-uddesakanusari akaradivarna kramena sabdarthanirdesah. [69]102.--2. Pathabhedah [103]-106.3. Pratiparicaya) (107)-108.--4. Behatkalpa sutra vrtyantargatani visesa namani (109)-111.-5. Tippanam [112]-119. The commentary was begun by Malayagiri and completed by Ksemakirti (see Brhkapp.1933-42). ANU PK5003.A55 K3 1969? 1969? 1976 *Sri Kalpasutram (Barasa-sutram)/Bhadrabahusvami-viracitam Sri Paryusanakalpakhyam : sampadaka-samsodhakas ca Jinendravijaya-Gani Lakhabavala-Santipuri, Saurastra : Sri Harsapuspamrta Jaina Granthamala, 1976. 134 [i.e. 268] p. ; 15 x 31 cm. (Sri Agamasudhasindhu ; 11). 1977 Chedasuttani : Kappasuttam : bitiya chedasuttam : Bihatkalpasutra / sampadaka evam vyakhyakara Kanhaiyalalaji 'Kamala.' Sanderava, Rajasthana : Agama Anuyoga Prakasana, Vira Nirvana sam. 2506; Vi. sam. 2034. San 1977. 24, [2]. 170, 24 p. (1 plate, portrait) ; 22 cm. (Agama Anuyoga prakasana; puspa 13). Contents: Prakasakiya (3).-Sampadakiya / Kanhaiyalala 'Kamala' [41-15.Brhatkalpasutra ki utthanika /Phulacandaji 'Sramana' [16)-20.-Anukrama [21)-24.Jivana saurabha : Sri Ganapatibai [2].--Kappasuttam [1]-170.-Parisista 1. Kalpavargikarana 1. Vidhikalpa (3)-5.-2. Nisedhakalpa [6]-8.-3. Vidhi-nisedhakalpa [91- 10.-Parisista 2. Prayascitta vargikarana [111-12).-Parisista 3. Sutra-vargikarana (13)16.-Parisista 4. Kappasuttam sutrom ka akaradikrama [17]-24. ANU PK5003.A55K32 1977 Navasuttani: Avassayam, Dasavealiyam, Uttarajjhayanani, Nandi, Anuogadaraim, Dasao, Kappo, Vavaharo, Nisihajjhayanam / vacana pramukha Acarya Tulasi; sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2044. I[svi san). 1987. 140, 812, 29, 320 p. : four pages of plates ; 25 cm. "Original text critically edited on the basis of MSS and printed editions. However the description of manuscripts and printed versions used is lost, so it could not be included herein" (p. 82 (1st group)). 1987 262
Page #285
--------------------------------------------------------------------------
________________ 7.2 Kappasutta /Bihatkalpa Forms v.5 of a complete edition of the Jaina Agama. BrhKapp. (561)-595 ANU NEW BOOKS COLLECTION 1 484 435 1990 Reprint of Brhkapp.1969. Vira samvat 2516 ; Vikrama-samvat 2046. Isvisan 1990. 15, 272, 40, 10, 156, 23 p. ; 25 cm. RW 1992 Trini chedasutrani : Dasasrutaskandha. Brhatkalpa. Vyavaharasutra : mulapatha, Hindi anuvada, vivecana, tippana yukta / samyojaka tatha adya sampadaka Misrimalaji Maharaja 'Madhukara'; anuvadaka-vivecaka-sampadaka Kanhaiyalalaji Ma[haraja). 'Kamala'. Byavara, Rajasthana : Sri Agamaprakasana Samiti, Vira nirvana sam. 2517. Vikrama sam. 2048. 1992 I. 81, 462 p. ; 25 cm. Prathama samskarana. (Jinagama-granthamala ; 32). Contents: Prakasakiya 7-8.-Sampadakiya : Cheda-sutra: samiknatmaka vivecana/ Muni Kanhaiyalala Kamala'. [9]-34.-Prastavana : Trini Chedasutrani : eka samiksatmaka adhyayana / Upacarya Devendra Muni 35-72.-Visaya suci 73-81.Dasasuyakkhandho 1-124.--Brhatkalpasutra (125)-258.-Vyavaharasutra [259]-458.Anadhyayakala [Nandi.1966c, 7-9se uddhita] [459]-461. ANU NEW BOOKS COLLECTION 2 036 711 Translations: English 1910 * The Kalpasutra : an old collection of disciplinary rules for Jaina monks / by Walther Schubring: translated from the German by May S. Burgess. Indian antiquary 39 (1910) 257-67. [Emeneau $3947] [Introduction and German translation of BrhKapp.1905 retranslated into English. Printed separately, Bombay, 1910. [Schubring, Kleine Schriften ix] German 1905 Walther Schubring (BihKapp.1905) Gujarati 1915 Jivaraja Ghelabhai Dosi (Bph Kapp.1915) 1960 Ghasilala (BhKapp.1960) Hindi 1918 1960 1992 Amolaka Rsi (BhKapp.1918) Ghasilala (BrhKapp. 1960) Kanhaiyalala 'Kamala', Muni (BphKapp.1992) Indexes: 1905 (BphKapp.1905): Glossar p. [60]-69. 1915 (Brhkapp.1915): Gives "a glossary of Prakrit words with Sanskrit equivalents and references about passages common to other agamas" (BORI Cat. 17:2, 25-26). 1933-42 (Brhkapp. 1933-42) v.6: 2. Brhatkalpasutrasya Niryukti-bhasya-curni-visesacurni vyttiktdbhir nirdistanam Prakrtanamnam sutranamnam canukramanika. p.[4]-8.-3. Samagrasya Bthatkalpasutrasya Prakstanamnam sutranamnam tadvisayasya canukramanika [9]-19.-4. Brhatkalpasutracurni-visesacurni-vrttiktdbhir vibhagaso nirdistanam niryuktigatha-sangrahagatha-puratanagathadinam anukramanika (20)-29.-5. Brhatkalpasutrasya Niryukti-bhasyagathanam akaradivarnakramanukramanika [30]-119.6. Brhatkalpasutravittyantah vsttikTdbhyam uddhstanam gathadipramananam anukramanika [120]-132.-7. Behatkalpasutrabhasya-vittyantargata laukikanyayah. (133). ... 9. Bthatkalpasutravrttyantargatanam granthakrtam namani. [134).-10. Brhatkalpasutrabhasyavsttyantah pramanatvena nirdistanam granthanam namani. [135]-137.-11. Behatkalpasutra-Niryukti-bhasya-vstti-tippanyadyantargatanam visesanamnam anukramanika. [138] 148.-12. Brhatkalpasutra-tanniryukti-bhasya-vittyadyantargatanam visesanamnam vibhagaso'nukramanika [149]--154. 263
Page #286
--------------------------------------------------------------------------
________________ Chedasutras 1957-60 (Nis. 1957-60): Nis. Bha.-Brh KappBha. concordance: v. 1? Reprinted Nis. 1982:4. 1969 (BphKapp.1969?): Parisistani. 1. Sribthatkalpasutrasya-uddesakanusari akaradivarna kramena sabdarthanirdesah. p. [69]-102. ... 4. Bthatkalpa sutra vrtyantargatani visesa namani [109]-111. (Nis. 1982): Nis.Bha.-BrhkappBha. concordance: v. 4. Parisista. 1. Nisitha-bhasyagathanam akaradivarnakramenanukramanika Bthatkalpabhasyasya samanagathanam ankanirdesas ca [447]-535. Reprinted from Nis. 1957-60. 1982 1987 (BphKapp.1987): combined index of: Nandi. (including JogNa. and LahuNa.) AnuOg., Utt., Dasave., Av., Dasa. (including AyarDas.), BfhKapp., Vava. and Nis.: Parisista 3. Navasuttani saddasuci (15 505 words. p. [1]-319. 264
Page #287
--------------------------------------------------------------------------
________________ 7.3 VAVAHARASUTTA (Vava.) Title: Vyavaharasutra (Skt). Content: Ten uddesakas, 373 slokas. Rules for monks and nuns, a kind of supplement to the Brhatkalpasutra. at times it makes more precise the injunctions given there. Utilised in the composition of the Prakirnaka text entitled Gacchacara. The Vava. has some portions in common with the Nisithasutra (H. R. Kapadia BORI Cat. 17:2, 37). References: JRK 367-8; BORI Cat. 17:2, 37-59; JSBI 2, 257-69; Schubring 1935 951. Exegesis: Niryukti (JSBI 3, 125). Printed in Vava.1925-28. Bhasya (VavaBha.) (JRK 367b; BORI Cat. 17:2, 43-47; JSBI 3, 251-71). Printed in Vava. 1925-28. 1996 Vyavahara bhasya : mulapatha, pathantara, pathantara-vimarsa, Niryukti, vistta bhumika tatha vividha parisistom se samalarksta/vacana pramukha Ganadhipati Sri Tulasi ; pradhana sampadaka Acarya Mahaprajna ; sampadika Samani Kusumaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2053. San 1996. 1. samskarana. 142, 447, 263 p. ; 25 cm. Contents: Samarpana [3].-Antastosa / Ganadhipati Tulasi [5].-Asirvacana / Ganadhipati Tulasi (7).--Mangalavacana / Acarya Mahaprajna, 22 Mai 1996, Ladanum [9].- Granthanukrama [11-12].--Prakasakiya / Taracanda Ramapuriya, Sitambara 1996, Ladanum 13). Sampadakiya / Samani Kusumaprajna [15]-28.-Vyavahara bhasya : eka anusilana / Muni Dulaharaja, Samani Kusuma prajna, 1 June 1996 (29)92.-- The glimpses of Vyavahara bhasya (English version of a portion of the preceding study/Muni Dulaharaja, Samani Kusum Prajna (93)-110.-Sanketa-nirdesika [111]112.-Visayanukrama (113)-142.-Vyavahara bhasya (text with variant readings as footnotes 1) 447.-Parisista. 1. Vyavaharabhasya-gathanukrama [1]-60.-2. Niryuktigathanukrama [61]-69.-3. Sutra se sambandhita bhasya-gathaom ka krama [70]-71.4. Tika evam bhasya ki gathaom ka samikarana [72]-104.-5. Ekarthaka (105)-107. 6. Nirukta [108-112.-7. Desisabda [113]-123.-8. Kathaem [1241-163.-9. Paribhasaem[164]-176.-10. Upama [177]-179.-11. Niksipta sabda [180].-12. Suktasubhasita [181]-191.-13. Anya granthom se tulana (192)-212.-14. Ayurveda aura arogya [213]-218.-15. Kayotsarga evam dhyana ke vikirna tathya [219]-224.-16. Drstivada ke vikirna tathya (225)-229.-17. Visista vidyaem [230]-232.-18.Tika mem uddhrta gathaem (233)-238.-19. Visesanamanukrama [239]-244.- 20. Vargiksta visesanamanukrama [245)-252.-21. Tika mem sanketita Niryuktisthala [253].-22. Tika mem uddhtta curni sanketa [254].--23. Vargiksta visayanukrama [255)-257.Prayukta grantha suci [258]-263. Sources: 4 paper manuscripts (there being few palmleaf manuscripts of this text), no single manuscripts was taken as the basis for the text:-(1) A. Dela upasraya, Ahmedabad, serial no. 6466, 109 p., 15 lines per page, dated samvat 1538 (1481);-(2) Ba. Lalbhai Dalpatbhai Institute, Ahmedabad, serial no. 12, 74 p., 17 lines per page, estimated date (samvat) 16th cent.; (3) Ka. Dela upasraya, Ahmedabad, serial 10515, 12 pages, 18 lines per page, estimated date (samvat] 16th cent., based on (Ba. above);(4) Sa. BORI, 127 pages, 13 lines per page, prasasti cited but no details of BORI Cat. numeration. (Description given in Sampadakiya, p. 24-25); (2) Tika of Malayagiri, presumably Vava. 1925-28, since shortcomings in that edition are referred to in the Sampadakiya p. 22-23; (3) verses from the text also found in BIhKapp., Nis., Jiy Kapp., AvNi. RW Cunni, 10 360 granthas (JRK 367b; BORI Cat. 17:2, 56-57). Malayagiri, Tika, 33 625 granthas (JRK 367b; BORI Cat. 17:2, 49-50). Printed in Vava. 1925-28.
Page #288
--------------------------------------------------------------------------
________________ Chedasutras 5 6 7 Editions 1918a 1918b 1923 Paryaya, see Pancavastukaparyaya (JRK 368a; BORI Cat. 17:2, 58-59). Avacuri (JRK 368a). Tabba (BORI Cat. 17:2, 42-43). 1925 Vavahara- und Nisiha-sutta / herausgegeben von Walther Schubring. Gedruckt mit Unterstutzung der Konigl. Preuss. Akademie der Wissenschaften. Abhandlungen fur die Kunde des Morgenlandes; 15, 1. Leipzig: F. A. Brockhaus, 1918. 72 p. ; 23 cm. [Schubring, Kleine Schriften ix-x] Kalpa-Vyavahara-Nisitha sutrani | Valtara Subringa namadheyena vidvadvarena samsodhitanam Jarmanadesastha-Laipjiga-nagare Romanalipyam pustakanam adharena Devanagaraksaraih prakatikrtani. Punyapattane [Pune] : Jaina Sahitya Samsodhaka Samiti, Viranirvanabda 2449. I. sa. 1923. Vikramabda 1979. 67 p. ; 25 cm. (Jaina Sahitya Samsodhaka granthamala). Contents: Kappasuttam [1]-15.-Vavaharasuttam [16]-34.-Nisihasuttam [35]-62.-- Kalpasutrasya pathantarani. [63].-Vavaharasutrasya pathantarani [63]-65.Nisithasutrasya pathantarani [65]-66. - Asuddhi-samsodhanam 67. BORI 90 (A) and LD 7398 *[Devanagari version of Schubring's Vava.1918 with Gujarati translation]/Jivaraja Ghelabhar Dosi. Ahmadabada, 1925. (The Sacred books of the Jains). [JSBI 2, [257] item 'i'] *LD 12 194 1925-28 Sri Vyavahara-sutram : Bhadrabahuddharita-mulasutram Niryukti-sametam, ... -bhasyam Sriman-Malayagiri-viracita-vivarana-sametam/samsodhako Muni Maneka [or Manikyah]. [Ahmedabad] : Vakil Kesavlal Premcand [Modi]. samvat 1982-85. Sane 1925-28. 12 v. ; 13 x 27 cm. [CLIO 4, 3081; Schubring 1955, 297 = Kleine Schriften, 321; Tripathi 1981, 328] Reprint. Nendeln, Liechtenstein, 1966. Text only in Devanagari, Nis. 1923. Contents: [Vorwort] [5]-11.-Vavahara-suttam [12]-36.-Nisiha-suttam [37]-72. Based on two MSS: Berlin ms.or.fol.1038; 2395; Malayagiri's Tika 737; 738. ANU PJ5.D5 Bd. 15, Nr.1 Vyavahara sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918. 180 p.; 13 x 23 cm. Publisher varies. "The publication was released in twelve bundles of pothi format, cach having its own foliation." The numbering of bhasya verses is defective, only some bundles are called bhaga or vibhaga, some apparently have no title-page (Tripathi 1981, 32829). Contents: Bundle 1: folia 62. Pithika.-2. 99. Uddesa 1.-3. 139. Uddesa 1.-4. 3, 87. Uddesa 2.-5. 73. Uddesa 3.-6. 104. Uddesa 4.-7. 29. Uddesa 5.-8. 72. Uddesa 6.9. 4, 95. Uddesa 7.-10. 60, 3. Uddesa 8.-11. 23. Uddesa 9.-12. 114. Uddesa 10. (folios 94-114 Upasamhara) (Tripathi 1981, 328). Some title-pages have "Prata 625." Reprints the text of Vava. 1918, adding the bhasya and tika (Caillat 1968, 151). ?= Bhavnagar, 1926 [1927], 1928. (Schubring 1944, 39; Balbir 1993, 25). Bruhn mentions corrections to the numbering of this edition (1996, 47). BORI 38 144, 38 119 *LD 6129-40, Pa. 16 008, 16009, 16011-17, 16 108 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie ; [sutthuruvena] Pupphabhikkhuna sampadio. 1. avrtti. Gudagamva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354. 2 v.; 19 cm. Vavaharo 2:[797]-829. ANU BL1310.S8 1954 2 v. 266
Page #289
--------------------------------------------------------------------------
________________ 7.3 Vavaharasutta 1966 1969 Drei Chedasutras des Jaina-Kanons: Ayaradasao, Vavahara, Nisiha/bearbeitet von Walther Schubring; mit einem Beitrag von Colette Caillat. Hamburg : Cram, de Gruyter, 1966. 106 p. ; 28 p. (Alt- und Neu-Indische Studien ; 11). Contents: Die Cheyasutta) 1-4.-Ayaradasao (mit Kommentar] 5-28.-Vavahara. 29.[Text] 31-47.-[Ubersetzung und Kommentar: Uddesa 1-3 into French / Colette Caillat) 48-69.- Comments on 1-3/Schubring] 69-70.-Uddesa 4-10 translated into German Walther Schubring 70-89. Varianten aus H. 89-91.-Nisiha [Einfuhrung und Analyse] 92-103.-Auswahl aus dem Wortschatz 104-106. For the Vava, the text is that of Vava. 1918 with corrections based on Vava. 1925-28; 1953-54; 1918 and Brh Kapp.1933-42. Review Colette Caillat. JA 256 (1968) 150-54. ANU LARGE BOOK PK5003.A55 1966 J[ai]nacarya-Jainadharmadivakara-pujya-Sri-Ghasilalavrativiracita-bhasyasamalankrtam (1) Srivyavaharasutram = Shree Vyavhar sutram : evam Curnibhasyavacurisamalankstam (2) Sribrhatkalpasutram = Shree Bruhatkalpa sutram / niyojakah SrikanhaiyalalajiMaharajah. 1. avrtti. Rajakota, Saurastra : Sri A[khila) Bha[rata. Sveftambara Sthanakavasi Jaina Sastroddhara Samiti, Vira samvat 2495 ; Vikrama-samvat 2025. Isvisan 1969. 7, 15, 272, 40, 10, 156, 23 p. ; 3 leaves of plates ; 25 cm. Contents: Galundiya parivara ka sanksipta jivanacaritra [ie. donor details) [1]-7.Vyavaharasutrasya vinayanukramanika [1]-15.-Sri-vyavaharasutram [Text, chaya, *avacuri' (Sanskrit gloss) [1]-272.-Sri-vyavaharasutrasya mulapathah [1]-40.--(2) Curnibhasyavacurisamalankstam Sribthatkalpasutram. Bshatkalpasutrasya visayanukramanika [1]-10.--Sribthatkalpasutram (Text, chaya, 'curni'][11-156.-Sribhatkalpasutrasya mulapathah [1-23. "Prati 1100." Reprint 1990. ANU PK5003.A55V8 1959 [sic] Chedasuttani Vavaharasuttam: taiyam chedasuttam/sampadaka Kanhaiyalala Kamala.' Sanderava, Rajasthana : Agama Anuyoga Prakasana, Vi. sam. 2037. Vira Nirvana sam. 2507. Sitambara 1980. 136 p. ; 13 cm. (Agama Anuyoga Prakasana ; 15). Bare text reprinted form Vava. 1980. ANU NBC 2 118 353 1980 1987 Navasuttani: Avassayam, Dasavealiyam, Uttarajjhayanani, Nandi, Anuogadaraim, Dasao, Kappo, Vavaharo, Nisihajjhayanam / vacana pramukha Acarya Tulasi; sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2044. I[svi san). 1987. 140, 812, 29, 320 p. ; 4 pages of plates ; 25 cm. "Original text critically edited" on the basis of six manuscripts:-(1)-(3) from 16th cent. V.S.; (4) one from Jaisalmer V.S. Sravana Badi 11, 1225 [1168]; (5) one of Malayagiri's Vrtti about which no details are given and (6) another undated manuscript of the Curni--and three printed editions: Vava.1923; 1925; 1928 (bhasya), described on p. 25-26 = 82-83 (1st group). Forms v.5 of a complete edition of the Jaina Agama. Vavaharo p. 15971-661. ANU NEW BOOKS COLLECTION 1 484 435 1990 1992 Reprint of Vava. 1969. Vira samvat 2516; Vikrama-samvat 2046. Isvisan 1990. 15, 272, 40, 10, 156, 23 p. ; 25 cm. RW Trini chedasutrani : Dasasrutaskandha. Brhatkalpa. Vyavaharasutra : mulapatha, Hindi anuvada, vivecana, tippana yukta/ samyojaka tatha adya sampadaka Misrimalaji Maharaja *Madhukara'; anuvadaka-vivecaka-sampadaka Kanhaiyalalaji Ma[haraja). 'Kamala.' Byavara, Rajasthana : Sri Agamaprakasana Samiti, Vira nirvana sam. 2517. Vikrama sam. 2048. 1992 I. . 81, 462 p. ; 25 cm. Prathama samskarana. (Jinagama-granthamala ; 32). Contents: Prakasakiya 7-8.-Sampadakiya : Cheda-sutra : samiknatmaka vivecana / Muni Kanhaiyalala Kamala'. [9]-34.--Prastavana : Trini Chedasutrani : eka samiknatmaka adhyayana / Upacarya Devendra Muni 35-72.-Visaya suci 73-81.Dasasuyakkhandho 1-124.-Brhatkalpasutra (125)-258.-Vyavaharasutra [259]-458.Anadhyayakala [Nandi.1966c, 7-9 se uddhtta] [459]-461. ANU NEW BOOKS COLLECTION 2 036 711 267
Page #290
