Contemporaneity and Chronology of Mahavira and Buddha

Author(s): Nagrajmuni, Mahendramuni
Publisher: Today and Tomorrows Book Agency
Catalog link: https://jainqq.org/explore/006721/1

Page #1
THE CONTEMPORANEITY AND THE CHRONOLOGY OF MAHAVIRA AND BUDDHA

Page #2
BY THE SAME AUTHOR 1. Jain Philosophy and Modern Science 2. The Anuvrat Ideology 3. Light of Inspiration 4. Pity and Charity in the New Pattern of Society 5. Pen Sketch of Acharya Shri Tulsi 6. The Strides of the Anuvrat Movement 7. Glimpses of Terapanth 8. Glimpses of Anuvrat

Page #3
THE CONTEMPORANEITY AND THE CHRONOLOGY OF MAHAVIRA AND BUDDHA Vu MUNI SHRI NAGRAJJI, D. LITT. Anuvrat-Adviser Foreword By DR. BISHESHWAR PRASAD Head of the Department of History University of Delhi Edited and Translated Vu MUNI SHRI MAHENDRA KUMARJI 'DVITEEYA' B.Sc. (Hons.) TODAY AND TOMORROW'S BOOK AGENCY 22B/5, ORIGINAL ROAD, DEV NAGAR KAROL BAGH, NEW DELHI-5 1970

Page #4
Publishers Today and Tomorrow's Book Agency 22B/5, Original Road, Dev Nagar Karol Bagh, New Delhi-5 Rajendera Kumar Jain August 1970 Price: Fifteen Rupees Printed by R. K, Printers, Kamla Nagar, Delhi

Page #5
FOREWORD Historical scholarship in India has made considerable progress, yet many unresolved problems continue to face the students of our past history. Paucity of source material and inadequate assessment of the canonical and other literature have limited the scope and extent of enquiry. For the ancient period of Indian history, in the absence of conventional sources such as chronicles, official records and other documents, our basis of knowledge gets confined to religious writings, literature and epigraphic evidence. These data might provide adequate frame work for the understanding of cultural and social developments in that age, but certainly are unable to throw sufficient light on chronology or sequence of events with any preciseness. For this reason even today we are unable to fix the dates of rulers or dynasties precisely, or to indicate definitely the age of leaders of thought and great religious reformers. Because of this handicap, the study of the history of ideas is also considerably affected and it may not be possible always to determine the relationship between one set of ideas and another with any definiteness. This drawback has led to speculations and considerable confusion and vagueness in the interpretation of history of India. Two mighty movements flourished about the same time in one region and influenced the mind and behaviour of large masses of people both in India and abroad. Their progenitors, Mahavira and Buddha, acquired fame in later ages and have left behind them the two religions, Jainism and Buddhism, which had great impact on the life and thought of the people in India. Yet, unfortunately, our knowledge about them is still meagre and has been derived from not very direct and unimpeachable sources.

Page #6
Mahavira and Buddha Even today there is a mysterious uncertainty about their date of birth and death and the period of their mission. It is largely believed that they were contemporaries and that their field of action was the region of Bihar. But we have no information whether they ever met and what was the attitude of the one towards the other. The philosophy which permeated their teachings is fundamentally the same, yet it is impossible now to say whether one derived inspiration from the other or both of them drew from the same source. If both of them flourished in the same period and their thought had independent origin and growth, then there must have been certain features in the contemporary society which prompted both of them to raise their voice against the common evils. History has to supply answers to these and similar other questions which arise in the mind of an enquiring devotee of the Muse of History. Muni Shri Nagarajji has presented a well-reasoned analysis of the problem of the contemporaneity of Mahavira and Buddha. He has critically examined the existing theories propounded by foreign and Indian scholars, and on the basis of the evidence contained in canonical literature of the Jains and Buddhists, has come to the conclusion that Mahavira was the senior of the two, who was born earlier, took to his mission earlier and attained the Nirvana earlier than Buddha. His dissertation is full of critical examination and interpretation of established literary evidence. He has drawn upon Jaina source liberally and these have a richness which make them highly valuable for students of history. I congratulate Muniji on his production which I am certain will provoke scientific study of the problem of chronology of social and cultural movements and unfold the sources of inspiration and the socio-economic and other factors which gave them birth. The book fills a gap and will fulfil a great purpose. The learned Muni has brought to bear his erudition, critical

Page #7
Foreword vii judgement and dispassionate objectivity on the exposition of a difficult problem. It is all the more creditable that he has not allowed his religious bias to affect his conclusions and has relied on logic and concrete evidence in substantiating his point. The book is a distinct contribution to knowledge. BISHESHWAR PRASAD Head of the Department of History University of Delhi 11 May 1967