--------------------------------------------------------------------------
________________ Chedasutras Translations: Gujarati 1925 Jivaraja Ghelabhai Dosi (Vava.1925) Hindi 1918 1992 Amolaka Rsi (Vava.1918b) Kanhaiyalala 'Kamala (Vava.1992, 259-458) Partial translations: French 1966 Colette Caillat (Uddesas 1-3) (Vava. 1966, 48-69) German 1966 Walther Schubring (Uddesas 4-10) (Vava. 1966, 70-89) Indexes: 1966 1987 (Vava. 1966): Auswahl aus dem Wortschatz p. 104-106. (Vava. 1987): combined index of: Nandi. (including JogNa. and LahuNa.) AnuOg., Utt., Dasave., Av., Dasa. (including AyarDas.), ByhKapp., Vava and Nis.: Parisista 3. Navasuttani saddasuci [15 505 words). p. [1]-319. 268
Page #291
--------------------------------------------------------------------------
________________ 7.4 NISIHA (Nis.) Title: Nisitha (Skt). "The title Nisitha is a false Sanskritization of Nisiha, which probably corresponds to Sanskrit nisedha, "prohibition" (Winternitz 1933:2, 64n.3). Content: The text has around 1500 sutras in 20 uddesas (JSBI 2, 273-87). It describes for monks and nuns four kinds of atonement (prayascitta) for various transgressions against the rules of daily life. It is a later work, it includes most of the Vavahara and has numerous sutras in common with culas I and II of the Ayaranga, probably both works originated in one and the same earlier source (Winternitz 1933:2, 464-65). References: Weber 2, 623 = IA 21, 180]; JRK 214-15; BORI Cat. 17:2, 21-28.; JSBI 2, 273-87; Winternitz 1933:2, 464-65; Schubring 1935 $51. Exegesis: Niryukti. For more information see Dalsukh Malvania's introduction to Nis. 1957-60 [ = 1982a:1, 25-27). Sanghadasa, Bhasya (NisBha.) 6529, gathas, about 7000 granthas. Begins: navabambhacera (JRK 215a; BORI Cat. 17:2, 8-14). Printed in Nis.1938 or 1939, 1957-60 [=1982a). Jinadasa Mahattara, pupil of Pradyumna, Nisithacurni (NisCu.) or Visesacurni (28 000 grantha). Begins: namiuna 'rahantanam. Pilhika, then 20 uddesas, following the sutra. (JRK 215a; BORI Cat. 17:2, 14-22, 17:3, 468; JSBI 3, 321-44). Printed in Nis.1938 or 1939; 1957-60 (=1982a). 3.1 Sricandra, also known as Parsvadeva Gani, pupil of Dhanesvara Suri, pupil of Silabhadra, Vyakhya of Jinadasa's Nisithacurni on the 20th chapter of the sutra, also known as Vimsoddesakavrtti, or Nisithacurni-durgapadavyakhya. Composed samvat 1174 [1117]. In this commentary Sricandra calls himself a pupil of Silabhadra (JRK 215b; BORI Cat. 17:2, 23-25; JSBI 3, 449-50). Printed in Nis. 1938 or 19392; 1957-60 [=1982a): v. 4, 413-43). 3.2 Nisithacurnyadiparyaya, see Pancavastukaparyaya (BORI Cat. 17:2, 27-8). Byhadbhasya (grantha 12 000) (JRK 215a). Bhasya or Curni (JRK 214a-b). Paryaya see Pancavastukaparyaya (JRK 215b; BORI Cat. 17:2, 25-27). Bhasyaviveka, by a pupil of Ratnaprabha (JRK 215b). Editions: 1918 Vavahara- und Nisiha-sutta / herausgegeben von Walther Schubring. Gedruckt mit Unterstutzung der Konigl. Preuss. Akademie der Wissenschaften. AKM 15. Band. No. 1. Leipzig : F. A. Brockhaus, 1918. 72 p. ; 23 cm. [Kleine Schriften ix-x] Reprint. Nendeln, Liechtenstein, 1966. Text only in Devanagari, Nis. 1923. Contents: Vorwort) (5)-11.- Vavahara-suttam [12]-36.-Nisiha-suttam (371-72. Edition of Nis. based on six MSS: Berlin, ms.or.fol.728; 1021; 1022; 2395: Deccan College, Pune 1880/81 no. 35: Florence, Biblioteca Nazionale Centrale no. 528 (Curni of Jinadasa), (p. 10). See Schubring's further studies based on this text, see Studies below. ANU PJ5.D5 Bd.15, Nr.1 1919 *Nisitha sutra / Amolaka Rsiji Maharaja klta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, Vira samvat 2446 [1919). 246 p. ; 13 x 23 cm. [LC] 1923 Kalpa-Vyavahara-Nisitha sutrani / Valtara Subringa namadheyena vidvadvarena samsodhitanam Jarmanadesastha-Laipjiga-nagare Romanalipyam pustakanam adharena
Page #292
--------------------------------------------------------------------------
________________ Chedasutras Devanagaraksaraih prakatikstani. Punyapattane [Pune] : Jaina Sahitya Samsodhaka Samiti, Viranirvanabda 2449. L.sa. 1923. Vikramabda 1979.67 p. ; 25 cm. (Jaina Sahitya Samsodhaka granthamala). Contents: Kappasuttam 1]-15.-Vavaharasuttam [16]-34.-Nisihasuttam [351-62.Kalpasutrasya pathantarani. [63]. -Vavahara sutrasya pathantarani [63]-65.Nisithasutrasya pathantarani [65]-66.- Asuddhi-samsodhanam 67. BORI 90 (A) and LD 7398 1938 or 1939 Sri Nisitha sutram : Curni-bhasyopetam / Curnikarah Jinadasamahattara samsodhitah Vijaya Premasurfsvaraih ; pustakarupe sajjikrtah. Vira samvat 2465 [1939). Samvat 1995 [1938]. 6 v. ; 35 x 23 cm. Handwritten title-page, remainder of work is cyclostyled typescript. "Acarya Sri Vijayapremasuriji pathakapravara Srijjambuvijayajiganityetayor atulaprayatnena nirmapitaprakstagranthapratikstyanusarena." Contents: v.1: Uddesa 1. [Includes a plate with separate photographs of Vijayadanasuri, Vijayapremasuri, Vijayaramacandrasuri and Jambuvijaya and a layman, husband of the person responsible for the publication.] 1-202 p.-v.2: Uddesa 2-5. 203-445 p. v.3: Uddesa 6-10.446-665 p. v.4: Uddesa 11-14. (666)-916 p.-v.5: Uddesa 15-17. 917-1160 p.--v.6: Uddesa 18-20. 1161-1338, 35 p. This edition contains a large number of errors, many of which have survived into the printed version Nis. 1957-60. A numerical listing of the Acaryasrimadvijayadanasurisvaraji-Jainagranthamala in Av.1939-49 (v.3, 7a-b) refers to a six part set of "Srinisitha curni" published as vols 68, 23-25 of that series for free distribution, it is presumably this 1938 or 1939 edition. LD 2673 1953-54 Suttagame / carimatitthayara-pancamaganahara-Suhammayariyaviraie ; [sutthuruvena Pupphabhikkhuna sampadio. 1. avstti. Gudagamva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 195354.2 v. ; 19 cm. Nisihasuttam v. 2:849_917. ANU BL1310.58 1954 2 v. 1957-60 Sri-Visahaganimahattara-pranitam, sa-bhasyam Nisitha-sutram : Sri-Jinadasamahattara viracitaya Visesacurnya samalankstam/sampadaka Sri Amaracandraji, Sri Kanhaiyalalaji. Agra : Sanmati Jnanapitha, 1957-60.4 v. ; 24 cm. (Agama-sahitya ratna-mala ; 3, 4, 5, 6). [Tripathi 1981, 317] v.1 Pithaka. 1957. 8, 4, 191 p. -v.2 (Udd. 1-9). 1957 [2), 2, 14, 470 p. v.3 (Udd.10 15). 1958. [2], 30, 8, 594 p.--.4 (Udd. 16-20). 1960 [2], 4, (Nisitha : eka adhyayana / Dalsukh Malvania) 87, 18, 572 p. Based on Nis.1938 or 1939. Reprint. Nis. 1982a. LD Institute 1967 Nisihajjhayanam : pancami Ayara-cula / vacana pramukha Acarya Tulasi ; sampadaka Muni Nathamala. Kalakatta: Jaina Svetambara Terapanthi Mahasabha, 1967. 'tina,' 36, 8, 186, 164 p. ; 22 cm. Contents: Samarpana [1].-Antastosa (3).--Granthanukrama [5].--Prakasakiya ['eka')tina.'-Sampadakiya / Muni Nathmal [1]-6.-Bhumika / Acarya Tulasi [9]-33.Bhumika mem prayukta grantha-suci [35]-36.-Nisihajjhayanam [1]-8.-Nisihajjhayanam (text with variants).-- [1]-186.-Parisista 1. Sanksipta-patha, purta-sthala aura purtiadhara-sthala nirdesa [1]-9.-2. Sabda-suci [11]-58.-3. Visesanamanukrama (59)120.-4. Visesanama-varganukrama (121)-164. Text based on four MSS-(1) 'A.' Jaisalmer palmleaf, (photoprint), 15 p. 12th cent.; three from the "Sanghiya bhandara" (2) 'Ka.' text, curni and avacuri 46 and 86 p. dated samvat 1781; (3) *Kha.' 15 and 31 p. samvat 1711; (4) 'Ga.' of about the 18th cent. samvat.--and the NisCu. edited by Amara Muni (Nis. 1938 or 1939; 1957-60). The sources are described in the Sampadakiya, p. 4. It is not clear how this text relates to Nis. 1987, many of the sources are the same. "Mudrita prati 1100." University of Poona (31:2141 / 1516J7 / 146471 LD 6485 270
Page #293
--------------------------------------------------------------------------
________________ 1969 1982a 1982b 1987 1991 7.4 Nisiha Sri-Nisithasutram = Shree Nishith sutram: Jainacarya-Jainadharmadivakara-Sri-pujyaGhasilala-vrati-viracitaya Curnibhasyavacurirupaya vyakhyaya samalankrtam/niyojakah Kanhaiyalala. Rajakota, Saurastra: A[khila]. Bha[rata]. Sve[tambara]. Stha[nakavasi]. Jainasastroddharasamiti, Vira samvat 2495. Vikrama samvat 2025. Isvi san 1969. 20, 458, [1], 60 p. ; 3 leaves of plates; 26 cm. Prakrit text with Sanskrit chaya and Sanskrit 'Curni'.-Suddhipatram after page 458.Nisithasutrasya mulapathah p. 1-60 (3rd group). "Prati 1200." Reprint 1993. ANU PK5003.A55N5 1969 Sthavira-pungava Sri Visahagani Mahattara-pranitam, sabhasyam Nisitha-sutram: Acaryapravara Sri Jinadasa Mahattara-viracitaya Visesa-curnya samalankrtam / sampadaka Amaramuni tatha Kanhaiyalala. 2. samsodhita samskarana. Dilli Bharatiya Vidya Prakasana; Agara : Sanmati Jnana Pitha, 1982a. 4 v. ; 22 cm. (Agama-sahitya ratna-mala ; 3, 4, 5, 6). Contents v. 1: 31, [1], 87, 8, 4, 166 p. Introduction: Jain literature / B. B. Rayanade. [1]31. Sadhana ka anekanta [1].-Nisitha: eka adhyayana/Dalasukha Malavaniya [1]87. Sampadakiya / Amara Muni. [1]-8-Visayanukrama[1]-4.-Nisitha-sutram : Pithika 1-166. [facing page lists 6 appendices which are at the end of v. 4.] Contents v. 2: [1], 2, 14, 470 p. Atma-nivedana / Kanhaiyalala 'Kamala' [1]-2.-- Visayanukrama [1]-14.-Nisitha-sutram [Uddesakah 1-9] 1-470. Contents v. 3: 29, 8, 594 p. Utsarga aura apavada marga : Cheda sutrom ka marma sthala / Amara Muni [1]-29.-Visayanukrama [1]-8.-Nisitha-sutram [Uddesakah 1015] [1]-594. Contents v. 4: 3, 16, 572 p. Sampadakiya / Amara Muni; Muni Kanhaiyalala [1]-3.-- Visayanukrama [1]-16.--Nisitha-sutram [Uddesakah 16-20] [1]-443.-Parisistani. 1. Nisitha-bhasyagathanam akaradivarnakramenanukramanika Brhatkalpabhasyasya samanagathanam ankanirdesas ca [447]-535.-2. Nisithacurnau Curnikarenoddhrtani gathadipramanani [536]-541.-3. Curnau pramanatvena nirdistanam granthanam namani [542]-544.-4. Nisithabhasyacurnyantargata drstantah [545]-551-5. Nisithabhasyacurnyantargatanam visesanamnam vibhagaso'nukramanika [552]-570.6. Subhasita-sudhasara [571]-572. Reprint. Originally published: 1957-60. Some sections have been moved from v.4 of the original edition to v.1, and the plate of the BORI MS has not been reproduced. ANU BL1313.3.N58 1982 Nisihajjhayanam = Nisithadhyayana, aparanama Acaraprakalpa / sampadaka Kanhaiyalalaja 'Kamala'; preraka Vinayacandraji. Prathamavrtti. Ahamadabada: Agama Anuyoga Trasta, 1982. Vi. sam. 2039. 'nau', 224 p. ; 13 cm. Bare text reprinted from Nis.1957-60. ANU NBC 2 118 352 Navasuttani: Avassayam, Dasavealiyam, Uttarajjhayanani, Nandi, Anuogadaraim, Dasao, Kappo, Vavaharo, Nisihajjhayanam/vacana pramukha Acarya Tulasi; sampadaka Yuvacarya Mahaprajna. Ladanum, Rajasthana: Jaina Visva Bharati, Vikrama samvat 2044. I[svi san]. 1987. 140, 812, 29, 320 p. ; 4 pages of plates; 25 cm. "Original text critically edited" on the basis of four MSS:-(1) from Jaisalmer, later half of 12th cent. [V.S?]; (2)-(4) three Ladanum, V.S. 1711 [1654], 1871 [1814], 18th cent. and two printed editions: Nis. 1923; 1957-60 [=1982a]), described on p. 27-28 = 85-86 (1st group). Forms v.5 of a complete edition of the Jaina Agama. Nisihajjhayanam [663]-712. The text here may be based largely on Nis. 1967 but this is not made clear. ANU NEW BOOKS COLLECTION 1 484 435 Nisithasutra : mulapatha, Hindi anuvada-vivecana-tippana yukta / adya samyojaka tatha pradhana sampadaka Misrimalaji Maharaja 'Madhukara'; anuvadaka-vivecaka-sampadaka Kanhaiyalalaji Ma[haraja]. 'Kamala'; Sri Tiloka Muniji Ma[haraja]. 1. samskarana. Byavara, Rajasthana : Sri Agamaprakasana Samiti, Vira nirvana sam. 2517. Vikrama sam. 2048. 1991 I. 97, 458 p. ; 25 cm. (Jinagama-granthamala; 32a). 271
Page #294
--------------------------------------------------------------------------
________________ Chedasutras Contents: Prakasakiya [7].--Aprakasyom ka prakasana 9-10.--Prakkathana 11-17.Nisithasutra: eka samiksatmaka adhyayana / Upacarya Devendramuni 19-71.-Visayasuci 72-97.--Nisihasuttam 1-458.-Anadhyayakala [459] 461.-List of donors. [4 pages). ANU on order 27.11.95. Reprint of Nis. 1969. Vira samvat 2519. Vikrama samvat 2049. Isvi san 1993. 23, 458, 60 p. ; 25 cm. "Prata 250". RW 1993 Translations: Hindi 1919 Amolaka Rsi (Nis.1919) 1991 Kanhaiyalala 'Kamala, 'Muni (Nis. 1991) Studies: Devendra Muni. 1991. Nisithasutra : eka samiknatmaka adhyayana. In, Nis.1991, 19-71. Malavaniya, Dalasukha. 1957-60. Nisitha : eka adhyayana. In, Nis. 1957-60 [=1982a 1:1-87). Schubring, Walter. 1966. Drei Chedasutras des Jaina-Kanons : Ayaradasao, Vavahara, Nisiha / bearbeitet von Walther Schubring; mit einem Beitrag von Colette Caillat. Hamburg: Cram, de Gruyter, 1966. 106 p. ; 28 p. (Alt- und Neu-Indische Studien ; 11). Contents: Die Cheyasutta) 1-4.-Ayaradasao (mit Kommentar] 5-28.--Vavahara. [Text] 29-47.-Ubersetzung und Kommentar: Uddesa 1-3 into French/Colette Caillat) 48-69.- (Comments on 1-3/Schubring] 69-70.-Uddesa 4-10 translated into German/ Walther Schubring] 70-89. Varianten aus H. 89-91.-Nisiha [Einfuhrung und Analyse 92-103.-Auswahl aus dem Wortschatz 104-106. Review Colette Caillat. JA 256 (1968) 150-154. Detailed analysis and comments based on Nis. 1918 and publications since that edition: Nis. 1919; Nis. 1953-54; Nis. 1957-60 [=1982a). ANU APK5003.A55 1966 Sen, Madhu (b. 1946). 1975. A Cultural study of the Nisitha Curni. Amritsar : Sohanlal Jain Pracharak Samiti ; Varanasi: P. V. Research Institute, 1975. xiii, 409 p. ; [1] leaf of plates ; port. ; 23 cm. (Parshvanath Vidyashram series ; 21). Contents: Publisher's note fiii-iv.-Preface v-viii.-Abbreviations fix-x-Contents (xi)-xiii.--Chapter 1. Introductory [1]-15.-2. Polity and administration (16)-73.-3. Social life (741-122.-4. Material culture [123]-190.-5. Economic conditions [191]229.-6. Education, learning and literature (230)-253.-7. Fine arts 254-276.-8. Religion [277]-330.-Appendix A. Diseases mentioned in the N[isitha C[urni] [331]337.-B. Geographical names mentioned in the N[isitha C[urni] [339]-348.Bibliography (349)-359.-Index [361]-409. A revision of the authoress's thesis, Banaras Hindu University, 1968. ANU BL1313.3.N586 S46 1975 Indexes: 1957-60 (Nis. 1957-60): Nis.Bha.-BrhkappBha. concordance: v. 1. Reprinted Nis. 1982a:4. 1966 (Nis. 1966): Auswahl aus dem Wortschatz p. 104-106. 1982 (Nis. 1982a): Nis. Bha.-BrhKappBha. concordance: v. 4. Parisista. 1. Nisitha-bhasyagathanam akaradivarnakramenanukramanika Bthatkalpabhasyasya samanagathanam ankanirdesas ca [447]-535. Reprinted from Nis. 1957-60. (Nis. 1987): combined index of: Nandi. (including JogNa. and LahuNa.) AnuOg., Utt., Dasave., Av., Dasa. (including AyarDas.), BshKapp., Vava and Nis.: Parisista 3. Navasuttani saddasuci [15 505 words). p. [1]-319. 1987 272
Page #295
--------------------------------------------------------------------------
________________ Title: Mahanisithasutra (Skt). Content: Eight adhyayanas, the last two termed culiyas, 4 544 granthas (JRK, 304a). "[R]ules regarding confession and penance, which are emphasized as the most important steps towards liberation" (Winternitz 1933:2, 465). The text is ethical and disciplinary and includes legends (Schubring 1944, 40). The Prakrit is degenerate and the tradition faulty (Schubring 1935 SS52). H. R. Kapadia suggests that the Gacchayara (Prakirnaka) is based on material found in the fifth adhyayana here (BORI Cat. 17:2, 30). The work is of comparatively late composition, c. 7th cent. CE (Schubring MahaNis.study.1918; MahaNis.partial edition.1963, 1, 172; 1951). Renou notes that it is a text in mixed Ardha-Magadhi and Maharastri (L'Inde classique 1953:1, 82). References: Schubring 1935 SS52; Winternitz 1933:2, 465; JRK, 304a; Devendra Muni 1977, 404-41. Exegesis: 1 2 3 Editions: 1981 1994 7.5 MAHANISIHA (MahaNis.) Curni (JRK, 304b). Alapaka (JRK, 304b). Tabba (BORI Cat. 17:2, 36). J. Deleu comments that the Tabba of his MS of this text is of no help, its text is of later constitution and transmits corruptions of later versions (MahaNis. 1963, 7-8). *[Press-copy edition of MahaNis. edited by Vijayendra Suri of the Tapa-gaccha, prepared by Muni Jinendravijaya Gani at Jamnagar] Lakha-baval, Santipuri, Saurashtra, Vira sam. 2507 [1981]. 240 p. (Sri-Harsa-puspamrta-Jaina-granthamala; 77). [Tripathi, MahaNis. 1994, 13] "A limited xerox edition" (R. Pagariya, MahaNis. 1994, [2]). Used for the edition of 1994. Mahanisiha-suya-khandham / sampadaka Punyavijayaji; Rupendrakumara Pagariya. Jarmani mem Mahanisiha ke adhyayana aura sampadana ki eka sarveksana riporta ke satha: prastutakarta Candrabhala Tripathi. Ahmadabada: Prakrta-grantha-parisada, 1994. 73, 157, 41 p. ; 28 cm. (Prakrta-grantha-parisad granthanka; 29). Contents: Foreword / H. C. Bhayani [1].-Preface / Rupendrakumar Pagariya [2].-- [Mahanisiha studies and edition in Germany / Candrabhal Tripathi] [1]-73.-- Mahanisiha-suya-khandham 1-157.- Mahanisithasutra gatha suci [1]-18.-Visesa nama suci [19]-20.-Mahanisiha sabda suci [21]-41.-Suddhipatraka. The text "fills gaps left by Schubring in his edition .. but also offers some better readings" (p. 2) and has been established on the basis of nine MSS (1) La. Sri Lavanyavijayajiyati Jnanabhandara, Radhanapur; (2) Palm-leaf of samvat 1454, Sanghavi Pada Bhandar, Patan 111 folios; (3) Kham. Sri Santinatha Jaina Jnanabhandar, Cambay, no. 35, 243 folios; (4) Su. Acaryasri Sagaraji Maharaja Jnanabhandar, Surat; (5) "a manuscript copy of Mahanisitha corrected by Vijayamitrananda Suri"; (6-8) three MSS copies of the MahaNis. from the L. D. Institute, Ahmedabad; (9) MSS of Khartaragaccha Sri Jinakusala Suri Jnanabhandar, Ahmedabad- and three printed editions (1) Sa. "Silapattastha MahaNis. edited by Anandasagara Suri" [ie the 1941 or 1942 Agamaratnamanjusa;" (2) MahaNis.Partial editions 1951 and 1963; (3) "MahaNis. edited by Tapagacchiya Acarya Vijayajinendra Suri. Harsapuspamrta Jaina granthamala, Lakhanbavala (a limited xerox edition)." Described on p. [2]. Partial editions: 1876 RW Sri Sumati Nagila caritra tatha sanjatasanjata ane gaccha ke gacchano adhikara. Amadavada: Ranachodalala Gangarama, samvat 1933 [1876]. 155 p. ; 25 cm. MahaNis.Sections 4 (and 5?) (Schubring 1933 SS52). Contents: Prastavana [1]-6.--Anukramanika [7-8]. [Text] [1]-155. LD 12 214
Page #296
--------------------------------------------------------------------------
________________ Chedasutras 1951 Studien zum Mahanisiha : Kapitel 6-8/von Frank-Richard Hamm und Walther Schubring. Hamburg: Cram, de Gruyter, 1951. 116 p. ; 27 cm. (Alt- und Neu-Indische Studien ; 6). Contents: Inhalt [3]. [Kapitel 6 / Frank-Richard Hamm] Vorbericht 7-16.-Text] 17-38.-Varianten der Handschriften 39-41.-Anmerkungen 41-52.-Glossar 53-59. Kapitel 7-8/Walther Schubring] - Das Pacchittasutta und die Susadhakaha 1631- 74.-Text75-104.-Lesungen der Handschriften 105-107.--Die wichtigeren Worter 108-116. ANU LARGE BOOK PK5003.A55M35 1963 Studien zum Mahanisiha : Kapitel 1-5/ von Jozef Deleu und Walther Schubring. Hamburg: Cram, de Gruyter, 1963. x, 240 p. ; 27 cm. (Alt- und Neu-Indische Studien ; 10) Sources: the text based on cight MSS described 3-4. The Tabba is of no help, its text is of later constitution and transmits the corruptions of later versions (p. 7). Contents: Mahanisiha, Chapters I-III / Jozef Deleu] Preface vii.-Abbreviations ixX-A preliminary note on the Mahanisiha 1-2.-The edition of Mahanisiha : Chapters I-III 3-17.-[Text] 18-72.-Variant readings 72-77.- Translation] 78-149.--Notes 149-161.-Glossary 162-168.- Mahanisiha Kapitel 4 und 5 / Walther Schubring] Sumai-und-Naila und Navanitasara 171-174.--Text 175-205.-Varianten 206-208.[Translation 209-35.-Auswahl aus dem Wortschatz 236-40. ANU LARGE BOOK PK5003.A55M34 Susadhacariya "Chapter 8 of the Maha-Nisiha has been worked up by Devendra Suri in 519 Arya stanzas with the title Susadhakaha" (Winternitz 1933:2, 465.JRK 447-48). A MS with text and Gujarati cty listed by Schubring (1944, 578). 1918 *Bhavnagar. (Atmananda Jaina granthamala no. 67). [Schubring 1935 852] 1993 *Susadha-caritram : Yatanavisaye Cheda granthoddhstam / samsodhaka sampadakas ca Vijayajinendrasurisvarah. Prathamavrtti. Lakhaba vala-Santipuri, Saurastra : Sri Harsapuspamsta Jaina Granthamala, 1993. 39 p. ; 13 x 26 cm. (Sri Harsapuspamrta Jaina granthamala ; 259). [DK 5426. DK listing, Recent Sanskrit, Prakrit and Pali publications from India CIR-1625 / 1996-97, item 35] Partial translations: French 1963 Jozef Deleu (Adhyayanas 1-3) (MahaNis.1963, 78-149) German 1963 Walther Schubring (Adhyayanas 4-5 ) (MahaNis. 1963, 209-35) Studies: Schubring, Walther. 1918. Das Mahanisiha-sutta / von Walther Schubring : aus dem Abhandlungen der Konigl. Preuss. Akademie der Wissenschaften, Jahrgang 1918. Phil.-Hist. Klasse ; nr 5 : mit 1 Tafel. Berlin : Konigl. Akademie der Wissenschaften, 1918. 102 p. ; 28 cm. [Habilitationsschrift). Contents: 1 Einfuhrung 1-10.-2. Inhaltsangabe 10-32.-3. Ubersicht 32-50.-4. Parallelen 50-64.-5. Dogmatik 64-77.-6. Ordensregeln 78-84.--7. Sprache 84-95.8. Zusammenfassung 95-101.-Inhalt 102.--Plate (reproductions from the Berlin MSS). The Berlin manuscripts, however, were not seen as sufficient for an edition. ANU LARGE BOOK PK5003.A55M375 1918 1 CGRM lists a MS dated samvat 1593 with a version in Old Gujarati by Brahma Sisya, alias Vinayadeva Suri, disciple of Parsvacandra Suri. "The story is told in 253 verses. "The author has also written a commentary on the Jambudvipaprajnapti in which he calls himself Brahma Muni." (CGRM 106-07). 274
Page #297
--------------------------------------------------------------------------
________________ 7.6 PANCAKAPPABHASA (Panca Kapp Bha.) Although Winternitz stated that the [basic text of the) Pancakappa does not appear to be in existence any longer" (1933:2, 465), Tripathi's research indicates that there never was a Pancakalpa-sutra, nor a Pancakalpa-niryukti: "The so-called Pancakalpa-laghubhasya is nothing but an anthology of some 184 verses excerpted from the Pancakalpabhasya"? (Tripathi 1983, 121). Content: Known only from the 'cunni' and the bhasya), this text is written in gathas and deals with monastic rules (Schubring 1935 $52). References: JRK, 223a; Schubring 1935 $52; BORI Cat. 17:2, 257-62. Sanghadasa Gani, Bhasya, (grantha 2574 gathas, or 3035 slokas). Begins: vandami Bhaddabahum (JRK, 223a. JSBI, 3, 276-283; BORI Cat. 17:2, 258-61). Muni Punyavijaya prepared a handwritten copy of this text in Vi. sam. 1983 (1926). "Not published" (JSBI, 3, 276 n. 1) but see Pancakapp.1971 or 1972 below." 1971 or 1972 Pancakappabhasam = Pancakalpabhasyam / samsodhakah Labhasagaraganih. Kapadavanja, Ji[la). Kheda: Agamoddharaka-granthamala, Vira sam. 2498 [1972). Vikrama samvat 2028 (1971). Agamo sam. 23. 296, 16 p. ; 19cm. Contents: Prastavana / Punyodayasagara (3)-10.- [Concordance of Laghu bhasyanka and Mahat bhasyanka) 11-14.- Prakasakiya-nivedana (15).-Visayanukrama (16)18.-Pancakappabhasaam [1]-296.-Suddhi patram [1]-16. Text established on the basis of three MSS:-(1) in the Jainananda Pustakalaya [Surat?]; (2) in the collection of Sri Kantivijayaji, Chani (near Baroda); and (3) in the Sri Jaina Svetambara Jnanamandira. (Prakasakiya-nivedana, p. 15). "Pratayah 300." LD 18 373 Exegesis: Anonymous, (mistakenly ascribed to Amradevacarya) Curni, (grantha about 3 000). Begins: mangaladini satthani (JRK, 223b). Final verse quoted by Punyavijaya gives the grantha total as 3125 (Nandi.1966a, 7 (1st group); BORI Cat. 17:2, 257-8). "A commentary in ... Sanskrit and Prakrit on the laghubhasya of the Pancakalpasutra, a work of Bhadrabahusvamin, who extracted it from the 9th Purva" (BORI Cat 17:2, 257). 2 Pancakalpasutraparyaya, part of the Pancavastukaparyaya (BORI Cat. 17:2 261-2). Studies: Tripathi, Chandrabhal. 1983. Narratives in the Pancakalpabhasya and cognate texts. Indologica Taurinensia 11 (1983) [119]-128. 1 Cf. JSBI 3, 276. ? "It elucidates the laghubhasya (?) of the Pancakalpasutra ... no manuscript of this Chedasutra is available ... [MS versions however) exised up to samvat 1612 [1555]" (BORI Cat 17:2, 259). Posthumous publication of an edition prepared by the late C. Tripathi has been announced by Bruhn (1996, 47). Twelve verses were published in 1974 by Umakant P. Shah from "MS no. 1673, Sri Hamsavijaya's collection, Baroda, copy kindly supplied by Muni Sri Punyavijayaji." (The Jaina monk Kalakacarya : a historical figure, Adyar Library bulletin 58 (1974) [84]-101), p. 88-89.
Page #298
--------------------------------------------------------------------------
________________ 276
Page #299
--------------------------------------------------------------------------
________________ 7.7 JIYAKAPPA / JINABHADRA (Jiy Kapp.) Author: Jinabhadra,' c. Vira samvat 1115, ie. Vikrama 645 [588] (BORI Cat 17:2, 263). Title: Jitakalpa (Skt). = Sarksiptajitakalpa (JRK, 140).2 Content: 103 gathas. "Penances prescribed for the violations of rules and regulations enjoined for Jaina saints (ie. monks and nuns) in the canon" (BORI Cat 17:2, 264). It owes its inclusion in the canon more to the standing of Jinabhadra, the author of the famous Visesavasyakabhasya, than its antiquity (Schubring 1935 $52). References: JRK, 140-41; BORI Cat. 17:2, 263-80; JSB, 3, 292-98; Schubring 1935 952; Winternitz 1933:2, 465; Devendra Muni 1977, 411-17. Exegesis: Siddhasena Gani, Cunni/ Bihaccurni (Jiy KappCu.) grantha 1300 (JRK, 140a; JSBI 3, 314; BORI Cat. 17:2, 269-78). Printed in Jiy Kapp.1926. Extracts printed in Jiy Kapp.1892. Jinabhadra, Bhasya (JiyKappBha.) 2606 gathas (JSBI 3, 202-12). Printed in Jiy Kapp.1937. 2.1 Sricandra, pupil of Dhanesvara, pupil of Silabhadra Suri, Curni-visama-pada-vyakhya (grantha 1120), composed samvat 1227 [1170). Also called Tippana.''Brhaccurnivyakhya.' Begins: natva Srimanmahaviram (JRK, 140b; JSBI 3, 450-51). Cf. BORI Cat. 17:2, 276- 77. Printed in JiyKapp.1926. Bhasya in Prakrit (grantha 3125) (JRK, 140a). Same as 2 above? Vivarana in Prakrit gathas (543 granthas). Seems to be the base for Sritilaka's work (see next) and seems to be wholly incorporated into his Vitti (JRK, 140b). Srstilaka Acarya, pupil of Sivaprabha Suri, pupil and successor of Cakresvara, successor of Dharmaghosa, successor of Candraprabha Suri, Vrtti, composed in samvat 1274 [1217] (JRK, 140b; BORI Cat. 17:2, 266-67). Avacuri (JRK, 140b). Paryaya and "sutraparyaya" (JRK, 141a; BORI Cat. 17:2, 277-80). 7 Editions 1892 *Jinabhadra's Jitakalpa, mit Auszugen aus Siddhasena's Curni / von Ernst Leumann. Sitzungsberichte der koniglich preussischen Akademie der Wissenschaften (1892) 1195- 1210. Emeneau 3948; Guerinot 1906, $275) Separate printing: Berlin: Reichsdrukerei, 1893. [1], 16, 1195-1210 p. [CLIO 2, 1167] Includes translation, into German, of the first eleven verses of the commentary (Guerinot 1906, $275). 1 The Gujarati introduction to Jiy Kapp.1926 deals mainly with the life and works of Jinabhadra (BORI Cat 17:2, 265). 2 Winternitz's statement (based on Leumann?) that the Jiy Kapp. is often called Yati-Jitakalpa, to distinguish it from the Sraddha-Jitakalpa, dealing with the penances for laymen" (1933, 2:465nl) could be misleading. There is a separate work by Somaprabha, Yatijitakalpa (306 gathas) which "bodily reproduces the first twenty-four gathas (from the Jiy Kapp.) ... Hence its beginning is the same" (JRK, 316b). Kapadia notes that a commentator on the work by Somaprabha refers to it as Jitakalpa (BORI Cat 17:2, 282). Dharmaghosa's Sraddhajitakalpa (141 or 225 gathas) was composed in sam. 1357 [1300] (JRK, 388a).
Page #300
--------------------------------------------------------------------------
________________ Chedasutras 1925 1926 Siri-Jinabhadda-Khamasamana-viraio Jiyakappa /[Jinavijaya). Jaina sahitya samsodhaka 2 (1925). Apparently the first printing of the pages subsequently bound as Jiy. 1926. Each section is numbered independently, details not recorded here. [Deccan College Library, serials section] Jitakalpa-sutram Sricandrasurisandrbdha-visamapadavyakhyavibhusita-srisiddhasenaganikrta-brhaccurnisamanvitam/Srijinabhadragani-ksamasramana-viracitam: sampadaka tatha samsodhaka Muni Jina Vijaya. Amadabada : Jaina Sahitya Samsodhaka Samiti, Khrisam. 1926. Vi. sam. 1982 20, viii, 60 p. ; 1 plate ; 18 x 24 cm. (Jaina-sahitya-samsodhakagranthamala; no. 7). [CLIO 2, 1167; Emeneau 3949) Contents: Sampadakiya prastavana (5)-18.-Parisista : Silankacarya vise vaghare vigata 19-20.-Jiyakappa-suttam [i]-viii.-Siddhasenasurikarya Jiyakappa-cunni [text with variants) [1]-30.-Sricandra suriracita Jitakalpabrhaccurnivisamapadavyakhya. 3159.-Parisista 1. Prstha 53 upari sucitam Jitakalpayantram (table] [Details of sources not noted. RW] BORI 1938 Jitakalpasutram : svopajnabhasyena bhusitam : Pujyasrijinabhadraganiksamasramanaviracitam/samsodhakah Munipunyavijayah. Prathamavytti. Ahamadavada : Babalacandra Kesavalala Modi, Vira samvat 2464. Vikrama samvat 1994. 19, 224 p. ; 22 cm. Contents: Smarananjali / Punyavijaya [3]-Prastavana / Punyavijaya [41-6.Visayanukramanika [71-19.-Jitakalpasutram [1]-224 p. "500 copies)." Based on a single MS of the Limbdi Jaina Jnanabhandara. Prastavana reprinted in Jnananjali : Pujya Muni Punya vijayaji abhinandana grantha. Badodara : Sagara Gaccha Jaina Upasraya, Vira Ni. sam. 2595. Vikram samvat 2025. I. sa. 1968. Pages 136-37. LD3 The copy examined was the personal copy of Muni Punyavijaya and contains extensive corrections by him to the printed text. Many other such hand-corrected personal copies of Muni Punyavijaya are preserved in the LD Institute. A photo-copy of a listing of these editions prepared by Mr Amrut Patel of the LD Institute is in my possession. 278
Page #301
--------------------------------------------------------------------------
________________ Appendix II Major commentators on the Jain canon This Appendix is to provide references to the published editions of works by the most important commentators on the Jain canon. Silanka (fl. 850-76) Leumann (1934, 15)-followed by Bruhn-dates this commentator to 870 CE (references from Balbir 1993:1, 78). Kapadia, however, cites dates provided in manuscripts of Silanka's commentary on the first Anga, ranging from Saka 772-798 (850-876 CE). He prefers 876 CE as the most likely (1941, 197). This information is repeated by Mehata in JSBI:1 (p. 382-87). Publication details of the two canonical commentaries by this author are provided in Appendix I above, ic. under the entries for the exegesis of the Ayaranga and Suyagadanga. Abhayadeva Suri, (fl. 1058-71) Dundas has made a survey of hagiographies of Abhayadeva, focusing on Jinapala's Yugapradhanacaryagurvavali-written in 1248--and Prabhacandra's Prabhavakacarita--written in 1277 (1996, 79-84). According to Dundas, Abhayadeva may have became a Suri, that is "a senior teacher authorized to interpret the scriptures," in 1063 and then begun his ambitious commentarial enterprise (Dundas 1996, 79). The JRK, however, dates Abhayadeva's Uvav.cty to samvat 1115, 1058 CE, but does not cite its source. There is a short article on Abhayadeva: 1957 Vrttikara Abhayadevasuri/Risabhadasa Ramka p. [462] 465. In, Srimad Rajendrasuri smaraka-grantha / samyojaka Yatindrasuri ; sampadaka-mandala Agaracandaji Nahata, Dalasukhabhai Malavaniya, Daulatasimha Lorha 'Aravinda, Balabhai Viracandra 'Jayabhikhu', Aksayasimha Dangi. Ahora (Maravara-Rajasthana): Sri Saudharmabshattapagacchiya Jaina Svetambara Sri Sangha, Vira samvat 2482: Vikrama samvat 2013: I. san 1957: Saka samvat 1878: Rajendra samvat 50.26 cm. 39, 875 p. ; [28] leaves of plates : ill. ; 26 cm. Works Sthanarga-sutra-bhasya Samavayanga-sutra-vrtti Bhagavati-sutra-vrtti (also called -tika, -vivrti, -vivarana) Jnata-dharma-katha-vivarana Upasaka-dasa-vivarana Anuttaropapatika-dasa-vrtti Antagadadasao Prasnavyakarana-vivarana (also called -vivsti) Vipaka-sutra-vrtti Aupapatika-sutra-vrtti Prajnapanopanga-ttiya-pada-sangrahani 1 The dates cited are those used in the Introduction (p. lxxviii onwards). Tripathi 1981, 305 lists details of another work ascribed to Abhayadeva, the Bandhasattrimsika published 1918-21. 279
Page #302