Page #8

Page #9
PREFACE The philosophical and historical aspects of Jain and Buddhist traditions have been my subject of interest for over a number of years. Some time ago, the editor of Jaina Bharati received a letter from Sri Kastur Chandji Banthia, in which he had written : "I was surprised to read in Muni Sri Nathmalji's book, Jaina Darsana ke Maulika Tattva, that Maha vira was older than Buddha. I tried to get it clarified by some evidence but to no avail. Again, Muni Sri Nagrajji has emphasized this viewpoint in an article entitled "Bhagvana Sri Mahavira aur Gautama Buddha,' in your quarterly, "Lord Mahavira was older than Gautama Buddha. When Lord Buddha started preaching, Lord Mahavira had already done a good deal of work in that field.' "Lord Mahavira lived seventy-two years on this earth, while Gautama Buddha attained the Nirvana at the age of eighty. No historian has so far doubted the veracity of these facts. Of course, the question, as to which of the two attained the Nirvana first, has aroused fierce controversy amongst historians. If it is agreed that Mahavira was older than Buddha, then we have to accept the view that the former predeceased latter. But the late Dr. Hermann Jacobi in the last article of his life "The Nirvana of Buddha and Mahavira and the Contemporary Political Conditions in Magadha' had conclusively proved by citing the Jaina Agamas (canons) that Mahavira lived some years (probably seven years) even after the Nirvana of Buddha. Mahavira attained omniscience at the age of forty-two and after that he preached for almost thirty years. On the other hand, Buddha attained enlightenment at the age of thirty-six and Nirvana when he was eighty years old. Thus Buddha

Page #10
Mahavira and Buddha in all preached for over a period of forty-four years. Now if, according to Dr. Jacobi, Mahavira attained the Nirvana seven years later than Buddha, how is it possible that Mahavira had already done a good deal of preaching even before Buddha ? "Relying on the Uvavai Sutra, one of the thirty-two canons accepted by the Terapantha Sect, Dr. Jacobi has tried to refute the erroneous theory of some of the Western scholars based on (i) the Samagama Sutta of the Majjhima Nikaya, (ii) the Pasadika Suttanta of the Majjhima Nikaya, and (iii) the Sangitipariyaya Suttanta of the Digha Nikaya. Therefore, the untenable notion of the Terapantha sect stands to scrutiny. It is not without significance that Mahavira himself said in the Bhagavati Sutra that he would live for sixteen years after the death of Gosalaka and that the Mahasila kantaka and Rathamusala wars were fought by Konika, just after he became the king of Magadha. The first war was spoken of as a 'finality' by Gosalaka. Moreover, according to the Buddhists, Buddha attained the Nirvana in the eighth year of Ajatsatru's (Konika's) reign. * "In spite of all these evidences to the contrary, it is beyond my comprehension how Terapanthis continue to hold to their rigid belief. It verily needs an explanation....It will be in the fitness of things if you publish an article detailing the evidence and the reasons for the said belief." I received this letter during my chaturmasa at Saradarasahara in Vikrama Samvat 2019 (i.e. in 1962). At that time I was extremely busy in my usual literary pursuits and in seasonal festivities. Simultaneously, I was carrying on the onerous responsibility of giving religious instruction to 1500 Jain families of Saradarasahara. The result was that I could not give any serious thought to the above-mentioned letter. However, a copy of the same was sent to Acharya Sri Tulsi, at Udaipur, by Jaina Bharat quarterly of the Jain Svetambara Terapanthi Maha

Page #11
Preface sabha. The Acharya asked for my opinion on the subject. Meanwhile, the pressure of work at my hand decreased and I was able to devote some time to the writing of the present book. Sri Banthia has expressed surprise that, in spite of much evidence, the Terapanthi Sect continues to hold on to its particular opinion. As a matter of fact, it is not at all a question of sectarian belief. None of the fundamental principles or concepts of Terapantha will in any way be violated by accepting Mahavira's seniority to Buddha or vice versa. The view expressed by Muni Sri Nathamalji and me, that Mahavira was older than Buddha, was based on the Jaina and Buddhist traditions, while Muni Sri Nathamalji's theory as propounded in his work Jaina Darsana ke Maulika Tattva, that Buddha flourished forty years after Mahavira, was only an acceptance of someone else's conviction. However, the procedure followed in the present study has been that of unbiased investigation measured on the yardstick of pure historical facts. The 2500th anniversary of the Mahapariniry a of Lord Buddha, celebrated on the full moon in May 1956, was observed on the basis of chronology as described in the Ceylonese chronicle, Mahavamsa. Though various schools of Buddhism have their different systems of chronology, yet they were in unison to celebrate the festival?. Interestingly enough, some sects consider the full moon day of the lunar month of Vaisakha to be the day of Buddha's birth, enlightenment and Nirvana, while others agree with regard to the day of Buddha's birth and enlightenment but differ from them regarding the day of Buddha's Nirvana. In their opinion, Buddha attained Nirvana on the full moon day of the lunar month of Kartika. In spite of all these differences, almost all the Buddhist countries observed the 2500th anniversary of Buddha's Nirvana 1. Cf. 2500 Years of Buddhism, "Foreword" by Dr. Radhakrishnan, p. 1