--------------------------------------------------------------------------
________________ 1 Jayatihuana-stotra Parsva-jina-cintamani-stuti Saptatika-bhasya Jayanta vijaya Commentary on Jinacandra Ganin's treatise, Navatattva-prakarana, about 1063 CE. (Winternitz 1933:2, 588). Commentary on Haribhadra's Pancasaka. The date for this given in the JRK (p. 231a) is samvat 1124 [1067). Canonical commentaries Sthananga-sutra-bhasya: Tika / Vivarana, composed samvat 1120 [1063], 14 250 granthas. Begins: Sriviram Jinanatham. (BORI Cat. 17:1, 62-63; JRK 454-55). Printed Thana. 1880, 1918-20 [ =1985b); 1937. (References are to Appendix I above). Gujarati translation in Thana.1951. 1.1 Sumatikallola and Harsanandana, pupils of Samayasundara of the Kharatara Gaccha, Vivarana on the gathas in Abhayadeva's tika (JRK 455). Samavayanga-satra-vrtti: the author was a pupil of Jinesvara Suri of the Kharatara gaccha. The commentary variously termed Vitti, Vivrti Tika was composed in samvat 1120 (1063) It begins: srivardhamanam anamya (JRK 420). Translated into Gujarati Samav.1938b. Printed. Samav.1880; 1917; 1918; 1938a; 1985b; 1989. Bhagavati-sutra-vrtti (also called fika, -vivrti, -vivarana): composed in 1128 [1071] with the help of Yasascandra Gani, and revised by Dronasuri. (Schubring 1944,9; JRK 290; BORI Cat. 17:1, 86). Extent: 15 616 Slokas, It mentions a mula tika and the "curnikara" a number of times (Viy.1994_<1996?>, Bhumika 1, 38-39). Printed. Viy.1881, 1917-31, 1918-21, 1994. Viy.partial edition. 1876; 1937-40; 1954. Jnata-dharma-katha-vivarana: Vrtti, composed samvat 1120 [1063). Printed. Naya.1876; 1919; 1951-52; 1987. Upasaka-dasa-vivarana: composed samvat 1120 [1063] (Hoernle, Uvas. 1880-90:2, xxi). Printed. Uvas. 1876; 1880-90; 1920a; 1920b; 1935. Translated into Gujarati Uvas.1935. 6/7 Anuttaropapatika-dasa-vitti and Antagadadasao: a collective cty on the Uvasagadasao, the Antagadadasao and the Anuttarovavaiya, very likely composed samvat 1127 [1070), which is stated at the end of the Anuttarovavaiya commentary (Hoernle, Uvas. 1880-90:2, xxi). Antag.cty Printed: Antag.1920; 1932b. Translated into Gujarati Antag. 1933. Anuttaro.cty Printed: Anuttaro. 1920; 1921; 1984. Gujarati translation Anuttaro. 1933. Prasnavyakarana-vivarana (also called -vivrti): Tika, corrected by Dronasuri (JRK 274). Printed. Panha.1876; 1919; 1989. Vipaka-sutra-vrtti: Vrtti (JRK 357). Printed. Viva.1876; 1919; 1920a; 1935a. Aupapatika-sutra-vrtti: composed samvat 1115 [1058] (date from JRK 64a). Printed. Uvav.1879; 1916; 1985. Prajnapanopanga-trtiya-pada-sangrahapr: a partial commentary. Prajnapana-trtiyapada-sangrahani= Samgahani, 150 granthas (BORI Cat. 17:1,205). Begins: disigai indiyakae (JRK 258; Pannav.1969-71:2, 426). 1917-18 Navangi-vrtti-kara-Srimad-Abhayadeva-Suri-racite Panca-nirgranthi-Prajnapanopangatrttiya-pada-sangrahani-prakarane (savacurnike)/Muni-Caturavijayena samsodhite. Bombay : Nirnaya-sagara Press, 1974 [1917-18]. 2, 16, 26 sie. 4, 32, 52] p. ; 12 x 27 cm. (Jaina-Atmananda-grantha-ratna-mala ; no. 62). [CLIO 3, 1849) 280
Page #303
--------------------------------------------------------------------------
________________ Other works 12 1890 1916 1919 13 1923 14 1919 15 1902 16 17 Jayatihuana-stotra: Jayatihuanastotra. Ahmedabad, 1890. [Guerinot 1906 SS431] Text with cty of Ramacandra Dinanatha and a Gujarati gloss by Giridharalala Harabhai. Abhayadeva-Suri krtam Jayati-huana-stotram : Samayasundaropadhyaya-krta-vyakhyaya samalankrtam/Muni-Sukhasagarena samsodhitam. Bombay: Nirnaya-sagara Press, 1916. 2, 12 [ie 4, 24] p. covers; 26 x 12 cm. [CLIO 2: 1158] Jayati-huana-stotra, p 101-115 in Sri-Nitya-smarana-stotra-sangraha [Gujarati-bhasa-padya sameta]: nava-smarana tatha hammesa ganava layaka stotro chando Tattvartha-sutra tenum parisista tatha snatra-puja astaprakari puja ... vigere. 2nd ed. Ahmedabad: Santi-vijaya Press, 1919. 19, [1], 336 p. (plate). [CLIO 3:1792] Parva-jina-cintamani-stuti: 2 In Pracina-Jaina-stotra-sangraha. Agra: Sarasvati Press, 1980 [1923]. [2], 2, 48 p. (plates); 16 x 12 cm. [CLIO 3:1929], no. 7. Saptatika-bhasya: the Saptatika itself is by Devendra Suri and Candrarsi Mahattara (but this seems not have been published separately). Sri-Abhayadeva-Suri-viracitam Sri-Saptatika-bhasyam. Sri Merutungacarya-racita-tikasamvalitam. Bombay: Nimaya-sagara Press, 1919. 7, 128 [ie 14, 256 p.]; 25 x 13 cm. [CLIO 4:2367] Jayanta vijaya: Jayantavijaya/edited by Pandit Bhavadatta Sastri and Kasinatha Pandurang Parab. Bombay: Nirnaya-sagara Press, 1902. 7, 139 p. Kavyamala; 75. [Emeneau 4047] Cty on Jinacandra Ganin's treatise, Navatatttva-prakarana: about 1063 CE. [Winternitz 1933:2, 588] Cty on Haribhadra's treatise, Pancasaka-sutra / -prakarana: composed samvat 1124 (JRK 231a). 1912 *[Pancasakasutra : with Abhayadeva's cty. Bhavnagar: JDPS, 1912]. [Schubring 1935, $210; JRK 231a] Malayagiri, (c.1093-1193) Malayagiri was one of the most prominent Svetambara scholars, he is famous as a contemporary of Hemacandra.3 See also Pannav. 1969:2, 426-431 and Peterson Report IV, p. lxxxviii (Winternitz 1933:2, 592). Pandit Sukhalala Sanghavi (1880-1978), in the introduction to his Tattvarthasutra (1974, 62) refers to the introduction of the *Dharmasangrahani (presumably the edition of 1916 by Muni Kalyanavijaya) for information on the works of Malayagiri. 1 Avasyaka-vivarana: (incomplete)- slokapramana 18 000 [Devendra Muni 1977: 525] See Devendra Muni 1977 532-533. Begins: patu nah Parsvnathasya. Printed. Av. 1928-36. Bhagavati-vrtti: a vrtti on the second sataka only of the Viyahapannatti (JRK 290). Slokapramana 3750 (Devendra Muni 1977: 525). 3 Brhatksetrasamasa/Ksetrasamasatika: slokapramana 9500. [Devendra Muni 1977: 526] 1920-21 Jinabhadragani. Srimaj-Jinabhadra-Gani-Ksamasramana-vinirmitah Brhat-ksetra-samasah: Sriman-Malayagiri-Suri- ... sutritaya vivrtyopetah. Bombay: Nirnaya-sagara Press, 1977 [1920-21]. 2, 269, [1] [ie 4, 538, 2] p. ; 25 x 12 cm. oblong. [CLIO 1:552] 3 Sources for this listing of his works: (1) Bechardas J. Doshi's introduction to Malayagiri's Sabdanusasana 1967 (2) Devendra Muni 1977, 524-534-(3) CLIO indexed under Malayagiri. 281
Page #304
--------------------------------------------------------------------------
________________ Reprint. 1987 or 1988. 1987 or 1988. Jinabhadragani. (Samayakkhettasamasa). Brhatksetrasamasah / Jinabhadragani ksmaksamna vinirmita ; Malayagirisuriviracitavrtyupetah. Mumbai: Sri Jinasasana Aradhana Trasta, Vura samvat 2514[1988]. Vikrama samvat 2044 [1987].27 x 11 cm. 269 [ie. 538) p.; 12 x 28 cm. In Prakrit; prefatory matter in Gujarati; commentary in Sanskrit. Verse work on Jaina cosmography. Reprint of 1920-21 edition. ANU BL1375.C6J57 1987 Brhatkalpa (Vrtti on the Kalpasutra): Brhatkalpapithikavrtti (incomplete)- slokapramana 4600 [Devendra Muni 1977: 525] See Devendra Muni 1977 533-534. Malayagiri, Tika, completed by Ksemakirti, pupil of Vijayendu of the Candrakula, in samvat 1332 [1275). (JRK 284b; BORI Cat. 17:2, 237-44; JSBI 3, 454) Schubring states that Malayagiri's work was continued by Balasirahsekhara and gives Ksemakirti as the author of a separate Vrtti (Schubring 1935, $51). Printed in BIhKapp. 1933-42. Brhatsangrahani-vrtti on Jinabhadragani's Brhatsangrahani: Slokapramana 5 000 [Devendra Muni 1977: 526] 1917 * Sri-Malayagiri-Sari-viracita-vrtti-yuta, Bhagavac-Chrimaj-Jinabhadra-Gani.... samdrbdha Brhat-samgrahani. ... Pannyasadana-Vijaya-Ganina samsodhita. Bhavanagar : Jaina Atmananda Sabha, 1973 [1917). f. [1], 7, 159, [1];27 x 12 cm. oblong. (Jaina-Atmanandagrantha-ratna-mala ; no. 47). [CLIO 1: 553] Printed Bombay: Nirnaya-sagara Press. 1987 *Brhatsangrahani / Jinabhadraganiksamaksamana-viracita ; Malayagirisuri viracitavitti sahita; samsodhakah Vijaya Danasurisvarah. Bambai : Sri Jinasasana Aradhana Trasta, 2514 [1987]. 6, 142 [ie. 12, 284) p. ; 13 x 28 cm. [DKS-4642. DK Agencies Recent Sanskrit, Prakrit and Pali publications Ref. No. CIR-1432 / 1994-95, item 35] Candraprajslapti: slokapramana 9500 [Devendra Muni 1977: 525) Devendraprakarana: "Devendranarakendraprakarana, by Cirantanacarya ie, by some ancient acarya whose name was unknown even to the commentator. It consists of 378 gathas in Prakrit and is published in the Jain Atmananda Sabha series, Bhavanagar, (Series no. 74), 1922, together with the commentary by Municandra ... Tika by Malayagiri. This is mentioned by Malayagiri in his commentary on gatha 263 of Jinabhadra's Brhatsangrahani. No MSS. of it are so far known." [JRK 180b] Dharmasaraprakarana: (not extant) Dharmasangrahani: slokapramana 10 000 [Devendra Muni 1977: 526] 1916 Haribhadra Suri. Dharmasangrahani. Haribhadra-Suri-viracita ... Malayagiri-pranitaya tikaya samalarkrta Dharma-sangrahanih/ samsodhakah ... Kalyanavijaya-Munih. Bombay: Nirnaya-sagara Press, 1916.2 v.: 27 x 12 cm. (Sresthi-Devacandra-Lalabhai-Jaina pustakoddhara ; no. 39). [CLIO 1, 761] Part I: 1916. f.[1], 210,1 plate 12 x 27 cm.- Part II: 1918 f. [1], 49, 211-451, [1]. Jambudvipaprajnapti: not extant (Devendra Muni 1977: 526). Jyotiskarandaka: -Slokapramana 5000 [Devendra Muni 1977: 525] See Devendra Muni 1977 528-529. - Jyotiskarandaka, on astrology (grantha. 1 830), is sometimes regarded as a Prakirnaka. Published with the commentary of Malayagiri (grantha. 3 150), Ratlam, 1928. [JRK 150b] 1928 Vallabhiyacaryiyam Sri-Jyotiskarandakam prakirnakam sriman-Malayagiry-acarya-ksta vrtti-yuktam. Ratlam, 1928. 8, 266 p. ; 13 x 27 cm. [CLIO 2 : 1202] Printed. Indore : Jaina-bandhu Press. 282
Page #305
--------------------------------------------------------------------------
________________ Jivajivabhigama: aTika on Jivajivabhigama (grantha. 14 000). [JRK 144] Printed in the editions of 1883, 1919. The 1987 edition used one manuscript with this Tika. Slokapramana 16 000 [Devendra Muni 1977: 525). See Devendra Muni 1977 529-530. Karmaprakyti: slokapramana 8 000. [Devendra Muni 1977: 526] 1913 Sivasarman Acarya. Karmapraksti Malayagiri-viracita-tika-samyukta-... Karma-prakrtih/ Srimacchivasarmacarya-pada-pranita (edited by Sagarananda). Bombay : Nirnaya-Sagara Press, 1913. f. 6, 3, [1], 1 plate, 219, [1] : 12 x 26 cm. (Sresthi-Devacandra-Lalabhai-Jaina-pustakoddhara; no. 17). [CLIO 2 : 1256; DLJP series list) Nandi-sutra-tika (it mentions both the NandiCu. and Haribhadra's Vivarana) 7 732 granthas (JRK 201; Devendra Muni 1977: 527).4 A manuscript of this cty is dated 1235 CE (Winternitz 1933:2, 592n.2). There is an incomplete reference to a published edition: Nandisutra with the commentary of Malayagiri, s.l. s.d. (Balbir 1993, 22). Printed Nandi. 1878; 1916; 1924; 1969; 1987b. Studies: Jambuvijaya, Muni. 1994. Quotations in Malayagiri's commentary on the Nandisutra = Jainagamasya Nandisutrasya Acaryasri Malayagirisuriviracitayam vrttau uddhstanam darsanikanam pathanam mulasthanani. WZKS 38 (1994) 389-401. Identification of more than 75 quotations, some have been matched to sources such as the Vartalankara, Sastra vartasamuccaya, Mimamsaslokavartika, Vaisesikasutra, Pramanavartika, Tattvarthakarika, etc. Oghaniryukti commentary. [Devendra Muni 1977, 526] Pascasangraha commentary: slokapramana 18 850.[Devendra Muni 1977, 526] 1919 Candramaharsi Mahattara. Pancasamgraha. Candrarsi-Mahattara-Surisvara-sandrbdhah sriman-Malayagiri-Suri-viracita-Vrtti-sametah Panca-sangrahah/Danavijaya-Gani-samsodhitah. Bombay: Nirnaya-Sagara Press, 1919. f. 11). 246 ; 12 x 26 cm. oblong. (Sri-Atmananda-grantha-ratna-mala ; no. 50) (CLIO 1855] 1937 *[Pancasangrahatika. Ubhoi (Gujarata): Sri Khubacanda Panacanda, san 1937). [Nirukta kosa / vacana pramukha Acarya Tulasi; pradhana-sampadaka Mahaprajna ; sampadaka Sadhavi Siddhaprajna, Sadhavi Nirvanasri, 1984. p. 25 (first group)) Pindaniryukti commentary: See Devendra Muni 1977 532. Tika 6 700 granthas (JRK 249). Printed in PindNi.1918; translated into Gujarati, PindNi.1962. Prajnapana: See Pannav. 1969:2, 426-431. Vitti (15 000, 14 000 slokas) (BORI Cat. 17:1, 200-201), 14 500 (JRK 258). Malayagiri discusses textual variants in this commentary (Pannav.1969-71, 426-31, 436 40). The 1983-1984 edition has a translation into Hindi based on Malayagiri. Slokapramana 3750 [Devendra Muni 1977: 525] See Devendra Muni 1977 527-528. Printed. Pannav.1884;1918-19 (=1988). Translated into Gujarati Pannav.1934 Rajaprasniya-fika or-Vrtti: 3 700 / 3 500 / 3 650 granthas including text (JRK 330). See Devendra Muni 1977 531-532. Printed. RayPa. 1879; 1925; 1937; 1937 or 1938; 1938. Partial edition 1936. Commentary on the Sadasiti: this is Malayagiri's shortest vrtti. Slokapramana 2 000 [Devendra Muni 1977: 526] 1915 Garga Acarya. Karmavipaka. Satikas catvarah pracinah karma-granthah [(1) Karma-vipaka by Garga; (2) Karma-stava; (3) Banda-svamitva ; and (4) Sad-asiti or Agamika-vastu-vicara-sara by Jinavallabhal. Mula 4 A section of the commentary (the refutation of theism) is given by F. C. Schrader, Uber den Stand der indischen Philosophie zur Zeit Mahaviras und Buddhas, p. 62 ff. (Winternitz 1933:2, 472n.2). 283
Page #306
--------------------------------------------------------------------------
________________ 21 1909-1 1919a Karma-stava-Sad-asiti-[Praksta-]bhasyair upabrmhitah... Caturavijayena sodhitah. [The book also comprises Sanskrit commentaries on (1) by Paramananda and an anonymous commentator, on (2) by Govinda Ganin, on (3) by Haribhadra and on (4) by Haribhadra and Malayagiri). Bombay: Nirnaya-sa gara Press, 1915). f. 13,[1], 68, 29, 18 x[1][?), 87, 20,[1]: 12 x 26 cm. (Atmananda-grantha-ratna-mala; no. 52). [CLIO 2: 1258) Saptatika: slokapramana 3750 [Devendra Muni 1977: 526] *[Edited with the Devendra Suri's own commentaries on Books 1-5 and commentary by Malayagiri in Book 6, by the Sri-Jaina-Dharma-Prasaraka Sabha, Bhavnagar 1909-11. [Winternitz 1933:2, 591 n.6] Suryaprajnapti: slokapramana 9500. [Devendra Muni 1977: 525] See Devendra Muni 1977, 528. * Sriman-Malayagiry-Acarya-vihita-vivarana-yutam Sri-Surya-prajnapty-upangam .... foll. 4.[1], 297 ; 26 x 12 cm. oblong. Mahesana : Agamodaya Samiti, 1919. (Agamodaya Samiti series, no. 24). [CLIO 4: 2658. JRK 452. JL 2: 18 (3rd group).] Printed: Bombay, Nirnayasagara Press. [Emeneau item 3932] Tattvarthadhigama commentary: not extant (Devendra Muni 1977: 526] Visesavasyaka-(tika): not extant (Devendra Muni 1977: 526 Vyavahara-tika: 33 625 granthas, Malayagiri's longest commentary (JRK 367b; BORI Cat. 17:2, 49-50). See Devendra Muni 1977 530-531. A manuscript of this cty is dated 1253 CE (Winternitz 1933:2, 592 n.2] Printed in Vava.1928. Sabdanusasana (Sabdanu.): a grammatical work, slokapramana 5 000 (Devendra Muni 1977: 526). Sabdanusasanam: svopajnavrttiyutam/sampadaka Becaradasa Jivaraja Dosi. Amadavada: Lalabhai Dalapatabhai Bharatiya Samskrti Vidyamandira, 1967. 8, 19, 563, 46 p. ; 25 cm. (L.D. series; no. 13) Initial matter 1-8.-Introduction /Bechardas J. Doshi 1-19.-Text. 1-418.- Appendices 418-563. Further appendices, index and corrections. 1-46. "500 copies" 1st publication. ANU PK541.33 1967 Sricandra Suri, fl. 1103-1171 See the Introduction (p. Ixxxiv) for further details on these works. CE 1112 Nyayapravesa-panjika samvat 1169 1116 ithacurni-durgapadavyakhya samvat 1174 1121 Pindavisuddhiprakaranavstti samvat 1178 1165 Sraddhapratikramanasutravrtti samvat 1222 <1169 Nandisutralaghuvsttidurgapadavyakhya < samvat 1226 (MS date) 1170 Jitakalpabrhaccurnivisamapadavyakhya samvat 1227 1171 Nirayavalikavivaran samvat 1228 Subodha-samacari 1 Nyayapravesa-panjika: 1930 [1968] The Nyayapravesa : part 1 Sanskrit text with commentaries (of Haribhadra and Sricandra (Parsvadevagani)]: critically edited with notes and introduction by Anandshankar B. Dhruva. Baroda : Oriental Institute, 1968. xxxvii, 92, 104 p. ; 24 cm. (Gaekwad's Oriental series ; no. 38). 5 Sources: JSBI 3:449-451;-JRK;-Nandi. 1966, Introduction. 284
Page #307
--------------------------------------------------------------------------
________________ 1982 Contents: Introduction. i-xxxv.-Books of reference. xxxvi.--Nyayapravesakasutram 1-8.-Nyayapravesakvrtti / Haribhadra. 9-37.-Nyayapravesakavsttipanjika 38-82.Notes 1-104. First edition 1930. "Second edition (reprint). Copies 500." JJRK 220, see Emeneau and CLIO entry). The start of the Panjika is missing from the manuscript used as the basis of the text. (p. 3 (second group)). Part 2 containing a Tibetan translation of the Sanskrit text, edited by Vidhusekhara Bhattacharyya, was published in 1927, as Gaekwad's Oriental series no. 39 (Foreward / B. J. Sandesara). The Nyayapravesaka vrttipanjika covers p. 38-82. Some comments on the Panjika are given in the notes discussing the main text, p. 1-104 (second group). ANU PK2971.G3D55 Nisithacini-durgapadavyakhya on the 20th uddesaka of the Visesacurni. Written in samvat 1174 [1117]. Sthavira-pungava Sri Visahagani Mahattara-pranitam, sabhasyam Nisitha-sutram: Acaryapravara Sri Jinadasa Mahattara-viracitaya Visesa-curnya samalankrtam / sampadaka Amaramuni tatha Kanhaiyalala. Dilli : Bharatiya Vidya Prakasana ; Agara : Sanmati Jnana Pitha, 1982. Dvitiya samsodhita samskarana. 4 v. (Agama-sahitya ratna-mala ; 3, 4, 5, 6). v. 1.31, 166 p.--v. 2. 2, 14, 470 p.--v. 3. 29, 8, 594 p.--v. 4.3, 16, 572 p. ANU BL1313.3.N58 1982 [The citation for Sricandra's part is, v. 4. p. 413-43.] Pindavisuddhiprakaranavrtti: written samvat 1178 [1121]. [JRK 250) Sraddhapratikramanasutra vrtti: written samvat 1222. [JRK 390 item 4.] Nandisutralaghuvttidurgapadavyakhya: a commentary on Haribhadra's Vivarana. Sricandra wrote it before samvat 1226, since a manuscript with that date exists. It is also called VrttiTippana (grantha. 3 300), and Durgapadavyakhya. [JRK 2013 Printed Nandi.1966b ;1969. Jitakalpabrhaccurpi-visamapadavyakhya: * Jita-kalpa-sutram SricandrasurisandrbdhavisamapadavyakhyavibhusitasrisiddhasenaganikTtabrhaccurnisamanvitam / Srijinabhadraganiksamasramanaviracitam : sampadaka Muni Jinavijaya. Ahmedabad; Jaina Sahitya Samsodhaka Samiti, 1926. 1 plate, 20, viii, 60 p. ; 24 x 18 cm. (Jaina-sahitya-samsodhaka-grantha-mala; no. 7). [CLIO 2: 1167. Emeneau 3949] Printed. Bombay: Nirnaya-sagara Press. Nirayavalila-vivarana: Printed NirayavSu.1885; 1922 ( = 1934, = 1938). Subodha-samacari: Srisubodhasamacari / Srimacchricandracarya-sankalita. Bombay : Sresthi-DevacandraLalabhai-Jaina-Pustakoddhara Fund, Bhagavanmahaviranirvanasamvat 2450. Kraista san 1924. Vikrama samvat 1980.2, 49 sie 4,98) p. ; 12 x 28 cm. (Sresthi-Devacandra LalabhaiJainapustakoddhara Fund series ; no. 62). [CLIO 4:2627] "Prati 1000." BORI 2 765 /LD Pa. 19 297 Reprint. Mumbai : Sri Jinasasana Aradhana Trasta, 2045 (1988). 14 x 28 cm. *Srisubodha-samacari / Sricandracaryasankalita. Mumbai : Sri Jinasasana Aradhana Trasta, 2045 (1988). 48 [ie. 98] p. ; 12 x 27 cm. [DK 4478. DK listing 1988-96, item 574] *Samacari prakaranam : Purvatarakalinasrimadacaryapurandaravihitam : srimacchricandracarya-sankalita Srisubodhasamacari ca / sampadakah samsodhakas ca Vijayajinendrasurisvarah. Prathamavsttih. Lakhabavala, Santipuri, Saurastra : Sri Harsapuspamsta Jaina Granthamala, 1993. [8], 164 p. ; 13 x 25 cm. (Sri Harsapuspamsta Jaina granthamala ; granthankah 277). DK 5425. DK listing, Recent Sanskrit, Prakrit and Pali publications from India CIR-1625 / 1996-97, item 70] 1926 1924 1988 1993 285
Page #308
--------------------------------------------------------------------------
________________ App en dix III The works of Muni Ghasilala (1884 or 85-1973) Muni Ghasilalaji spent much of his life preparing editions of canonical texts. He also produced a number of other works, not all of which have been published. I have been able to piece together the following list of his works from published materials and from searches in libraries. If a work does not have a date of publication I have not traced any published edition. For additional details on this monk and his works see the Introduction (p. xxvii-xxviii), where details of the sources for this information are given. 1. Canonical works (full details of these publications are given in the relevant section of Appendix I above): Ayar.1952-57 Suy.1969 Thana. 1964-66 Samav.1962Viy.1961-72 Naya.1963 Uvas. 1936 (3rd ed. 1961) Antag. 1950 (2nd printing 1958) Anuttaro. 1948 (reprint. 1959) *Panha. 1962 Viva.1952 (reprint 1959) Uvav.1959 RayPa.1965-66 *Jivabhi.1971-? *Pannav. *Jambuddi. *SuraP./CandaP.1973 NirayaSu.1948 Nandi.1958 AnuOg. 1967 Utt. 1959-61 Dasave. 1942 (reprint 1957-60) Av.1951 Kapp.1970-73 Dasa. 1952 *BIhKapp. Vava.1959 Nis. 1952 (reprint 1969) *MahaNis. 2. 1973 Other works Tattvarthasutram / Ghasilalaji Maharajah viracita Dipika-niryukti vyakhya dvayopetam Hindi Gurjara bhasanuvadasahitam. Vira samvat 2499. Vikrama samvat 2029. Isvi san 1973. 2 v. : ill. : 25 cm. Contents v. 1 Adhyayas 1-5: Tattvarthasutra ki visayanukramanika [1]-7. -- Tattvarthasutra Bha. 1 na Gujarati vibhagani visayanukramanika (1)-4. - (Sanskrit 286
Page #309
--------------------------------------------------------------------------
________________ text and Hindi translation] [1]-670.-(Gujarati translation] 1-330. Contents v. 2 Adhyayas 6-9: Tattvarthasutra bhaga dusare ki visayanukramanika [1] 8. Sanskrit text with Hindi and Gujarati translations (1)-878. "Prati 1200." RW *Nyaya ratnasara (a series of four works each in six adhyayas for use in preparing for examinations in Nyaya). * Praksta cintamani (Prakrit grammar). * Praksta kaumudi (a work in five adhyayas illuminating the Prakrit language). *Arhat vyakarana (Sanskrit grammar in two parts, one on Laghu-siddhanta-kaumudi, the other on te Siddhanta-kaumudi). *Srilala namamala kosa (a dictionary of modern words, including some English terms. *Nanarthodaya sagara kosa. *Siva kosa (a dictionary like the Amarakosa) 1973 Sri Sivakosa / Sri Ghasilalaji Maharaja viracita. Amadavada : Karunasankara Venirama Pandaya, Vira samvat 2501. Vikramasamvat 2033. Isvisan 1976. 12, 375 p. ; 19 cm. Contents: Prakasakiya nivedana (3)-5. -- Suddhi patra 6-12. -- Sivakosah 1-375. Verse compilation of words, arranged by topic: Deva varga, Sura varga, Vyomavarga, Samayavarga, Mativarga, Vanivarga etc. Original in Sanskrit with Hindi version below. **Prata 1000." *Ganadharavada (mula, Praksta gatha, Sanskrit chaya, a Sanskrit cty on them). *Grhi dharma kalpataru (mula Prakrta gathas, Sanskrit chaya and Hindi and Gujarati exposition (vivecana). *Jainagamatattva dipika (Hindi equivalents of Jain technical terms). *Tattvapradipika (full exposition of the nava tattvas, original Prakrit gathas, Sanskrit chaya and Hindi exposition) RW 3 Poetical works Lorikasahacarita 1983 Srilorkasahacaritam/Ghasilalaji-Maharaja viracitam Hindi-Gurjara-bhasa'nuvadasahitam ; niyojakah Srikanhaiyalalaji-maharajah. 1. avrtti. Ahmadabada : Sri Akhila). Bharata). Sve(tambara). Stha[nakavasi) Jainasastroddharasamiti, Vira samvat 2509. Vikrama samvat 2040. Isavisan 1983. 16, 456 p. ; 25 cm. Contents: Bhumika / Kanhaiyalala Muni (3)-16. - Srilo[n]kasahacaritam [1] 456. An original poem written in 1600 Sanskrit slokas, in fourteen sargas on the life of Lonkasaha who founded the Lonkagaccha, precursor of the Sthanakvasi sect, in VS 1451 [1394]). This mahakavya was completed in samvat 2029 [1972). "Prata 1000." RW * Santi sindhu mahakavya (15 ullasas) *Moksapada (a compilation of Prakrit verses akin to the Dhammapada, with Skt chaya and Hindi and Gujarati translations) * Srilaksmidhara caritra (Prakrit with Sanskrit and Hindi) Stotras (Ghasilala's biography give titles of 18 and ends "ityadi ..."). These were apparently published from time to time as 18 pamphlets (pustika") (Kanhaiyalala, in the published version of Ghasilala's Lonkasahacarita cited above, 1983, 8). 287
Page #310
--------------------------------------------------------------------------
________________ Appendix IV Extant manuscripts of the Nira ya valiya suy a k khandha and its exegesis Ultimately our sources for Jain scriptural works are the manuscripts (MSS) prepared and passed down by Jain tradition. This Appendix presents a provisional census of the manuscript sources for the two texts presented in this edition, ie. the Niraya valiyasuyakkhandha and its commentary. Also marked are those manuscripts used to establish the text here. There are two starting points to locate manuscripts of Jain works--both modelled on Aufrecht's great work (Catalogus catalogorum 1891-1903, (see Janert 1965, 21-22))--the first is Velankar's Jinaratnakosa : an alphabetical register of Jain works and authors (= JRK) (1944), and the second the New catalogus catalogorum (v. 1 <12> 1966<1988>). These listings need to be supplemented by consulting themore recently published manuscript catalogues. Janert (1965) is the definitive listing of Indian manuscript catalogues. Biswas (1998) can be seen as an update to Janert, although it does not keep to the same rigorously accurate and detailed standards of description. Velankar (1893-1963) planned the JRK in two volumes, a title listing and a separate author listing, but only the first volume ever appeared. He listed 121 sources for his information; some of them were standard published reports and catalogues but many of the sources were handlists, some prepared solely for his use. The whereabouts of many manuscripts he listed is no longer traceable. As he states (Preface [il-ii), he was not able to visit all the collections personally, and so a considerable number of his entries are based on unverified second-hand information. Nevertheless, no investigation of Jain literature in Sanskrit and the Prakrits is possible without consulting Velankar's JRK. I have been able to locate and obtain copies of 22 manuscripts having entries in the JRK, and about 35 of those having entries in NCC (there is some overlap of course). The New catalogus catalogorum is too well-known to need any introduction here. For Jain manuscripts the most important supplementary sources are the catalogues of the Patan, Jaisalmer and Khambhat collections detailed below. The material present here has the following sub-divisions: Manuscripts of the mula listed in the JRK (p. 213). Manuscripts of Sricandra's commentary listed in the JRK (p. 213). Manuscripts of the mula listed in the NCC (v. 8 p. 136-37) Manuscripts of the commentaries listed in the NCC ( v. 8 p. 136-37) Manuscripts in Patan (North Gujarat) 5.1 Catalogues of the manuscripts held in Patan 5.2 Palm leaf and paper manuscripts of the mula and commentary from Patan Manuscripts in Jaisalmer (Rajasthan) 5.1 Catalogues of the manuscripts held in Jaisalmer 5.2 Palm leaf and paper manuscripts of the mula and commentary from Jaisalmer Manuscripts in Khambhata (=Cambay) (Gujarat) 7.1 Catalogues of the manuscripts held in Khambhata 7.2 Palm leaf manuscripts of the mula and commentary from Khambhata 288
Page #311
--------------------------------------------------------------------------
________________ Reference list of JRK/NCC entries showing manuscript siglia used in the critical edition given above 1 Manuscripts of the mula listed in the JRK (p. 213). The JRK listing is in two parts: (1) manuscripts of the mula; (2) those of Sricandra's commentary. Mula Ref. no. here B1 B2 F M 2 3 JRK ref. *Agra no.s 192-96 *A[nantanatha]. M[andira]. 77; 122; 164; 186; 207 *[Asiatic Soceity of] Bengal 4329 6785 (mula and cty)' 6977 (mula and cty)' 7613 *BO. p. 60 [Bhandarkar Institute] *BSC No. 460 *Buh III [Collection of 1872-73] no. 112 *Buh IV [Collection of 1873-74] no. 158 *D[ela Upasraya Bhandar] A 13 (16-22) *D[ela Upasraya Bhandar] B 6 (10; 11) *DC. p. 33 [catalogue Dalal 1923] *Flo. no. 518 (mula and cty) *Hamsa nos. 868; 1132 *JA [Santinath temple] 14 (2) *JB [Jnanavimalasuti bhandar] 47; 48 *Jesal. nos. 423; 553 (mula and cty) *JHA 29 (4c) *JHB 15 (5c) *[Bhandar of Bhantha ki] Kundi nos. 11; 14; 19 (all three with mula and cty) *Limdi. nos. 126; 133; 162; 189; 247; 260; 329; 330; 358; 405; 448 *Mitra VIII. p. 112 *PAP [Sangha bhandar] 38 (11; 20; 21; 22; 23, 26 mula only-18; 24; 25, 27, 28 mula and cty) *PAPL [Sangha bhandar, Limdi pada branch] 4 (24); 5 (18) mula and cty *PAPS [Agal Sheri, Pofalia Wada] 19 (4, 6, 7, 8); mula only 19 (5); 21 (10); 24 (10); 76 (9) mula and cty *PAS [Lodhi Posala Sanghavi Pada] No. 63 *PAZA 3 [Sha Chunilal Mulji's Bhandar] (16 (mula only); 17 (mula and cty) *PAZB [Vadi Parsvanatha Pustaka Bhandar] 14 (6) (mula and cty) *Pet III. A. p. 109 *Punjab nos. 1466; 1467; 1468 *Samb[havanatha temple]. nos. 313 (mula only); 181 (mula and cty) Place Agra Bombay Calcutta 289 Varanasi [Pune] [Pune] 1 1 1 Ahmedabad 7 Ahmedabad 2 Jaisalmer Florence Baroda Cambay Cambay Jaisalmer Jaipur Jaipur Jaisalmer Patan3 Patan MSS 5 5 Patan Patan Patan Ahmedabad 11 [Azimganj] 12 Patan Patan Cambay? "Punjab" Jaisalmer 1 2 1 palmleaf 2 2 1 1 3 11 2 4 4 2 3 2 From the JRK entries it is not possible to tell if these manuscripts give the commentary alongside the mula or afterwards False entry, this manuscript contains the commentary only. From this information it is not possible to positively identify the Patan manuscripts as listed in the catalogue of 1991.
Page #312
--------------------------------------------------------------------------
________________ Surat Surat Ahmedabad 1 Ahmedabad 1 Ahmedabad 2 *SB (Mohanlal bhandar] 1 (46) (mula and cty) *Surat [text found in bhandars no. 1, 2, 5-9 (no. of manuscripts not given) *VA [Vimala gaccha upasraya, Falusha pole] 10 (2) (mula and cty) *VB [Vimala gaccha upasraya, Haja pole] 18 (27) (mula and cty) *VC [Vimala gaccha upasraya) 8 (5; 6) (both give mula and cty) *VD (Vimala gaccha upasraya, "Haji Patel" pole) 8 (4) (mula and cty) Vel. nos. 1485; 1486 Weber II. nos. 1854 (mula only) 1855 (mula only) 1856 (mula only) 1857 (mula only) 1858 (mula only) 1859 (mula and cty) 1860 (mula and cty) Bol; Bo2 Ahmedabad Bombay Be1 Be2 Be3 Be4 Bes Beb Be7 Berlin 7 290
Page #313
--------------------------------------------------------------------------
________________ 2 B2 B7 F M 4 B4 B5 B3; B6 Manuscripts of Sricandra's commentary listed in the JRK (p. 213). *Bengal nos. 6785; 6977 (both give mula and cty)+ *Bik. no. 1699 *BSC No. 460 Veb Be7 *B[rhattipajika]. No. 23 [not a MS entry] *Buh IV [Collection of 1873-74] no. 158 (mula and cty) no. 159 *D[ela Upasraya Bhandar] A 13 (14; 15): *D[ela Upasraya Bhandar] B 6 (8; 9) *Flo. no. 518 (mula and cty) *Hamsa nos. 1044 [Pune] 2 Ahmedabad 2 Ahmedabad 2 Florence 1 Baroda Cambay *JA [Santinath temple] 14 (2) (mula and cty) *JB [Jnanavimalasuti bhandar] 47; 48 (mula and cty) Cambay *Jesal. nos. 423; 553 (mula and cty) Jaisalmer *JHB 15 (5c) Jaipur *[Bhandar of Bhantha ki] Kundi nos. 11; 14; 19 (all three with mula and cty) *Mitra VIII. p. 112 *PAP [Sangha bhandar] 38 (18; 24; 25, 27, 28 mula and cty) *PAPL [Sangha bhandar, Limdi pada branch] 5 (18) mula and cty *PAPS [Agal Sheri, Pofalia Wada] 19 (5;); 21 (10); 24 (10); 76 (9) mula and cty 19 (10) cty only *Patan Cat I p. 122 *PAZA 3 [Sha Chunilal Mulji's Bhandar] 17 (mula and cty) *PAZB [Vadi Parsvanatha Pustaka Bhandar] 14 (6) (mula and cty) *Pet. III [Collection of 1884-85] no. 607 *Pet. IV [Collection of 1886-92] no. 1277 *Pet. V [Collection of 1892-95] no. 738; 739 *SA [Jainananda bhandar, Surat] nos. 13; 1522; 1980; 2512; 2658; 2727 *Samb[havanatha temple]. nos. 6; 181; 312; *SB [Mohanlal bhandar] 1 (46) (mula and cty) *VA [Vimala gaccha upasraya, Falusha pole] 10 (2) (mula and cty) *VB [Vimala gaccha upasraya, Haja pole] 18 (27) (mula and cty) *VC [Vimala gaccha upasraya] 8 (5; 6) (both give mula and cty) Weber II. nos. 1859 1860 Calcutta Bikaner Varanasi 291 Jaisalmer [Azimganj] Patan Patan Patan Patan Patan Patan Patan [Pune] [Pune] [Pune] [Surat] Jaisalmer Surat 2 1 Ahmedabad 1 1, palm leaf 2 2 1 Berlin 3 1, cty only 5 1 5 1 ? 1 1 1 2 Ahmedabad 1 6 3 1 Ahmedabad 1 2 2 From the JRK entries it is not possible to tell if these manuscripts give the commentary alongside the mula or afterwards.