Page #12
Mahavira and Buddha with great enthusiasm, giving added importance to the universal glory of Buddhism. According to the traditional Nirvana era of Maha vira, 2500 years from Mahavira's Nirvana will be completed in 1974 A.D. Since no sect or sub-sect of Jainism has any differences regarding the date of the anniversary, it is essential on the part of the whole Jain community to celebrate this occasion in a systematic and well-organized manner. I would be failing in my duty if I were not to mention the immense help that my colleague Muni Mahendra Kumarji "Dviteeya' rendered in the writing of the present volume. I also owe a debt of gratitude to Shri Sampat Kumar Gadhaiya, and Muni Mahendra Kumarji, 'Pratham' for the collection and sifting of valuable material. I am equally grateful to those authors, historians and scholars whose books and articles have been liberally referred to elucidate the present work. MUNI NAGRAJ Bhiksu Bodhi Sthala Rajanagara (Rajasthan) 27 July 1963

Page #13
EDITOR'S NOTE Although Mahavira and Buddha shine like two resplendent luminaries on the firmament of Indian history, yet it is suiprising that the computation of their contemporaneity and chronology has remained so dim. The complexity of the problem can be easily gauged by the conflicting opinion expressed by renowned scholars. Dr. R.C. Majumdar, Dr. H.C. Raychaudhuri, Dr. K.K. Dattal and Dr. Radha Kumud Mookerjee assert that Mahavira was senior to Buddha and attained Nirvana before the latter. However, Dr. Harmann Jacobil and Jarl Charpentier4 hold the contrary view. On the other hand, Dr. Hoernle5 and Dr. K.P. Jayaswalo think that Mahavira was junior to Buddha but he attained Nirvana before the latter. Much more complicated, in any case, is the problem of the date of Buddha's Nirvana, on which historians have frequently commented. Pandit Bhagwan Lal Inderji? places it in the seventh century B.C., while Dr. Vincent A. Smith' and Dr. Radha Kumud Mookerjee regard this event to be occurring in the sixth century B.C. Dr. R.C. Majumdar, Dr. H.C. Ray 1. An Advanced History of India, Part I, pp. 85-86. 2. Hindu Sabhyata, pp. 216-224. 3. Hindi translation of Dr. Jacobi's article in German in Sramana (Monthly), Vol. XIII, No, VII, p. 10. 4. Indian Antiquary 1914, pp. 195-196; The Cambridge History of India, Vol. I, pp. 139-140. 5. Hastings, Encyclopaedia of Religion and Ethics, Vol. I, p. 264. 6. Journal of Bihar and Orissa Research Society, Vol. XIII, p. 246. 7. Cf, Muni Kalyana Vijayaji, Vira Nirvana Samvat aura Jaina Kala ganana, p. 155. 8. Early History of India, 46-47. 9. Hindu Sabhyata, p. 223,

Page #14
xiv Mahavira and Buddha chaudhuri and Dr. K.K. Dattat hold that Buddha attained Nirvana in the fifth century B.C. Dr. E.J. Thomas goes to the extent of saying that Buddha's Nirvana took place in the fourth century B.C. and in this he has also been supported by a Japanese scholar. An authoritative scholar of Buddhism, Dr. Rhys Davids, reviewing this subject in The Cambridge History of India writes:3 "Unfortunately, even after all that has been written on the subject of the early Buddhist chronology, we are still uncertain as to the exact date of Buddha's death. The date 483 B.C. which is adopted in this history must still be regarded as provisional." Muni Sri Nagarajji, the author of this volume, has waded through the mass of canonical literature of the Jains and the Buddhists (popularly known as Agamas and Tripitakas) to arrive at the contemporaneity of Mahavira and Buddha. It is unfortunate that historians had so far ignored these important works and had instead relied on later literary contributions, the veracity of which is doubted. That is why Dr. Vincent A. Smith was constrained to remark in The Early History of India : "The sacred books of the Jaina sect, which are still very imperfectly known, also contain numerous historical statements and allusions of considerable value. "The Jataka or birth stories and other books of the Buddhist canons includes many incidental references to the political condition of India in the fifth and the sixth centuries B.C., which although not exactly contemporary with the event alluded to, certainly transmit genuine historical tradition." 1. An Advanced History of India, p. 88. 2. Recently Dr. E. J. Thomas has pointed out (B. C. Law Commemo ration Volume, II, pp. 18-22) that, according to Saravastiyadin, Ashoka flourished about a century after Buddha's Nirvana. This even borne out in the Sinhalese chronicles and a Japanese scholar quoted by Thomas places this even in 386 B.C. 3. Vol. I, p. 152.