Page #314
--------------------------------------------------------------------------
________________ 3 Manuscripts of the mala listed in the NCC (v. 8 p. 136-37). My no. Please dabad MSS 5 MSS H2 4 Bo1 Bo2 2 Pune B2 B8 Pune B11 B9 B10 NCC ref. Place *Ahmedabad (Gujarat Vidyapitha) 18; 19; 10; 21(1): 81 Ahmedabad *America (Harvard University Library, (Poleman 1938, 362)] 6751 = H788 (mula only) 6752 = 1785 (mula only) 6753 = H787 (mula only) 6754 = H990 (cty only) Cambridge *Arrah I. A. p. 17 (Ptd.) *Blombay] B[ranch of the R[oyal] A[siatic] S[ociety) 1485 1486 Bombay *Bikaner 1500 (with "Hemacandrasuri's vyakhya") 1699 (mula and cty) Bikaner *BORI 112 of 112 of 1872-73 (mula) = no. 255 158 of 1873-74 (mula and cty) = no. 256 Pune 754 of 1899-1915 (mula and tabba) = no. 262 160 of 1873-74 p. 62 = no. 265 (Balabodha) Pune 736 (16) of 1875-76 (Paryaya) Pune 789 (16) of 1895-1902 Pune *BP pp. 199a, 2026 205b 214b *Chani 413; 517, 1568; 1748 (or 1743?]; 2652 Baroda 1330, 1565 (mula with cty) Baroda *D[eccan College) pp. 47 62 (mula and cty) [incorporated into BORI holdings *Delhi II 107 [Digambara Mandirs] Delhi *Delhi MJP p. 4 (no. 47); p. 11 (no. 265); p. 12 (no. 285) Delhi Filliozat II Ms no. 137 Paris *Firenze 518 (mula with cty) Florence *Gough p. 109 *H[ultzsch). 387 (=IIO 245) *H[ara pr[asada Shastri). III. 157 Varanasi *ITO [2]45 [= H[ultzsch). 387] Oxford *I[ndia O[ffice] 7464 8217 London *Jac. 694 *JASB 1908 p. 422b nos 4329; 7613 (mula) 6785, 6977 (mula with cty) Calcutta *Jain Bhsandars of the P[unjab). I 1466-68 Punjab *Jesalmere p. 33 [Dalal's 1923 catalogue = Janert 129] 1 *Kh. p. 94 [list by Keilhorn, already in Deccan College above] Leumann 111 false entry = transcript of 1879 ed. *Mandlik Sup. 377 Pune *Pannalal [Digambar Jain Sarasvati Bhavan, Sukha nanda Dharamsala] (part] V B. p. 18 (ptd.) Bombay *Pattan I p. 122 [Dalal's catalogue of 1937] Patan 292
Page #315
--------------------------------------------------------------------------
________________ ? *Petersson Reports April 1884-Mar. 1886] III A. p. 109 (palm-leaf manuscripts in Santinatha Bhandar) Khambat *Skt. Coll. Ben 1897-1901, p. 113 (no 460) Varanasi *Tod 20 London *Ujjain I. pp. 85, 88 Ujjain *Viz Skt Coll Vizianagaram *Weber manuscript nos Bel 1854 (mula) Be2 1855 (mula) Be3 1856 (mula) Be4 1857 (mula) 1858 (mula) Veb 1859 (mula and cty) Berlin 4 Manuscripts of the commentary listed in the NCC (v. 8. 136-37). Be5 NCC gives four headings for commentaries on the mula, entitled (1) Vrtti (one entry here also called Stabaka) (2) Avacuri (3) Vivarana of Sricandra (4) Vyakhya. Since I have not found evidence of any cty other than that by Sricandra, (ie. (3) Vivarana) and it is sometimes termed a Vrtti in all likelihood the entries referring to a Vitti, indicate the cty of Sricandra so I have included them below in that category. The entry giving a vyakhya by Hemacandra Suri (1088-1172 CE) is also very likely to be based on a mistake. The library of the palace in Bikaner declined to make a copy of the manuscript available to me. NCC does not know of the paryaya. Vivarana by Sricandra Suri, pupil of Dhanesvara, B7 B4 B3 *BP pp. 198b; 205a; 214b (all Vrtti) *Chani 1330, 1568 (both with Vrtti) Ahmedabad 1743 (or 1748?] (sika) Ahmedabad *F1. J. 26 (Tika) *Skt. Coll. Ben. 1897-1901, p. 113 (no. 460) "Vivarana" H4 *America 6754 *Bik 1699 (mula and cty) Bikaner *BORI 158 159 of 1873-74 (mula and cty) 607 of 1884-86; B5 1277 of 1886-92; 738 B6 739 of 1892-95 Pune [=B2-B7) *BORI D XVII.i. 256-61 *D[eccan College) p. 62 [included in BORI holdings *Firenze 518 (mula with cty) Florence *JASB 1908, p. 422b (nos. 6785, 6977) (mula and cty) Calcutta *Kh. p. 94 [list by Keilhorn, already in D[eccan College above*L 2647 *Pattan I p. 122 [Dalal's catalogue of 1937] B4 *Petersson) III. p. 405 (no. 607) BS IV p. 48 (no. 1277) B3, B6 V p. 289 (no.s 738, 739) *Weber (1854 is an error, that manuscript contains only the mula Veb 1859 (mula and cty) Berlin 293
Page #316
--------------------------------------------------------------------------
________________ 1860 (cty only) Berlin 1 Be7 Stabaka B11 *Chani 1565 Stabaka Avacuri *BORI 160 of 1873-74 Pune 1 *D[eccan College) pp 62 (mula and cty) [incorporated into BORI holdings Vyakhya by Hemacandrasuri (1088-1172 AD) *Bik 1500 Bikaner 1 Paryaya B9 B10 *BORI 736 (16) of 1875-76 Pune 1 789 (16) of 1895-1902 Pune 1 In each of the sections below I give first the details of the manuscript catalogues and then the entries found in them. 5 5.1 1937 Manuscripts in Patan (North Gujarat) Catalogues of the manuscripts held in Patan A descriptive catalogue of manuscripts in the Jain Bhandars at Pattan. Part I. Palm-leaf manuscripts/ compiled from the notes of the late C. D. Dalal with introduction, indices and appendices by Lalchandra Bhagawandas Gandhi. Baroda : Oriental Institute, 1937. 72, 498, [2], 10 p. ; 25 cm. (GOS ; 76). [Janert 259). Contents: Prastavikam [71-32.-A report on the search for manuscripts in the Jain Bhandars at Pattan / C. D. Dalal. [33]-72.-Descriptive catalogue of manuscripts (1) Sanghavi pada bhandara 1-258.--(2) Khetaravasi bhandara (259)-309.-(3) Sanghabhandara, Phophaliya vada, Vakhataju Seri [310]-396.--(4) Tapagaccha bhandara, Phophaliyavada Agaliseri-bhandara [3971-406.-(5) Mahalaksmipatakabhandagara (407) 410.--(6) Vali Parsvanatha bhandara [411] 412.-(7) Modi bhandara 413.- (8) Aduvasu Pada Bhandara 413.-Parisistam Vadiparsvanatha-vidhicaityaprasasti-silalekhah [414]-415.-Pattanasthajainagranthagariya-tadapatriyapustakanam varnanupurvya suci [4171-436.-Pattanastha-Jainagranthagariyasucipatre nirdistasamvatsaranam suci [4371-440.-Pattanastha-Jainagranthagariyasucipatrasucitanam itihasopayoginamnam varnakramena suci. [441] 489.-Prastavika-tippani 491-98.GOS Catalogue of books 1937 [2], 10 p. ANU PK2971.G3D3 Patana-Srihemacandracaryajainajnanamandirasthita Jaina Jnanabhandaronum sucipatra : prathama bhaga / sankalayita Muni Punyavijaya. Patana : Sri Hemacandracarya Jaina Jnanamandira, Vi. sam. 2028. Vira sam. 2498. I. sa. 1972. 11, 631 p. ; 28 cm. Contents: Prakasakanum nivedana / Cimanalala Himmatalala Sanghavi (31-5.Granthagata Bhandarono anukrama [6).-Setha Sri Punamacanda Karamacanda Kotavala (Donor details 7-11.-1. Patana Srisangha Jaina Jnanabhandarana hastalikihta granthonum sucipatra 1-163.-2. Limbadipada Jaina Jnanabhandara [164]-89.-3. Subhavira Jaina Jnanabhandara (190)-293.-4. Vadiparsvanatha Jaina Jnanabhandara [294]-328.-5. Sagaragaccha Jaina Jnanabhandara (329)-435.-6. Modi Jaina Jnanabhandara (436)-448.-7. Laherubhai Vakila Jaina Jnanabhandara (449)-469.-8. Pravartaka Srikantivijayaji Jaina Jnanabhandara [470]-556.-9. Yatiji Srihimmatavijayaji Jaina Jnanabhandara (5571-560.-10. Srisangha Jaina Jnanabhandara (Kacchadesamanthi Kharidela grantho) [561]-575.-11. Aduvasipada Jaina Jnanabhandara (5761-580.-12. Sri Manikyasimhasuri Jaina Jnanabhandara (581)-583.13. Kharataracarya Sri Vrddhicandraji Jaina Jnanabhandara (584)-631. The MSS are numbered 1-14 789, there are no indexes in this volume. Only v.1 published. ANU (Z7835.J2 S5 1972 v. 1 Anahilalpalaka(Patana)nagarasthajainagranthabhandagarantargatanam hastalikhitagranthanam sucih / sankalayitarah Punyavijayaji maharajah ; sampadakah Muni 1972 1991 294
Page #317
--------------------------------------------------------------------------
________________ Jambuvijayah: sahayako Muni Dharmacandravijayah. Amadavada: Saradabena Cimanabhai Ejyukesanala Risarca Sentara, 1991. 4 v. in 3. ; 28 cm. (Sri Svetambara Murtipujaka Jaina Bordinga (Amadavada) granthamala puspa 1-3). Parts 1-2 (in one volume): Sri Hemacandracaryajainajnanamandirasthitanam kagadapatropari likhitanam 20 035 granthanam sucyatmakau prathama-dvitiyabhagau = Detailed catalogue of 20 035 paper MSS. preserved in the Hemacandracarya Jaina Jnanamandira at Patana, (N. Gujarat). Contents: Prakasakiya/Jitendra Bi. Saha, Amadavada 17 Nov. 1991(5).Sampadakiya dvi-trah sabdah/Muni Jambuvijayah, Pancasara, Vikrama sam. 2048 [6].--Sampadakiya nivedana / Muni Jambuvijayah, Pancasara, Vikrama sam. 2047 (7-10).-Purvaprakasita sucipatranum nivedana / Cimanalala Himmatalala Sanghavi, Patana, 7 April 1972 [1112].--Granthagata bhandarono anukrama [12]. -- (Concordance of Dabhada (container numbers and work numbers 13-15). A sucipatramam apela ketalaka sanksipta sabdonum spastikarana [16].-photograph of Sri Hemacandracarya Jaina Jnana Mandira, Patana, northern Gujarat 17). ["Punyodayaprasastih" ... 18).-photograph of Punyavijayaji 19).--[1] Patana Srisangha Jaina jnanabhandarana ... MSS 1-3508 p. 1-110.[2] Limbadipada Jaina jnanabhandarana ... MSS 3509-4014 p. 110-126. [3] Subhavira Jaina jnanabhandarana ... MSS 4015-6525 p. 127-194.[4] Vadiparsvanatha Jaina jnanabhandarana ... MSS 6526-7332 p. 195-218.[5] Sagaragaccha Jaina jnanabhandarana ... MSS 7333-9985 p. 218-285.[6] Modi Jaina jnanabhandarana ... MSS 9986-10 308 p. 285-93.[7] Laherubhai Vakila Jaina jnanabhandarana ... MSS 10 309-10 830 p. 293-305.[8] Pravartaka Srikantivijayaji Jaina jnana bhandarana ... MSS 10 831-12 843 p. 305-59.[9] Yatiji Srihimmatavijayaji Jaina jnana bhandarana ... MSS 12 844_915 p. 359-61.[10] Srisangha Jaina jnanabhandarana ... (Kacca desamanthi Kharidela grantho) MSS 12 916-13 322 p. 361-70.[11] Aduvasina Padana Jaina jnanabhandarana... MSS 13 323-436 p. 371-73.[12] Srimanikyasimhasuri Jaina jnanabhandarana MSS 13 437-503 p. 373-74.[13] Kharataracarya Sri Vrddhicandraji Jaina jnanabhandarana ... MSS 13 504-14 789 p. 375-402. Part two 1-222. [These entries give slightly more information][14] Tapagaccha Jaina jnanabhandarana hastalikhita granthonum sucipatra MSS 14 790-20 035 p. 1-222- Prathamavibhagasya suddhipatrakam. v.2 Part three: Sri Hemacandracaryajainajnanamandirasthitanam kagadapatropari likhitanam granthanamakaradikramena sucyatmakah trtiyo bhagah = The Alphabatical [sic] index of all the 20 035 paper MSS preserved in the Hemacandracarya Jaina Jnanamandira at Patana, (N. Gujarat). Contents: Prakasakiya / Jitendra Bi. Saha, Amadavada 17 Nov. 1991 (5).Trtiyavibhagasya suddhipatrakam [6]. (plate of Bhuvanavijayaji (1895-1958)].[Index entries) 1-547. v.3 Part four: Bhabhapadajainagranthabhandagarasthitanam kagalapatropari likhitanam 3206 granthanam sucih, Khetaravasipadasthitanam talapatropari likhitanam granthanam sucih, Sri Hemacandracaryajainajnanamandirasthitanam Sanghavipadabhandarasatkanam Sanghabhandaradisatkanamca talapatropari likhitanam granthanam sucih, tatha sarvesam akaradikramena sucih, cvam vividhasucisangrahatmakah caturtho bhagah = Detailed catalogue of 3206 paper MSS presereved (sic) in the Bhabhapada bhandara at Reprints the entries for MSS 1-14 789 published in 1972, additional MSS no.s 14 790-20 035. All material was prepared by Punyavijaya but has been prepared for publication here by Muni Jambuvijaya. The Sampadakiya nivedana printed here in v. 1 is reprinted from p. [31-5 of the 1972 printing. Prakasakiya v. 1). Numbers [2-14] are all "Patana Srihemacandracarya Jaina Jnanamandirasthita." 6 295
Page #318
--------------------------------------------------------------------------
________________ Patana, catalogue of the palm-leaf MSS of the bhandara of Sanghavi Pada, now preserved in the Hemacandracarya Jaina jnanamandira at Patana, catalogue of the palmleaf MSS of the bhandara of Khetaravasi Pada and the catalogue of the palm-leaf MS of Sanghabhandara etc. now presereved (sic) in the Hemacandracarya Jaina Jnanamandira at Patana with the alphabatical (sic) index of the [sic] all these MSS. Contents: Prakasakiya / Jitendra Bi. Saha, Amadavada 17 Nov. 1991 5.-Patanana Bhabhapadana bhandarano sanksipta paricaya/Muni Jambuvijaya, Vikram samvat 2048, Pancasara 6.-Patanana Sri Sanghavi Padana tadapatriya Jaina grantha bhandarano eka paricaya / Jambuvijaya, Vikramasamvat 2048, Pancasara 7-8.-Prasangika / Sevantilala Ema. Saha, Talakacanda Bi. Dalala, Vrjalala Ti. Saha (Hemacandracarya Jaina jnanamandira) 8.-Khetaravasina Palana tadapatriya bhandarano sanksipta paricaya / Jambuvijaya, Vikramasam. 2048, Pancasara 9.--Sri Hemacandracarya Jaina Jnanamandiramam rahela Sanghabhandara adi bhandarona tadapatriya granthono sanksipta paricaya / Jambuvijaya Vikramasamvat 2047, Pancasara 10.-Kineit prastavika / Amrtlala Mohanalala Bhojaka, 11 Mar. '92, Amadavada 11-16.--Patanana jnanabhandaro / Punyavijayaji 17-20.-(photo of Manoharasriji : Jambuvijayaji Maharajanam matusri] [1] Patana Bhabhana Padamam Rahela Vimalagacchana upasrayana Jaina jnanabhandarana ... MSS 1-3206 p. 1-158.-granthono akaradikrama 159-207. [2] Sri Sanghavi Padana Bhandarana tadapatriya granthoni suci (MSS renumbered, numbers from the 1937 catalogue by C. D. Dalal are also cited) 208-53.- granthono akaradikrama 254-74. 13] Sri Sanghavi Padana Bhandarana jirna, trutaka ane contela tadapatriya granthona nama 275-86.-granthono akaradikrama 287-93. [4] Patanana Khetaravasiya Padana Bhandarana corayela tadapatriya granthoni suci 294-95. [5] Patanana Sri Hemacandracarya Jaina Jnanamandirasthita Sanghabhandara adi bhandarona tadapatriya granthoni suci 296-300.-granthono akaradikrama 301-304. 5.2 Palmleaf manuscripts of the mula from Patan (1991 catalogue v.4, 263) Gaekwad no. Petino calu no. Book no. Name lekhanasamvat P5 194 63 (2) (1) Nirayavali 102 p. 1309 P6 194 63 (2) (2) Nirayavalivitti 70p. 1310 Paper manuscripts from Patan There seem to be only three manuscripts containing both mula and cty (no.s 1483, 2578 and 16389). Mula Nirayavalikasutra 21 p. 16th uttama, 12 /// x 5 262 Nirayavalikadi pancupangasutra 263 Nirayavalikadi pancupangasutra 264 Nirayavalikadi pancupangasutra 265 Nirayavalikadi pancupangasutra Nirayavalikadi pancupangasutra 267 Nirayavalikadi pancupangasutra Nirayavalikadi pancupangasutra 1483 Nirayavalikasutra satika tripatha 32 p. 17th uttama, 10/ x 4/ Candrasuri 1484 Nirayavalikasutra mula 27 p. 17th 10/ x 47 2578 Nirayavalikasutra vsttisaha 12 p. 17th uttama, 10 x 4 3020 Nirayavalikadi apurna 3 p. 3814 Nirayavalika upanga pancaka 4192 Nirayavalikadi pancupangasutra 2-43 p. 6568 (1) Nirayavalika upangasutra 1-17 p. 6912 Nirayavalikapangasutra 28 p. 10024 Nirayavalikopangasutra 20 p. 10359 Nirayavalikopangasutra 21 p. P1 10419 Nirayavalikopangasutra 20 p. 1553 [1496] (see 1972 cat,, p. 453) 26 266 809 3-21 p. 296
Page #319
--------------------------------------------------------------------------
________________ 39 p. 32 p. -- 18903 269 P2 10420 Nirayavalikopangasutra 25 p. 1602 [1545] (see 1972 cat., p. 453) P4 10475 Nirayavalikopangasutra 23 p. 16th cent.sam.(see 1972 cat, p. 455) 13267 Nirayavalikopangasutra 14015 Nirayavalikasutra 38 p. 14849 Nirayavalikasutra 20 p. 1572 [1515) 1109 slokas 16385 Nirayavalikasutra 31 p. 1109 Slokas 16388 Nirayavalikasutra 28 p. 1675 [1618) 16390 Nira yavalikasutra 34 p. 1662 [1605) 1109 Slokas 16391 Nirayavalikasutra 33 p. 1668 (1611] 1250 slokas 16392 Nirayavalikasutra 1319 slokas Nirayavalika sutra 53 p. 1915 (1858) Vivarana / Sricandrasuri 268 Nirayavalikadivstti 19 p. Sricandrasuri Nirayavalikadivstti 18 p. Sricandrasuri 270 Nirayavalikadivstti 11 p. Sricandrasuri 271 Nirayavalikadivrtti 22 p. Sricandrasuri 272 Nirayavalikadivitti 16 p. Sricandrasuri 1483 Nirayavalikasutra satika tripatha 32 p. 17th cent. uttama, 10/ x 4/ Candrasuri 2578 Nirayavalikasutra vyttisaha 12 p. 17th cent. uttama, 10 x 4 4066 Nirayavalikaupangavivarana 13 p. Sricandrasuri 6568 (2) Nirayavalika upangasutra vitti 17-27 p.Sricandrasuri 6846 Nirayavalikopangavivarana 17 p. Sricandrasuri 10025 Nirayavalikopangasutravstti 12 p. Sricandrasuri P3 10421 Nirayavalikopangasutra vstti 9 p. Sricandrasuri, 1598 [1541] 13785 Nirayavalikadivrtti 17 p. Sricandrasuri P7 14861 Nira yavalikasutravrtti 12 p. Sricandrasuri 1571 (1514] 8 650 si 14904 Nirayavalikasutra vytti 17 p. Sricandrasuri 16th cent. sam." 15182 Nirayavalikadivstti 12 p. Sricandrasuri 17th cent. sam 16389 Nirayavalikasutra satikatripatha 38 p. Sricandrasuri 1715 slokas 16870 Nirayavalikasutra vstti 17 p. Sricandrasuri 1610 [1553] Paryaya 7111 (15) Nirayavalikopangaparyaya 30mum Stabaka 1188 Nirayavalikasutra sastabaka 55 p. 1752 uttama, 10 x 4// 1794 Nirayavalikasutra sastabaka 70 p. 1733 uttama, 10 x 4/ Pkt. and Guj. 13387 Nirayavalikopangasutra sastabaka 103 p. 13833 Nirayavalikopangasutra sastabaka 57 p 14747 Nirayavalikasutra sastabaka apurna 71 p. 17963 Nirayavalikaupanga sastabaka 63 p. 19th cent. Pkt. Guj. 6 Manuscripts in Jaisalmer (Rajasthan) 6.1 Catalogues of the manuscripts held in Jaisalmer [Parakh, Joharimal). 1988. Jina Bhadrasuri Jnana Bhandara Jaisalmera hastalikhita granthom ka suci patra = Jina Bhadrasuri Jnana Bhandara Jaisalmer handwritten manuscripts' catalogue / sankalana kartta karyakattargana Seva Mandira Ravati, Jodhpur. Jodhpura : Seva Mandira Raoti, Vikrama samvat 2045. Vira samvat 2514. Saka samvat 1910. Isvi san 1988. I v. ; 25 cm. Descriptions of 4 452 paper manuscripts from Jaisalmer collections (Prakkathana, p. 2). Labelled "2. khanda" part one described two paper manuscript collections, in Basmer 8 1972 catalogue p. 453. Picture on first leaf, this is the only illustrated manuscript of the Nirayavaliyasuyakkhandha traced. P. 6 and 9 are doubled. 297
Page #320