Page #15
Editor's Note XV "The chronicles of Ceylon in the Pali language, of which the Dipavamsa dating probably from the fourth century after Christ, and the Mahavamsa, about a century and a half later in date, are the best known, offer several discrepent versions of early Indian tradition, chiefly concerning the Maurya dynasty. These Sinhalese stories, the value of which is sometimes overestimated, demand cautious criticism at least as much as do other records of popular and ecclesiastical traditions." Muni Sri Nagrajji has also proved that the Ceylonese chronicles have not been used with "cautious criticism." This lack of caution, to say the least, is responsible for the intricacy of the problem. These chionicles show obvious inconsistencies as compared to the original Buddhist canons, the Tripitakas. As for example, according to the Mahayamsa, Buddha attained Niryana in the eighth year of Ajatsatru's reign. The historians have accepted this belief without examining it critically. But the events of the life of Buddha, as described in the Tripitakas, clearly imply that Ajatsatru's, accession had already taken place during the first twenty years of Buddha's life after his enlightenment. It means that Buddha must have lived at least for another twenty-five years after the accession of Ajatasatru. For, according to the Samannyaphala Sutta of the Digha Nikaya, Ajatasatru (King of Magadha) only once called on Buddha? during a "rainy season" passed in Rajag?ha. However, the Althakatha of the Anguttara Nikaya tells us that Buddha passed the second, third, fourth, seventeenth and twentieth "rainy season," after the enlightenment, at Rajagrha. Of the forty-six "rainy seasons," the remaining twenty-five were spent at Sravasti and the last at Vaisali. Then, how is it possible that Ajatasatru's accession took place only seven or eight years before Buddha's Nirvana and 1. Pp. 10-12 2. Cf. Rhys Davids, Buddhist India, p. 88,

Page #16
xvi Mahavira and Buddha that he met Buddha only seven or eight years before his Nirvana. The Muni in this treatise has given a critical and careful evaluation of such inconsistencies. Though the main object of the present study is to decide "the contemporaneity and chronology of Mahavira and Buddha," the author has also discussed the chronology of kings right from Sisunaga to Chandragupta Maurya. He has even refuted some of the misconceptions regarding the Nanda period. Not only that, he has also brought into light a number of unknown facts connected with the Jain and Buddhist traditions : Pava, where Mahavira attained Nirvana, is a village situated in North Bihar and not in South Bihar ; Ajatasatru was a follower of Mahavira and merely a patron of Buddha ; origin of the schism in the Jain Church resulting in the creation of Svetambara and Digambara sects. The exhilaration which I have felt and the knowledge I have gained have, undoubtedly, richly compensated me for the effort involved in the editing of this volume. The task of translating was not an easy one, as there were a number of technical terms in Jainism and Buddhism, which needed a fair amount of explanation. At the same time, I had to study lhe English rendering of the Jain and Buddhist canons by scholars like Dr. Jacobi, Dr. Rhys Davids, Mrs. Rhys Davids, E.M. Hare, F.L. Woodward, and I.B. Horner. I thank Muni Sri Mahendra Kumarji 'Pratham' for his valuable guidance in carrying out this work. I am also thankful to Mr. Sohan Lal Gandhi of the Gulabpura High School for his commendable participation in the work of translation. MUNI MAHENDRA KUMAR 'DVITEEYA' 7 September 1963

Page #17
CONTENTS I. Introduction II. View of Foreign Scholars Dr. Jacobi's First Approach The First Review The Date of Mahavira's Nirvana The Date of Buddha's Nirvana III. Dr. Jacobi's Second Approach The Last Essay? The Quintessence of Dr. Jacobi's Essay Ajatastru in the Buddhist Pitakas Konika in Jain tradition Pava, the place of Mahavira's Nirvana Agamas and Tripitakas in relation to the Contemporary Conditions The Date of Mahavira's Nirvana The Date of Buddha's Nirvana Inconsistencies Conclusion Pandit Sukha Lalji and Other Scholars Dr. Charpentier IV. Dr. K. P. Jayaswal Mahavira's Nirvana and Vikrmaditya A Critique Dr. Radha Kumud Mukherjee Dr. Kamta Prasad Jain Dharmananda Kausambi Dr, Hoernle and Muni Jina Vijayji

Page #18
xviii Mahavira and Buddha V. Muni Kalyana Vijayaji A Critique Mahavira Middle-aged, Buddha young Testimony of the Later Works Contradictions Shri Vijayendra Suri Dr. Shanti Lal Shah Shri Shrichand Rampuria VI. Historians' view A Critique VII. Research and conclusion Need of an Exhaustive Research The Evidence of the Buddhist Tripitakas The Event of Mahavira's Nirvana in Tripitakas A Critical Examination The Events of Mahavira's Seniority in Buddhist Tripitak as A Critical Examination Contemporaniety and Chronology Chronology of Mahavira The Vikrama Era : The Saka Era The Gupta Era Astrological Calculations Traditional Era of Vira Nirvana Chronology of Mahavira's Life Traditional Dates of Buddha's Nirvana Historians' Date of Buddha's Nirvana Problem of Chronology Reconstruction of Chronology

Page #19
Contents xix 108 115 121 121 122 123 133 Inconsistencies in Ceylonese Chronology Chronology of Buddha VIII. Corroboration of the Conclusion 1. Tibetan tradition 2. The Traditional Date of Chinese Turkestan 3. Asoka's Edicts 4. Burmese Tradition Appendix I The Chronological List of Rainy season Passed by Maha vira after His Attainment of Omniscience, Appendix II The Chronological List of Rainy seasons Passed by Buddha after His Enlightenment. Bibliography Index 139 141 143 155

Page #20

Page #21
CHAPTER I INTRODUCTION Man is curious by nature. Curiosity adds to his knowledge and knowledge increases curiosity. In this cycle of knowledge and curiosity lies the boundless joy of life. It is these two that lead unfailingly to truth. When history first took up the question of Mahavira and Buddha, the two were regarded as identical by some scholars.1 Others identified Buddha with Gautma Svami, the chief disciple of Mahavira. But a little investigation proved 1. Scholars, like Prof. Lassen regarded Buddha and Mahavira as identical, because the Jain and Euddhist traditions are almost identical on some points (cf. the Gaina Sutras, Sacred Books of the East, Vol. XXII, introduction, p. XIX.) 2. According to the Jains, the chief disciple of their Tirihankara Mahavira was called Gautma Svami (Ward's Hindus II p. 247, and Colebrooke's Essays, Vol. II p. 279) or Gautama Indrabhuti, whose identity with Gautama Buddha was suggested both by Dr. Hamilton and Major Delamaine and was accepted by Colebrooke. "This is what Colebrooke says in his Essays, Vol. II p. 276. In the Kalpa Sutra and in other books of the Jains, the first of Mahavira's disciples is mentioned under the name of Indrabhuti, but in the inscriptions under that of Gautama Svami. The names of the other ten precisely agree, whence it is to be concluded that Gautama, the first one of the first list, is the same with Indrabhuti, the first of the second list. It is certainly probable, as remarked by Dr. Hamilton and Major Delamaine, that the Gautama of the Jains and the Gautama of the Buddists is the same personage. Two out of eleven disciples of Mahavire survived him, viz. Sudharma and Gautama Svami. Sudharma's spiritual successors are the Jain priests, whereas the Gautama's followers are the Buddhists." -Manmath Nath Shastri, M.A.M.R.A.S., Buddha : His life. His Teachings, His Order, 1910 (Second Edition), p. 21-22.

Page #22
Mahavira and Buddha very soon that Mahavira and Buddha, though belonging to the same generation and country, were two distinct personalities, the former having lived on this earth for 72 years' and latter for 80 years. Next, curiosity led the people to ask the question : How long did Mahavira and Buddha live as contemporaries and who was the older of the two ? This question has drawn the attention of many a thinker and till now numerous efforts have been made to solve it. A good deal of new light has been thrown on it, but the conclusions reached are not indisputable. The various events described in the Jain Agamas, the Buddhist Tripitakas and the historical works, which appear to be inconsistent with one another have led the scholars to diverse conclusions. The classification of the efforts made so far, their critical examination and a humble effort to push the subject to an indubitable stage on the basis of independent thinking, form the subject matter of the present critique (this essay). 1. Digha Nikaya, Mahaparinirvana Sutta, 2-3-16. 2. Kalpa Sutra, 147.