--------------------------------------------------------------------------
________________ Punyavijaya. 1972. Jesalamerudurgasthahastapratisangrahatanam Samskrtaprakrtabhasa-nibaddhanam granthanam nutana suci= New catalogue of Sanskrit and Prakrit manuscripts, Jesalmer collection/sankalayita Punyavijaya. Ahamadabada: Lalabhai Dalapatabhai Bharatiya Samskrti Vidyamandira. 35, 471 p. : ill. ; 25 cm. (LD series 36). 6.2 Palm leaf and paper manuscripts of the mula and commentary from Jaisalmer Palm leaf (references are from the 1972 catalogue) Srijinabhadrasuri Jnanabhandarasthita J1 p. 1332(5) mula 1-25 complete 29-83 complete 83-114 incomplete J2 p. 1539 (1) mula J5 J6 Lonkagacchiya Jnanabhandaragata (3 of the MSS here sam. 1307) J3 p. 363(3) mula 305-29 330-47 3(4), cty Paper Srijinabhadrasuri Jnanabhandarasthita J4 p. 185 and in a modern temple in Bombay, however my notes of this catalogue were irretrievably lost after I left Jaisalmer. p. 200 p. 227 J8 77 J9 78 J10 79 J11 80 J12 81 J13 82 J14 83 84 J15 J16 J17 J18 85 39 (2)cty, 86 87 2-31(1) 2-31(2) 20-168 36-462 36-463 44-723 cty mula cty Stabaka J7 p. 246 (References for the manuscripts hereunder are from the 1988 catalogue) Ref. no. year leaves Ta-649 1485 size cm. Cat. no. mula / cty 36 x 14 mula Lo-131 26 x 11 1601 1610 mula mula Ta-84 Du-338 1659 mula Tha-154 1673 mula Lo-130 1682 mula/tabba Ta-86 mula A-31 mula /tabba Du-489 Lo-132 Tha-278 1877 68 19th cent. 24 74 1911 cty 17th cent 16 17th cent 16 cty 32(1) is dated 1375 [1318] 32(4) samvat 1412 [1355] est. last half 15th cent. mula 12 cty 12-19 others in same MS sam. 1489 11 28 14 362 29 39 21 36 25 samvat 1307 [1250] 640 granthas, tika w. sam. 1228 27 1109 granthas p. 1826-37 23 lines, 637 gr. p. 1937-44, 298 16 lines 15 lines water damaged 18 lines water damaged 14 lines samvat 1786 25 x 11 28 x 12 34 x 14 25 x 10 26 x 13 27 x 11 26 x 13 26 x 10 33 x 13 lines aksaras 16 16 16 13 13 13 7 15 7 15 13 Tha. Tharusahaji Bhandara = Sri Tharu Saha Bhamsali Jnana Bhandara Lom. = Lonkagaccha Bhandara = Sri Gujarati Lunka Gaccha Jnana Bhandara 60 31 52 35 58 65 36 50 31 A. = Laghu Acarya Gaccha Bhandara = Sri Laghu Acarya Gaccha Jnana Bhandara Du. = Dungaraji Yati Bhandara = Sri Dungaraji Yati Jnana Bhandara Ta. = Tapagaccha Bhandara = Sri Tapagaccha Jnana Bhandara 50 55 The only one of these used to establish an edition is apparently J1, described in the 1987-89 edition from a "photoprint" of a palm-leaf manuscript from a "Jaisalmer bhandar." In that edition it is manuscript 'Ka.': 25 folios or 50 pages, each 12" x 3/4" long, five lines of text per page, some pages have only two or three lines, some lines are incomplete (ie damaged?), 45-50 aksaras per line, no colophon (p. 26 and 54-55). But those physical dimensions match J2 rather than J1, however many (but not all) of the readings cited in 1987 match J1. Muni Jambuvijaya also mentioned that Jinabhadra had established the libraries in Patan and at Jaisalmer and there were copies from common manuscripts in both collections. When later copies were made they were often from the oldest existing manuscript. So once the variant pattern of the oldest copy from
Page #321
--------------------------------------------------------------------------
________________ Jaisalmer or Patan is established it may be possible to know that a particular later manuscript was copied from these originals. 7 Manuscripts in Khambhata (=Cambay) (Gujarat) 7.1 Catalogue of the manuscripts held in Khambhata 1961-66 Catalogue of palm-leaf manuscripts in the Santinatha Jain Bhandara, Cambay/Punyavijaya. Baroda: Oriental Institute, 1961-66. 2 v. ; 25 cm. (GOS 135, 149). 7.2 Contents v. 1: Foreword, 10-3-61, Baroda / B. J. Sandesara [5]-6.- [Listing in Anga sequence ][1]-200. Contents v. 2: Foreword, 14th Feb. '66, Baroda / B. J. Sandesara [v].-Introduction / Muni Punyavijaya [vii]-xii. [Listing continues with Prakaranas] [201]-441.-Parisistani 1. Granthasuci-kalanukramena [earliest MS samvat 1165] [442]-448.-2. Namasuci. [449]-468.-3. Granthasuci [469]-477.-Granthakarasuci 477-79.-5. Upanamasuci [480].-6. Lekhakasuci [480].-7. Munisuci [481].-8. Granthakarasahayakamunisuci [482].-9. Rajasuci [482].-10. Mantri-dandanayakasuci [483].-11. Rajnisuci [483].-- 12. Sresthisuci [484].-13. Sresthini-srest[h]iputrisuci 491-94.-14. Jnati-kula-gotragaccha-vamsa-sakhasuci 494-96.- 15. Nagaradisuci [496].-16. Desasuci 497.-17 Cautyasuci 497. [Jambuvijaya] Palm leaf manuscripts of the mula and commentary from Khambhata "Palmleaf, No. 20 (3) Nirayavalikopangasutra-pancaka folios 123-144, also numbered 1-22. 33.2 x 2.2 inches, later half of 15th century V.S. Bad condition." "Palmleaf No. 20 (4) Nirayavalikopangasutrapancakavrtti, Sricandrasuri, folios 147-159, also numbered 25-37, 33.2 x 2.2 inches. Latter half of 15th century V. S. Bad condition." Both are part of a collective manuscript which has a final date samvat 1478 [1421-22], the precise day is not stated (catalogue as cited above, vol. 1, 42-43). 299
Page #322
--------------------------------------------------------------------------
________________ Appendix V The Nira ya valiyasu ya kk handha-paryaya A paryaya is that type of commentary which gives simply the synonyms (paryaya) of difficult terms (visamapada)" (Pannav. 1969-71:2, 435). Collected manuscripts of a number of paryayas are known from several collections: Catalogue of the Santinatha Jaina Bhandara, Khambhat, part one p. 128; LD Institute, Ahmedabad (Pannav.1969-71:2, 435). The paryaya on the Nirayavaliyasuyakkhandha has never been printed before, nor it seems has it even been identified for what it is, merely a series of definitions extracted from Sricandra's commentary (vivarana) on the Nirayavaliyasuyakkhandha. I will present the text as available from two source manuscripts, both from the BORI in Pune (BORI 263 No. 736 of 1875-76 and BORI 264 No789 of 1895-1902). As present in these two manuscripts the text is comprehensible but faulty, often omitting letters. There are a few very minor differences between the comments here and those made by Sricandra, but nothing substantial, (eg. vastrapete ca is not found in Sricandra in the definition of celapeda). nirayAvaliyasuyaskaMdhaparyAyA nirAvalIzrutaskaMdhaparyAyA yathA / viharai aste / adUrasAmaMtena ca dUre na ca samIpe | udaMjANuM ukuDukAsanaH / vaMdai namasai tti / vaMdate statya namasyati / praNAmataH / ceDagassa ranno sapakkhiM iti sAmAnapakSaM / samAnapArzva / samavAmetarapArzvatayA / sapaDidisiM sapratidik / abhimukhAgamanehi parasparasya samAveva dakSiNavAmapAi~ bhavataH / / cha // egAhaccaM kUDAhaccaM iti ekaiva AhatyAhananaM prahAro yatra tat ekAhatyaM / kUDasyevapASaNamaya | 1 mahAmAraNayaMtrasyeva AhatyAhananaM yatra | solliehi ya pakvaiH / taliehi ya snehana pakvaiH / bhajiehi ya bhraSTaiH / pasannaM drAkSAdijanyAmanaH prasattihetuH ulaggA avarummA bhagnamanovRttiH / uluggasarIrA bhagnadehA | niyatteyA gatakAMtiH / dINavimaNavayaNA dInAvimanovadanA paMDulyamuhI / pAMDuritamukhI / umaMthiya adhomukhIbhUta | ruhiraM appakappiyaM ti | AtmasamIpasthaM dAragassa aNupubveNaM ThiipaDiyaM veti sthitipatitaM kulakramAgataM putrajanmAnuSThAnaM / ghAeuAmeNaM / amo iti haMtukAmaH / pIiM alovemANA alopayaMtaH / / khaMDayAvihUNo chAtratahitaH / mittanAiniyaya- viuleNaM ti / mitrANi suho / jJAyaH samAnajAtayaH / nijakAH pitRvyAdayaH saMbaMdhinaH zvasurapAkSikAH / bhogabhogAI bhuMjamANi tti | atizayavataH uSTAdIn / ajjAhi aNAhaTTiyA iti yo balAt hastAdau gRhItvA pravarttamAnaM nivArayati so'paghaTTakastadabhAvAdanapaghaddakAH / pADikkayaM uvassayaM pRthak / devaratro uvatthANiyaM karei tti prekSaNakaraNaye ya 300
Page #323
--------------------------------------------------------------------------
________________ ityarthaH / celapeDA iveti vastrapeTe ca / ti vastrapeTeva paragaNehi nRtyadbhiH / parakkamamANehiM ullaladbhiH / pakkholaNehiM prasavaladbhiH / akkussamANehiM ruSyadbhiH / ukkUyamANehiM bRhacchabdaM kurvANaiH / nikkhevau nigamanaM vAcyaM / ukkhevau prastAvanA | pUrisavaNurA parikkhittA iti / purUSAvAgureva mRgabaMdhanamivasarvatobhavanAt / tayAparikSiptAH / vakupaDipunnAI cAyAlaMsajati paNayAlaMsaM pAvAMtaraM / iti nirAvalikAzrutaskaMdhaparyAyAH / / sAmAptAH / / cha / / 301
Page #324
--------------------------------------------------------------------------
________________ INDEX This brief index is to provide name-access to the materials in Appendix I. A few references have also been added from the other appendices. Because Appendix I is arranged by title the index focuses on personal names appearing in that material. Abhayadeva 67, 73, 77, 86, 87, 95, 101, 105, 109, 113, 119, 123, 130, 279-81 Abhayadeva (Harsapuriya gaccha) 177, 220 Abhyankar, Kashinath Vasudev 207, 209, 214 Adicandra 186 Agamaratnamanjusa 13 Agamodaya Samiti 5-11 Agastyasimha 204 Ajitacandra Suri 186 Ajitadeva Suri (Pallivala gaccha) 247 Ajitadeva Suri (pupil of Mahesvara Suri) 109, 185 Ajitadeva 44 Aksararthalavvalesa 185 Alsdorf, Ludwig. xv, 32, 60, 63, 111, 137, 140, 161, 198, 199, 200, 213 Amradeva Suri (pupil of Uddyotana Suri) 186 Amradevacarya 275 Amrtacandra Suri 4, 119 Amrtalala Amaracanda 253, 255 Amar(a) Muni 22, 59, 80, 83, 90, 103, 110, 213, 231, 271 Amaracandra, Muni 209, 214, 270 Amarakirti 247 Amaravijaya (pupil of Subhavimala Gani) 248 Amolaka, Rsi 11-13, 45, 46, 56, 67, 71, 73, 78, 82, 87, 92, 96, 98, 101, 104, 105, 108, 109, 112, 113, 116, 120, 121, 123, 126, 127, 128, 130, 133, 135, 137, 139, 140, 143, 147, 170, 178, 180, 187, 197, 207, 214, 226, 228, 243, 257, 260, 263, 266, 268, 269, 272 Amolakhacand, Rsi 5, 135 Anandacandra 129 Anandasagara, see Sagarananda Suri Anandavimala Suri (Tapa gaccha) 158 Aryaraksita 177 Arunavijaya 103, 104, 108 Asokasri, Sadhavi 38 Atmarama 46, 58, 69, 71, 97, 99, 101, 101 n.1, 105, 108, 143 n.2, 146, 147, 172, 175, 177, 178, 180, 189, 197 n.6, 208, 214, 243, 257, 261 Balabhai Viracandra 'Jayabhikkhu' 33 n. 12 Balacandra, Siddhantasastri 37 302 Balasirahsekhara 259 Balbir, Nalini xv, 43, 55, 225, 228, 236, 240 Ballini, Ambrogio 116, 183 Bandhasattrimsika 86 Banerjee, Muralydhar 35 Banthiya, Ghevaracandra 'Viraputra' 49, 79, 83, 102, 104, 110, 112, 190, 197, 209, 214 Banthiya, Mohanalala 36, 37 Baraiya, Gopal Das 32 Barnett, L. D. 103, 105, 108, 122 Barth, A. A. 96, 229 Becaradasa, see Dosi, Becaradasa Jivaraja Belaji Sivaji 249 Beurlen, Wolfgang xix, 28 Bhadrankara Suri 232 Bhadrankaravijaya 210, 214, 233 Bhadrabahu, 6th cent. 43, 44, 55, 139, 181, 203, 220, 235, 239, 243, 246, 259 Bhagavan Vijaya 4, 5, 187 Bhagavatilala, Muni 145, 147 Bhagyesavijaya, Muni 194 Bhaktilabha (pupil of Ratnacandra) 248 Bharilla, Sobhacandra 12 n.6, 13, 21-23, 46, 50, 58, 63, 89, 91, 92, 93, 109, 115, 127, 140, 145 Bhaskaravijaya 173 Bhatt, Bansidhar 38, 51, 84, 86, 161 Bhattacharya, Ajit Ranjan 194, 197 Bhavasagara Suri (Ancala gaccha) 77, 184 Bhavavijaya Gani (pupil of Muni Vimala Suri) 185, 247 Bhayani, Harivallabh Chunilal (b.1917) 39 Bhogavata, Premaraja 103 Bhojak, Amritlal Mohanlal 16-17, 80, 131, 149, 212, 227 Bhuvanabhanu Suri 224 Bhuvanasoma 56 Bhuvanatunga (pupil of Mahendra Suri) 151, 155, 164 Blumhardt, J. F. xv Bodhakacarya 205 Bollee, W. B. xv, 32, 43, 51, 53, 55, 61, 63, 64, 92, 122, 181, 195, 197, 198, 203, 236, 240, 259 Bothra, Surendra 162 Brahma sisya, see Brahma Muni
Page #325
--------------------------------------------------------------------------
________________ Brahma Muni (= Vinayadeva Suri, pupil of Parsvacandra) 135, 184, 243 Brahmarsi, see Brahma Muni Bronkhorst, Johannes 259 Brown, W. Norman 71, 198, 200, 256 Bruhn, Klaus xv, 104, 199, 228 Buddhisagara Gani 57, 251 Budha vijaya (pupil of Santivijaya) 247 Burgess, May S. 263 Butzenberger, K. 229 Caillat, Colette xv, 16 n.7, 51, 52, 62, 149, 154, 155, 166, 198, 200, 201, 215, 268 Cakresvara (Candra gaccha) 225 Candana, Sadhavi 192, 197 Candanasagara 168 Candrakirti 143, 169 Candramanisimha 253 Candraprabha Suri 277 Candrasagara Suri 57, 88 Caturavijaya 130, 260 Chaganalala Sastri 21-23, 98, 99, 121, 122, 137 Chandra, K. R. 31, 35, 37, 52 Charpentier, Jarl 185, 187, 198, 200 Chatterji, Suniti Kumar 26 Chattopadhyaya, Basanta Kumara 251, 255 Chokshi, Vadilal Jivabhai 113, 114, 115, 144, 147 Chotalala, Muni / Yati 12, 120, 171 "Cirantanacarya" 186 Cort, John Edward 198 Dhanapati (?) 67 Dhanavijaya Gani (pupil of Kalyanavijaya) 247 Dhanavimala 129 Dhanesvara Suri (pupil of Silabhadra) 143,269, 277 Dharmasekhara (Ancala gaccha) 246 Dharmacandravijaya, Muni 17, 47, 58, 59, 69, 75,90 Dharmaghosa Suri (=Dharmakirti, pupil of Devendra, Ancala gaccha) 151, 155, 232, 277, 277 n2 Dharmakirti, see Dharma ghosa Suri Dharmamandira Upadhyaya 186 Dharmasagara (Gani) (pupil of Vijayadana Suri) 135, 246 Dharmasagara (Tapa gaccha) 247 Dharmasi 119, 143 Dharmasimha 143 Dharmasundara (Kharatara gaccha) 56 Dhiravimala (Tapa gaccha) 109 Dhisalala Pitaliya 99 Diparatnasagara 23, 145 Dipavijaya 33 Divyaprabha, Sadhavi 21, 27, 103, 104 Dixit, K. K. 30, 52, 64, 84, 93, 99, 104, 108, 112, 116, 147, 161, 198, 215, 256 DLJP, see Sresthidevacandra-Lalabhai-Jaina pustoddhara Phanda Dosi, Becaradasa Jivaraja 17, 78, 80, 82, 91, 98, 123, 126, 220, 252, 255 Dosi, Bhagavanadasa Harsacandra 78, 82, 97, 130-31, 133 Dosi, Jivaraja Ghelabhai 68, 71, 95 n.1, 206, 214, 260, 263, 266, 268 Dosc, Ratnalala 98, 191, 197 Dronacarya, see Drona Suri Drona Suri 77, 109, 239, 239 n.1 Dugar, Dhanapatisimha 3 Dulharaja, Muni 38, 43, 60, 197, 215 Dundas, Paul xv, xvi, 43, 55 Dutt, Romesh Chunder 99 Emeneau, Murray Barnson xvii Dahlmann, J. 93 Danasekhara, Gani/Suri 77 Danavijaya (pupil of Suravijaya) 105, 143, 158, 247 Dangi, Aksayasimha 33 n. 12 Dayasagara (Ancala gaccha) 127 Deleu, Jozef xix, 84, 85, 91, 145, 147, 274 Deo, Shantaram Bhalchandra 30 Deva Suri 127, 170 Devabhadra (pupil of Abhayadeva) 139, 186 Devacandra (1581-1655) 28, 68, 71, 235 Devakumara Sastri 145, 147 Devaraja, Ravajibhai 45 Devasena (pupil of Yasobhadra) 248 Devasundara Suri (Tapa gaccha) 184, 204, 225, 246 Devavacaka 169 Devavijaya (Tapa gaccha) 180, 247 Devavimala 135 Devendra, see Nemicandra Suri Devendra, Muni xvi, 27, 52, 71, 84, 253, 256, 272 Devya Suri 170 Dhaky, M. A. 215 Fick, Richard 182 Folkert, Kendall W. xvi Gabbulala / Gavvulala 13, 114, 227 Ganadharavada 222 Gandhahastin 44 n.2 Ganesamala, Muni 27 Garrett, Robert 71 Gavvulala, see Gabbulala Ghatage, Amrit, Madhav xvi, xvii, 39, 52, 64, 182-83, 203 n. 1, 204, 215 303
Page #326
--------------------------------------------------------------------------
________________ Ghasilala 13-16, 45, 58, 68, 71, 74, 79, 82, 83, 89, 92, 97, 98, 102, 104, 107, 108, 110, 112, 115, 116, 120, 121, 122, 126, 127, 132, 133, 136, 137, 139, 144, 145, 147, 171, 174, 175, 178, 179, 180, 191, 197, 209, 210, 214, 227, 228, 244, 252, 262, 263, 286-87 Gopaji, Amritlal Savchand 144, 147 Gopal, Lollanji 162 Gore, N. A. 97, 98 Gosala Mankhaliputta 83 Govaliya Mahattara Sisya 181 Grierson, George Abraham 96 Gunasekhara (pupil of Vimalacandra) 186 Gunaratna Suri (pupil of Devasundara Suri) 151, 153, 155, 164, 239, 246 Gunasagara 36 Gunavijaya Gani (pupil of Kamalavijaya) 248 Guerinot, A. 198 Guerinot, Armand xvii Gulabavijaya 158 Hamsaraja, Hiralala 45, 82, 171, 185, 189 Hamsasagara 236, 237 Hamm, Frank-Richard 274 Hanaki, Taiken 180 Hanamaya, Shinsho xvii Hara, Minoru xvii Haragovindadasa Trikamacandra Setha 35, 113 Harisankara Kalidasa 249, 255 Haribhadra (pupil of Jinabhata) 127, 177 Haribhadra (pupil of Jinabhadra) 169 Haribhadra Suri 5, 17, 127, 169, 204, 225, 232 Haribhadra 235 Harsacand(a) 190, 210 Harsacandra, Bhagavanadasa, see Dosi, Bhagavanadasa Harsacandra Harsakallola (Tapa gaccha) 44, 87 Harsakula (Gani) 56, 77, 129, 158, 164, 186 Harsananda Gani (pupil of Samayasundara Gani) 185 Harsanandana 67 Harsavallabha, Upadhyaya 95 Harsavijaya 189 Hastimal(1)a Suri 103, 104, 109, 111, 171, 175, 193, 197, 209, 262 Hasumati 50 Hemacandra (1088-1172) 32 Hemacandra Gani 151 Hemacandra Maladharin 169 n.3, 177, 177 n.*, 220, 225 Hemacandra Suri 5, 17 Hemacandra 59, 110, 112, 114 Hemanandana (pupil of Ratnasagara Gani) 204 Hemanandana Gani (Kharatara gaccha) 247 304 Hemasagara, Muni 120 Hemavimala Suri (Tapa gaccha) 56, 246 Hertel 169 Hira Muni 'Himakara' 92, 115, 116 Hirakumari 50 Hiralala Sastri 21, 69, 71, 74 Hiravijaya Suri, (pupil of Vijayadana Suri, Tapa gaccha) 135, 246, 247 Hoernle, A. F. Rudolf 83, 95, 98 Huttemann, Wilhelm Ferdinand 93, 256 Indracandra 97 Indranandi, 10th cent. 30 Ippagumta, S. 39 Isvara Gani (Saravala gaccha) 235 Jacobi, Hermann 27, 44, 49, 62, 103, 182, 187, 196, 249, 255 Jain, B. L. 35 Jain, Banarsi Das 24, 90, 109, 115, 116, 195, 196, 213, 215 Jain, Bhupendra Swarup 31 Jain, Jagdish Chandra 28, 29, 30 Jain, Parameshthidasa 52 Jain, Rajendra P. 237 Jain, Rajaram 183 Jain, Sagarmal xviii Jaina, Devakumara 23 Jaina, Kamala 'Jiji' 22 Jaina, Komala 31 Jaina, Prthviraja 223 Jaina, Purusottama 146 Jaina, Ravindra 146 Jaina, Rhajanaci Rama 96, 98 Jaina, Rosanalala 22, 115, 116 Jaina, Sagaramala 149, 161 Jaina, Sudarsanalala 198 Jaini, Arunodaya Na. 61, 64 Jaini, J. L 34 Jambuvijaya, Muni 16-17, 47, 58, 59, 67 n.1, 69, 70, 75, 90, 170, 177 n.1, 180 Janert, Klaus Ludwig xviii Javeri, N. G. 127 Jayacarya 83 Jayadayala 170 Jayakirti Suri (Ancala gaccha) 184, 186, 196, 235 Jayantavijaya 188 Jayaratna (Kharatara gaccha) 87 Jayasagara Suri (Ancala gaccha) 248 Jayasundara Suri 248 Jayavijaya Gani (pupil of Vimalaharsa) 247 Jayavijaya 185, 232 Jethalal Harishankar 87 Jha, Sasikanta 193 Jinabhata 127, 177 Jinabhadra Gani 220, 277, 277 n.1
Page #327