Page #23
CHAPTER II VIEWS OF FOREIGN SCHOLARS We shall first take up the views of Dr. H. Jacobi. Dr. Jacobi's First Approach It was late Dr. Hermann Jacobi, who first took the lead in making a significant effort in this direction. Dr. Jacobi had added greatly to his credit by having translated four of the Jain canons viz. The Acaranga Sutra, the Kalpa Sutra, the Sutrakrtanga Sutra and the Uttaradliyayana Sutra. These translations wese published in two volumes in the Sacred Books of the East Series", edited by Max Muller, an outstanding scholar of oriental learning. Besides this, Dr. Jacobi has also rendered other valuable services to Jainism. We owe the credit to him for having brought Lord Parsva Natha, the 23rd Tirtharikara in the category of historical personalities. The fallacy prevalent in the field of history that Jainism was nothing but a branch of Buddhism, was also disembroiled mainly by Dr. Jacobit. He also visited India twice in order to be able to get first 2. 1. Although Dr. Jarl Charpentier first dealt with the subject specially with a view to decide the chronology of Buddha and Mahavira, but Dr. Jacobi is responsible for the primary research in this field. There are 50 volumes in this series, out of these the Vol. XXII contains the translations of the Aceraniga Satra and the Kalpa Sutra, and the Vol. XLV contains the translations of the Satrakrtanga Sutra and the U.taradhyayana Sutra. 3. Sacred Books of the East, Vol. XLV, Introduction to the Jain Sutras Part II p. XXI, 1894. 4. Sacred Books of the East Vol. XXII, Introduction to the Jain Sutras Part I, pp. IX to XIX, 1884.

Page #24
Mahavira and Buddha hand knowledge of the Jain traditions in vogue. He established direct contact with many Jain Acharyas during his visit to this country. Dr. Jacobi has referred to the controversy about the dates of the Nirvana of Mahavira and Buddha at two different places and both the descriptions contradict each other. In one review he depicts Mahavira as having predeceased Buddha and vice versa in the other. The First Review His first review appeared in his Introduction to the Acaranga Sutra in 1884. Describing the events associated with the lives of Mahavira and Buddha he writes: "We shail now put side by side the principal events of Buddha's and Mahavira's lives in order to demonstrate their difference. Buddha was born in Kapilavastu, Mahavira, in a village near Vaisali ; Buddha's mother died after his birth, Mahavira's parents lived to see him a grown up man; Buddha turned ascetic during the life time and against the will of his father, Mahayira did so after the death of his parents and with the consent of those in power : Buddha led a life of austerties for 6 years, Mahavira for 12; Buddha thought these years wasted time, and that all his penances were useless for attaining his end, Mahavira was convinced of the necessity of his penances and persevered some of them even after becoming a Tirtharkara. Amongst Buddha's opponents Gosala Mamkhaliputta is by no means so prominent as amongst Mahavira's nor 1. During his second visit to India (March 1914) he met Acharya Sri Kalugani, the 8th Acharya of Terapanth Sect and held important discussions with him for three days. 2. S.B.E. Vol. XXII, Introduction, pp. XVII, XVIII.

Page #25
Views of Foreign Scholars among the former do we meet "Gamali, who caused the first Schism in Jain Church. All the disciples of Buddha bear different names to those of Mahavira. To finish this enumeration of differences, Buddha died in Kusinagar, whereas Mahavira died in 'Pava', avowedly before the former". Dr. Jacobi has absolutely omitted the mention of evidences supporting his belief nor has he reviewed the dates of the birth and death of both. Hence it is difficult to infer his view about the contemporaniety of Mahavira and Buddha. The Date of Mahavira's Nirvana The allusions occurring in both the volumes of the Jain Sutras edited by Dr. Jacobi bear testimony to the fact that he regarded 526 B.C. as the date of Mahavira's Nirvana. He writes. "The recordation of the Jains canon or the Siddhania took place, according to the unanimous tradition in the council of Vallabhi' under the presidency of Devardhi. The date of this event 980 (or 993) A.V.? corresponding to 454 (or 467) A.D. is incorporated in the Kalpa Sutra, ($148)." "This extract confirms the fact that Dr. Jacobi has accepted 526 B.C. as the date of Mahavira's Nirvana, for we get 980 and 993 respectively only after adding 454 and 467 to 526. He has repeated the same fact, incidentally, in his introduction to the second volume of the Jaina Sutras edited by him.3 It was written in 1894 A.D. i.e. ten years after the introduc*tion, he wrote the first volume. We come across one more allusion in that introduction which indisputably confirms 1. S.B.E Vol. XXII, Introduction, p. XXXVII. 2. A.V. means "after the death of Vira" (i.e., Mahavira). 3. S.B.E. Vol. XIV, Introduction, p. XI.

Page #26
Mahavira and Buddha 526 B.C. as the date of Mahavira's Nirvana, Dr. Jacobi writes: "Khaluya Rohagutta of the Kausika Gotra with whom originated the six schisms of the Jains, established Trairasika Matam in 544 A.V. (18 A.D.)". Here too, we get 18 A.D. only after substracting 526 from 544. The Date of Buddha's Nirvana Similarly Dr. Jacobi has not referred to any specific date about the birth or death of Buddha in these Introductions, but whatever he has written there, even though in different allusions, reflect his idea about the date of Buddha's Nirvana. For instance, he writes quoting Max Mullar's extract that the lastest date of Buddhist canon at the time of the Second Council was 377 B.C." It is an unanimously accepted fact that this Council was held at Vaisali, 100 years after the Nirvana of Buddha. It follows that 477 B.C. is the date of Buddha, Nirvana in the opinion of Dr. Jocobi on the basis of his concept at that time. If these were the dates of the Nirvana of Mahavira and Buddha, Mahavira was 41 years older than Buddha. 1. S.B.E., Vol. XLV. Introduction, p. XXXVII, quoted from S.B.E. Vol. X, p. XXXII ; S.B.E. Vol. XXII, p. XLII. 2. See Cullvagga II, 12-1-1; Buddha Carya by Rahul Sankrityayan, p. 556 ; Political History of Ancient India, by H.C. Raychoudhuri (Sixth Edition) 1953. p. 228.

Page #27
CHAPTER III DR. JACOBI'S SECOND APPROACH Dr. Jacobi had made another approach to the problem in his essay entitled as "The Nirvana of Maha vira and Buddha published in the 26th issue of a German research magazine in the year 1930. Its Gujrati rendering was published in Bhartiya Vidya1 and subsequently its Hindi translation, collected by Shri Kastur Chand Banthia, appeared in Sramana2, a monthly Hindi Magazine. The conclusion of this essay is that Buddha died in 484 B.C. and Mahavira in 477 B.C. It means that Mahavira died 7 years after the death of Buddha and the former was fifteen years younger than the latter. The Last Essay 4 According to Sri Kastura Chand Banthia, it was the last essay written by Dr. Jacobi and he has expressed an altered opinion therein. What astounds us is Dr. Jacobi's complete reticence, in this comprehensive essay, about his earlier view and the view he propounded later on, and the reasons that led him to change his opinion. The only thing he says while introducing the essay is: One school of thought says that, in accordance with the historical view passed on to us by tradition and stabilized by evidences, 1. Bhartiya Vidya, Vol. III, No. I, July, 1944. 2. Sramana Vol. XIII, No. VI-VII. 1962. 3. Ibid. Vol. XIII. No. VII, p. 10. 4. Ibid. Vol, XIII, No. VII, preface to the essay of Dr. Jacobi, p. 9. 5. Op. cit., pp. 9-10.

Page #28
Mahavira and Buddha Gautama Buddha had died many years before Mahavira. Another school of thought holds that, on the basis of the allusion found in the Buddist scriptures, Mahavira died perhaps only a little earlier than Buddha. This critique is being written to discover the extent of the truth underlying this obviously discernible contradiction." It is worth noting that Dr. Jacobi had already expressed his earlier view in the introductions to the volumes edited by him and they were published also during his life time. Nevertheless, why does not he again say his earlier statement in the last essay? It might have happend under some circumstances and we have not to go deep with its complicacies now. Here we have only to see on what grounds he has based his novel theory and how far they are true. It is beyond doubt that Dr. Jacobi was a profound critic, yet, as the discoverers of truth, it is our duty to examine and re-examine, any fact on various touch-stones, before accepting it. The Quintessence of Dr. Jacobi's Essay After studying this essay thoroughly one comes to know that this essay was not written only with reference to the date of Nirvana of Mahayira and Buddha, but one of the principal objects behind the writing of this essay was to bring to light the contemporary, political and royal conditions. The actual title of this essay, the Nirvana of Mahavira and Buddha and the contemporary Political Condition of Magadha also signifies the same fact. Also whatever he has written about the dates of the Nirvana is not only insufficient to lead the present controversy to a decisive stage, but it is a little unnatural too. The main evidence, which Dr. Jacobi has advanced in support of his rennovated belief that Buddha was older than Mahavira and that