--------------------------------------------------------------------------
________________ Jinacandra Suri (Kharatara gaccha) 44, 231, 248 Jinadasa Gani Mahattara 17, 43, 55, 77, 169, 177, 204, 225, 269 Jinadatta Suri 235 Jinadeva Suri 204 Jinahamsa Gani (Kharatara gaccha) 44, 135, 248 Jinaharsa 248 Jinakusala 248 Jinapala 271 Jinaprabha (pupil of Jinasimha) 246 Jinaraja Suri (Kharatara gaccha) 247 Jinasamudra Suri (Tapa gaccha) 44, 184 Jinasaubhagya Suri 248 Jinasimha (Kharatara gaccha) 246, 248 Jinavijaya 231, 278 Jinendra Suri 32, 43, 55, 181, 203, 215, 236, 239, 243 Jinendra Varni (1921-83) 37 Jinendravijaya Gani , see Vijayajinendra Jinesvara Suri (Kharatara gaccha) 73, 123 Jivavijaya Gani 129, 135 Jnana Muni 22, 114, 116, 132, 122 Jnanasila Gani 186 Jnanasagara, Muni/Suri (pupil of Devasundara Suri) 170, 184, 204, 225, 239, 246 Jnanasundara 170, 207 Jnanavimala Suri 109 Jong, J. W. de 62, 145 Josi, Ja. Ra. 126 Josi, Saloni xviii Ketkar, S. V.xx Kevala Muni 23 Khimavijaya 247 Khadabadi, B. K. 32 Kirfel, W. 168 Kirtivallabha Gani (pupil of Siddhantasagara Suri) 184, 246 Kirtivijaya Gani (Tapa gaccha) 247 Kothari, Subhasa 99, 157, 159, 166, 167 Kotyacarya 43 n.1, 220 Kohl, Josef Friedrich xix, 29, 137, 140 Kohn, H. xx Krause, Charlotte 149 Ksamaratna (pupil of Jayakirti Suri) 235 Ksemasakha (Kharatara gaccha) 185 Ksamavijaya, see Ksemavijaya Ksemakirti (pupil of Vijayendu) 259 Ksemankarasagara 36,41 Ksemavijaya 247 Kulamandana Gani / Suri 130, 248 Kumara, Muni 51 Kumudavijaya (pupil of Manavijaya) 225 Kusala vardhana (Tapa gaccha) 67 Kusumaprajna, Sadhavi 38 Kalanatha Sastri 161 Kalelkar, Dattatreya Balakrishna 91, 98 Kalikacarya 129 Kalyana Rsi 13, 58, 101 n.2 Kalyanaprabha 233 Kalyanavijaya 167, 247 Kamalabha (Kharatara gaccha) 185 Kamalaharsa (Kharatara gaccha, pupil of Manavijaya) 204, 247 Kamalasamyama Upadhyaya 184, 188 Kamalavijaya (pupil of Amaravijaya) 248 Kamptz, Kurt von 149 Kanakaprabha 81, 83 Kanakasundara Gani 87, 205 Kancanavijaya 6 n.1, 36, 41, 191, 236 Kanhaiyalala, Muni, Kamala' 13-16, 26, 27, 29, 69, 71, 74, 102, 107, 111, 124, 132, 139, 145, 146, 171, 173, 174, 178, 179, 190, 192, 193, 209, 210, 212, 227, 244, 254, 256, 262, 263, 267, 268, 270, 271, 272 Kapadia, Hiralal Rasikdas xvi, xviii, 27, 32, 126, 140, 215 Karnavata, Candamala 103 Kasturacandra 87 Labhasagara Gani 136, 275 Laksmikirti (Kharatara gaccha) 185, 248 Laksmivallabha Gani (pupil of Laksmikirti) 248 Laksmikallola Gani 44, 87 Laksmivallabha (pupil of Laksmikirti) 185 Lal(a)vani, K. C., see Lalwani, K. C. Lalwani, Kastur Chand xix, 31, 82, 83, 85, 121, 122, 193, 211, 214, 254, 255 Lath, Mukund 253, 255 Latha, Mukunda, see Lath, Mukund Law, Bimala Churn 28 Leslie, Julie xvi Leumann, E. 27, 96, 119, 126, 141, 196, 198, 200, 206, 207, 211, 215, 225, 229, 277 Lienhard, Siegfried 183 n.4 Lilamabai 50 Linke, Elfrun 28 Lorha, Daulatasimha Aravinda' 33 n.12 Mahaprajna (=Muni Nath(a) mal) xix, 17-19, 38, 43, 46, 53, 58, 64, 69, 71, 74, 75, 79, 81, 83, 85, 89, 93, 97, 99, 102, 104, 107, 111, 112, 115, 116, 117, 121, 124, 127, 132, 136, 140, 145, 174, 179, 191, 192, 194, 197, 199, 211, 212, 213, 215, 222, 227, 244, 254, 262, 265, 267, 270, 271 Mahesvara Suri 185 Mahesvara Suri (Candra gaccha) 109 Mahendra Kumar, Muni xix, 30, 31, 49 Mahendra Suri 235 305
Page #328
--------------------------------------------------------------------------
________________ Municandra 6, 130 Munivimala Suri, (Tapagaccha) 185 Nagarsi Gani 67, 186, 247 Nagraj, Muni xix, 30, 31 Nahata, Agaracanda 33 n. 12 Nanakacandra, Rsi 3, 4, 67, 129, 130 Nandalala 248 Nanna Suri 246 Narayan Rama Acarya 160 Nathamala, Muni, see Mahaprajna Navaba, Sarabhai Manilala 199, 232, 251, 256 Nawab, Sarabhai Manilal, see Navaba, Sarabhai Manilala Nayavijaya 77, 86, 248 Nayavimala 109 Nemacanda, Naginadasa 73 Nemicandra Suri (= Devendra) 181, 186, 232, 235, 274 Nemicandra 59 Nigodasattrimsika 86 Nirvanasri, sadhavi 38 Nirvanasagara 233 Norman, K. R. 43, 55, 62, 156, 157, 195, 197, 199, 236, 240 Nyayasagara (pupil of Uttamasagara) 248 Mahendra(simha) Suri (pupil of Dharmaghosa Suri) 151, 155 Mahendrakumara 'Dviteeya' 30 Mahendrakumara 'Prathama' 30 Mahimaratna (Vidhipaksa (Ancala) gaccha) 204 Mahimasimha / Mahimasimha 185 Mahimeru Upadhyaya 248 Malavaniya, Dalasukha, see Malvania. Dal sukh Malayagiri 5, 77, 123, 127, 129, 135, 139, 163, 169, 170, 225, 235, 239, 246, 259, 265, 281-84 Mallavadin 169 n.2 Malvania, Dalsukh xviii, 16-17, 26, 27, 30, 33 n. 12, 37, 71, 75, 84, 131, 133, 167, 221, 223, 272 Manavijaya (Kharatara gaccha) 204 Manavijaya 185, 225, 226 Maneka, Bhimasimha 3, 86, 206 Manikyasekhara Suri (pupil of Merutunga Suri) 186, 205, 225, 235, 239, 248 Manisagara, Muni 250 Maneka, Muni 50, 56, 214, 249, 256, 266 Manika, Muni, see Maneka, Muni Manohara Muni 160, 161 Maphatalala Jhaveracandra 251 Master, Alfred xv "Matikirti sisya" (Kharatara gaccha) 186 Megharaja (Parsvacandra gaccha) 67, 73, 77, 82, 123, (Megharaja Vacaka) 186, Megharaja Gani 3, 4 (bis), 78 Mehata, M. R. 78 Mehata, Madanakumara 83 Mehata, Mohanalala xviii Menariya, Oinkaralala 223 Merusundara (pupil of Ratnamurti) 205 Merutunga Suri (Ancala gaccha) 186, 225, 239, 248 Meruvijaya 247 Metha, M. R. , see Mehata, M. R. Mette, Adelheid 31, 62, 229, 236, 240 Meyer, John Jacob 183 Misrimala 21-23, 60, 69, 74, 89, 98, 103, 105, 109, 115, 120, 124, 137, 174, 175, 179, 194, 197, 213, 244, 263, 267, 271 Mithalala 197, 215 Miyao, Masahiro 217 Modi, M. C. 101, 103, 105, 108, 114, 115 Mohana Muni 5, 177, 180 Molha (pupil of Sobharsi) 177 Morgenroth, Wolfgang 196 Muktiprabha, Sadhavi 21, 27, 107, 108 "Muni Sundara sisya" = Subhasila? 184 Municandra Suri (pupil of Vinayacandra) 186, 232, 246 Oberlies, Thomas 229 Ohira, Suzuko 84 Ojha, Ambikadatta 57 Oldenberg, H. 249 Ousaka, Yumi 39, 53, 54, 64, 65, 162, 201, 202, 217 Padalipta 163 Padmasagara Gani (pupil of Vimalasagara Gani) 185 Padmasagara 127 Padmasundara Gani 77, 129 Pagariya, Rupendra Kumara 83, 273 Pancanirgranthasutra 86 Pascanirgranthasamgrahani 86 Pandey, Ramesh Chandra 30 Pandita, Prabodha Becaradasa 231 Panyasa, Muni 237 Paramala Candaliya 98 Paramanukhandasattrimsika 86 Paramananda (pupil of Anandacandra) 129, 133 Paramananda Rsi 4 Paraskumara, Muni 172, 175 Paravastu Venkata Ramanujaswami 35 Parsvacandra (pupil of Sadhuratna) 44, 56, 67, 109, 113, 135, 155, 164, 170, 186, 205 Parsvacandra Suri 248 Parsvadeva Gani 235 Parikh, Joharimal 52 306
Page #329
--------------------------------------------------------------------------
________________ Ratnasagara Gani (Kharatara gaccha) 204 Ratnasimha Suri (pupil of Municandra) 85, 246 Raycand, Kavi 256 Roth, Gustav xix, 83, 91, 92, 184 Rudhanathadasa, Sa. Tribhovanadasa 64 Patela, Gopaladasa Jivabhai 50, 62, 63, 83, 104, 108, 116, 126, 197, 2144 Patwardhan, M. V.215 Pavolini, P. E. 183 Pischel, R. 32, 35 Prabhacandra 271 Prabhananda (pupil of Devabhadra) 186 Pradyumnakumaracarita 12 n.6 Pralamba Suri 259 Pranakuivarabai 63 Pratapa 5, 151, 153, 154, 155, 159, 163, 164, 165, 166 Pravina Rsi 22, 109, 112 Priyadarsanasri 52 Prthvicandra (pupil of Devasena) 248 Pudgalasattrimsika 86 Punyanandana Gani (Tapa gaccha) 186, Punyasagara 134, 135, 135 n.1 Punyavijaya, Muni 17, 47, 59, 61, 70, 75, 131, 149, 151, 159, 166, 167, 168, 171, 172, 173, 178, 192, 211, 212, 227, 252, 260, 273, 278 278 n.1 Puppha Bhikkhu 16, 45, 51, 57, 68, 74, 78, 88, 97, 102, 107, 110, 114, 120, 124, 127, 131, 136, 139, 144, 171, 178, 190, 210, 227, 252, 261, 266, 270 Purana Chand Syamsukha 194, 197 Purnananda vijaya 85 Puspavati, Mahasati 22, 213, 215 Pyaracanda, Muni 63, 92, 102, 104, 196, 252, 256 Sadhuranga 56 Sadhuratna Suri 44, 55, 109 Sagarananda Suri (=Anandasagara Suri) 5,43, 47, 64, 68, 70, 75, 109, 114, 116, 117, 127, 130, 126, 169, 171, 177, 186, 188, 204, 207, 221, 226, 232, 235, 249, 250 Saha, Ara. Ema. 91, 92 Saha, Naginadasa Kevaladasa 49 Saha, Narottamadasa Naginadasa 233 Saha, Ramanikalala Manasukhabhai 27 Saha, Ukedabhai Sivaji 82 Saha, Vadilala Motilala 147 Saha, Venicandra Surcandra 239 Sahajakirti (pupil of Hemanandana Gani) 247 Sakalacandra (Kharatara gaccha) 204 Sakalacandra Upadhyaya 247 Salibhadra Suri 127, 169 Samadarsi, Muni 46 Samaracandra (Parsvacandra gaccha) 123, 164, 186 Samayasundara (Kharatara gaccha, pupil of Sakalacandra Upadhyaya) 67, 247 Samayasundara Gani (Kharatara gaccha) 185, 204 Raghavan, V. xix Rajacandra (Parsvacandra gaccha) 123 Rajacandra Suri 204 Rajacandra 186 Rajahamsa Upadhyaya 204 Rajakirti 99 Rajalabha (Kharatara gaccha) 186 Rajasekhara 160 n.3 Rajasila (Kharatara gaccha) 186 Rajendra Muni 22, 23, 128, 194 Rajendravijaya 221, 222, 232 Rakesa, Muni 27 Ramacandra Gani 3,3-4, 4, 5, 78, 135 Ramacandra Suri (Madahada gaccha) 246 Ramavijaya 247 Ratana Muni 22, 126 Rathaura, Gajasimha 103 Ratnasekhara 248 Ratnachandra 34, 231 Ratnakaravijaya 233 Ratnamurti (Kharatara gaccha) 205 Ratnanandin 182 Ratnaprabha Suri 123 Ratnaprabha vijaya 25 Samayasundara, Upadhyaya 5 Samira Malla 13, 102, 107, 114, 144, 209, 227 Samudraghosa Suri (pupil of Isvara Gani) 235 Samudravijaya Gani 231 Sandesara, Bhogilal Jayachandbhai 29, 36, 190 Sanghadasa (Gani) 259, 269, 275 Sanghavi, jivanalala Chaganalala 89, 92, 255 Sanghavi, Ratanalala 49 Sanghavijaya Gani (pupil of Vijayasena Suri) 247 Sanghavi, Sukhalal 30, 44 n.2 Sankrtyayana, Rahula 63 Santabala, Muni 196 Santibhadra Acarya 186 Santicandra Gani 5, 135 Santideva Suri 205 Santisagara (pupil of Srutasagara) 247 Santivijaya (pupil of Devavijaya) 247 Santyacarya Vadivetala (Tharapadra gaccha) 181, 182 Sarma, Dinesacandra 1651 Sarma, Raghunatha 31 Sastri, Balacandra xviii Satyavrata Samasrami 105, 119 Saubhagyacandra 'Santabala 25, 51, 188, 197, 208, 214 307
Page #330
--------------------------------------------------------------------------
________________ Saubhagyamala 48 Saubhagyasagara 259 Sayyambhava 203 Schrader, F. C. 169 n.5 Schubring, Walther xix, xix, 27, 28, 48, 50, 63, 91, 160, 161, 166, 207, 212, 214, 216, 244, 260, 263, 266, 267, 268, 269, 272, 274 Sethiya, Bhairadana 209 Seiren, Matsunami 161 Sejjambhava 203 Sen, Amulyachandra 112 Sen, Madhu 272 Sen, Sukumar 26 Shah, Umakant P. 275 n.4 Sham Shastri, R. 141 Sharman, J. N. 52 Shital Prasada 35 Shriyan, R. N. 240 Shrotri, Shridhar B. 27 Simhasuri 169 n.2 Siddhantasagara Suri (Ancala gaccha) 184 Siddhaprajna, Sadhavi 38 Siddharsi 232 Siddhasena Divakara 44 n.2 Siddhasena Gani 277 Siddhasena 44 n.2 Sikdar, Jogendra Chandra 84 Silabhadra 143, 269, 277 Silanka, 9th cent. 43, 55, 220, 279 Simha, Mahendranatha 199 Singh, Arun Pratap xviii Singh, Lalit Kumar 158 Sisodiya, Suresa 149, 155, 157, 159, 164, 168 Sitakumvaraji, Sadhvi 169 n.1 Sivanandi, Vacaka 163 Sivaprabha Suri (pupil of Cakresvara) 204, 225, 143, 169, 176, 269, 277, 284-85 Sresthidevacandra-Lalabhai-Jainapustoddhara Phanda 5-11 Sri Harsapuspamrta Jaina granthamala 19-21 Srisara (pupil of Hemanandana Gani) 247 Sritilaka, see Tilakacarya Srivijaya (pupil of Ramavijaya) 247 Sruta sagara (pupil of Dharmasagara) 247 Stache-Rosen, Valentine xix Steinthal, Paul 90 Stevenson, R., Reverend 255 Subhasila 184 Subhavijaya (pupil of Hiravijaya Suri) 247 Subhavimala Gani (Tapa gaccha) 248 Sukhasagara 247 Sumati Suri 205 Sumatikallola 67 Sumativijaya (= Sumati Suri?) 205 Suprabha 'Sudha' 23, 228 Suravijaya (pupil of Kirtivijaya Gani) 247 Surchand, S. V. 139 Suru, N. G. 120 Svarna Kanta 146 Syamacarya 129 Tanigawa, Taikyo 162 Taporatna Vacaka 184 Tarunaprabha (pupil of Jinacandra Suri) 231 Tatia, Nathmal, see Mahaprajna Tatiya, Nathamala, see Mahaprajna Tejoraja 184 Tessitori, L. P. 169 n.5 Thaker, Dhirubhai P. 25, 36, 222, 223, 255 Thaker, J. P. 200 Thakur, Anantlal 176 Thibaut, G. 141 Tieken, Herman xv, 32, 43, 55, 62, 63, 64, 199 Tilakacarya (pupil of Sivaprabha Suri) 204, 225, 277 Tilakavijaya 49 n.4 Trilokacandra, Muni 210, 214 Tripathi, Chandrabhal xv, xx, 273, 275, 276 Tripathi, C. B. , see Tripathi, Chandrabhal Tripathi, R. C. 125, 126 Tul(a)si, Acarya 17-19, 38, 44, 46, 69, 174, 179. 191, 192, 194, 197, 199, 211, 213, 215, 216, 227, 254, 260, 265, 267, 270, 271 Turner, R. L. 36 277 Smet, Rudy 16 n.8 Sobharsi 177 Sogani, Kamalacanda 49, 213 Solomon, Esther A. 223 Somaprabha 277 n.2 Somasundara Suri (Tapa gaccha) 77, 151, 155, 249 Somavimala Suri (pupil of Bodhakacarya) 205 Somavimala Suri (pupil of Hemavimala) 246 Spies, Otto 29 Sravana Muni 123 Sricandra, 13th cent. (author of Sangrahani ratna) 139 Sricandra (pupil of Prabhananda) 186 Sricanda Surana 'Sarasa' 21-23, 47, 60, 80, 90, 103, 132, 214 Sricandra Suri (pupil of Salibhadra Suri) 127 Sricandra Suri (pupil of Dhanesvara Suri) 5, Udaya, Muni 49 Udayanandi Suri 85 Udayasagara (Ancalika gaccha) 184 Udayasagara (pupil of Dharmasekhara) 246 Udayavijaya 186 Uddyotana Suri (Candra gaccha) 182, 186 Umanga Suri, see Vijayomanga Suri 308
Page #331
--------------------------------------------------------------------------
________________ Umaravakumvara 'Arcana' 22 Umesacandra Anu' 57, 120, 122 Umranikar, H. A. 183 Upadhya, A. T. 114, 115, 209, 214 Upadhye, A. N. 16,30 Upasak, C. S. 162 Urvasibai, Sadhavi 98, 99 Usabai 63 Uttamasagara (Tapa gaccha) 248 Vadekar, R. D. 190 Vadideva Suri 232 Vaidya, N. V. 82, 87, 92, 101 n.1, 105 n.1, 125, 144, 182, 190, 213, 215 Vaidya, P. L. 56, 82, 97, 101, 105, 111, 114, 125 Vallabhavijaya 68 Vanararsi Gani =Vijayavimala?) 86, 135 Vanitabhai, Sadhavi 91, 92 Velankar, Hari Damodar xx Venkatasubbiah, A. 123 Verclas, Katrin 229 Vidyaratna Gani (Bthat Tapa gaccha) 87 Vidyavijaya 85 Vidyavilasa Gani (pupil of Kamalaharsa) 247 Vijayananda Suri 247 Vijaya Muni 29, 107, 108 Vijaya Sadhu (fl. late 19th cent.) 109, 112, 113, 116 Vijaya Suri 73 Vijayadana Suri (Tapa gaccha) 135, 170, 185, 246, 247 Vijayadeva Suri (Tapa gaccha) 247 Vijayadharma Suri 85 Vijayaharsa Gani 185 Vijayajinendra Gani / Suri 19-21, 58, 76, 89, 109, 120, 145, 159, 181 n.1, 254, 256, 262, 273, 274 Vijayakta 95 Vijayakamala Suri 178 Vijayakumuda Suri 44 Vijayalabdhi Suri 85 Vijayamegha 250 Vijayaniti Suri 144 Vijayaprema Suri 270 Vijayaraja Suri 247 Vijayarajendra (1827-1906) 33, 158 Vijayarajendra Suri (Tapa gaccha) 273 Vijayarajendra Suri (Tristutika gaccha) 248, 250 Vijayarama Suri 254 Vijayasadhu 3, 4, 44, 87, 170 Vijayasena Gani 155 Vijayasena Suri 247 Vijayasena 187 Vijayatilaka 249 Vijayavimala Gani (=Vanararsi, pupil of Anandavimala Suri) 158, 165 Vijayendu (Candrakula) 259 Vijayendra Suri (Tapa gaccha) 19-21 Vijayomanga Suri 189, 193 Vikrama Suri 173 Vikramasena 232 Vimalacandra (pupil of Sricandra) 186 Vimalaharsa (pupil of Vijayadana Suri) 185, 247 Vimalakumara Muni 17 n.9, 27 Vimalaprajna, Sadhavi 38 Vimalasagara Gani (Tapa gaccha) 185 Vinaya Muni 'Vagisa' 26, 179, 192, 193, 212 Vinayacandra (pupil of Ratnasimha) 232, 246, 271 Vinayadeva Suri (=Brahma Muni, Brahma sisya) 135, 274 n. 1 Vinayahamsa (pupil of Mahimaratna) 184,204 Vinayaraja Gani 155 Vinayasagara 161, 162, 223, 253, 256 Vinayasundara Gani 151 Vinayavijaya Gani (pupil of Kirtivijaya Gani) 151, 247 Vinayavijaya 185 Vinodakumara 58 Viragani (pupil of Devacarya) 235 Viraputra, see Banthiya, Ghevaracandra Viraputra' Vivekahamsa 95 Visalasundara 165 Visvanatha, Pandita 5, 143 Vogel, Claus xx von Glasenapp, Helmuth 27 Vtddhivijaya Gani 247 Warren, S. J. 82, 146 Watanabe, Kenji 16 n.8, 53 Watanabe, Shoko 199 Weber, Albrecht 81, 83, 112, 141 Weibgen, Gunter xix Wiles, Royce 84, 145 Windisch, Ernst xx Winternitz, Moriz xx Woolner, A. C. 34 Yasascandra Gani 77 Yasobhadra Suri 205, 248 Yasodeva Suri 170 Yasovijaya 77, 86, 249 Yajima, Michihiko xvii Yamazaki, Moriichi 39, 53, 54, 64, 65, 162, 201, 202, 217 Yatindra (pupil of Hemanandana) 204 Yatindra Suri 33 n.12 Yatindravijaya 33 309
Page #332
--------------------------------------------------------------------------
________________ saMvat 2057 varSe zrAvaNasudi 5 zukravAre /