Page #29
Dr. Jackobi's Second Approach Mahavira survived Buddha by a few years, can be stated as follows: 'The Jain scriptures furnish us with a further account of the later events connected with the wars fought between Ajatsatru (Konika), the king of Magadha and the Vajjis (or Cetaka, the king of Vaisali), etc. than what the Buddhist scriptures do. In the Buddhist scriptures, Vassakara, the Prime Minister of Ajatsatru only lays down a plan of the victory over Vajjis before Buddha, whereas the Jain scriptures bear a picturesque discription not only of the Maha-SilaKantaka war and Rath-Musala war that took place between Cetaka and Konika, but also of the demolition of the rampart of Vaisali and finally of the victory of the king of Magadha over the Vajjis.' On the basis of this evidence, Dr. Jacobi concludes,1 "It proves that Mahavira survived Buddha by several years (probably seven years)." The extent to which the compilers of the scriptures. collected contemporary events in the scriptures, depended. upon the nature of their selection and needs. Even if we accept that the compilation made by the Jains is more extensive and exhaustive in comparison to that made by the Buddhists, it does not prove that Mahavira lived for some years even after the death of Buddha. Ajatsatru in the Buddhist Pitakas It is a fact that the Jain scriptures have recorded more events or reminiscences about Konika. This has happened probably because of Konika's intimate association with 1. Srmana, Vol. XIII, No. VII, p. 35.

Page #30
10 Mahavira and Buddha the Jain religion. According to Dr. Rhys Davids, a distinguish scholar, who carried out a first rate research on the Buddhist literature, however extensive the delineation of Ajatsatru in the Buddhist Pitakas may be, it only proves that he was a mere sympathizer of Buddha, and not a follower. Ajatsatru had once called on Buddha and asked him what the fruits of monkhood were ?! With reference to that event Rhys Davids writes. At the close of the discourse the king is stated to have openly taken the Buddha as his guide in future, and to have given expression to the remorse he felt at the murder of his father. But it is also distinctively stated that he was not converted. There is no evidence that he really, after the moment when his heart was touched, continued to follow Buddha's teaching. He never, so far as we know, waited again either upon the Buddha, or upon any member of the order, to discuss ethical matters. And we hear of no material support given by him to the order during the Buddha's lifetime. "We are told however, that, after the Buddha's death, he asked (on the ground that he, like the Buddha, was a Ksatriya) for a portion of the relics; that he obtained them; and built a Stupa or burial-mound over them. And though the oldest authority says nothing about it, younger works state that on the convocation of the First Council at Rajagraha, shortly after the decease, it was the King who provided and prepared the hall at the entrance to the Saptaparni cave, where the rehearsal of the doctrine took place. He may well have thus showed favour to the Buddhists without at all belonging to their party. He would only, in so doing, be following the usual habit so 1. Digha Nikaya Samannya-phal Sutta, 1-2. 2. Buddhist India, pp. 15-16.

Page #31
Dr. Jackobis Second Approach 11 characteristic of Indian monarchs, of patronage towards all schools." Dr. Radha Kumud Mukherjee, the renowned historian, has also proved on the basis of the Samannya-phala Sutta that Ajatsatru was a mere sympathizer, and not a follower of Buddha.? Konika in the Jain Tradition According to the Jain tradition, Konika was a staunch and devoted follower of Mahavira. He went so far as to establish a separate department headed by a special officer exclusively for the purpose of keeping himself informed of the activities of Mahavira's daily life. The officer was called Pravrttivaduka, one who speaks of the activities. He was assisted by a number of subordinates, who used to communicate the news to him. The Pravytti vaduka after editing the news, finally conveyed it to king Konika.?" No soonerdid king Konika receive the news of Mahavira's arrival in the suburb of Campa, capital of his state, while sitting in his court assembly, than he stood up 1. Hindu Sabhyata, P. 191. 2. Tassanam Koniyassa ekke purise viulakae vihie bhagvau pavittivaue, bhagvau taddevasiyam pavitti nivei ! Tassanam purisassa bahave anegapurisa dina bhatti bhattaveyana bhagvato pavittivauya bhagvato taddevasiyam pavittim nivedamti ! Aupapatika Sutra, Samavasarana Adhikara, 10. 3. Tenam kalenam tenam samaenam konie raya bhambhasaraputte bahariya uivatthanasalae anega gananayaka damdanayaga. Saddhim samparivude viharai ! Tenam kalenam tenam samayenam Samane bhayavam Mahavire............... Suhamsuhe Viharamane campaenayarie bahiya uvanagaragamam uvagae! Campanagari punnabhadda ceiyam samosariokame! Tattepam se pavittivaue imise kahae laddhatthe sainane............campanayarie majjhammajjhenam................ jeneva kopivassarannegihe......... ......jeneva koniyaraya bhambhasaraputte teneva uvagcchai, Contd. on next page Tasso

Page #32
12 Mahavira and Buddha and came seven or eight steps ahead of the throne, in a. blissful state ; in the uttara sajiga position? he masked his mouth by a scarf; and chanting "Namotthunam", he said', 'To thee, O Mahavira, who first sowed the seeds of religion in my soul, my religious preceptor, I bow down in reverence from this move place, for thou art yet staying away (in the garden)" After this, when Mahayira had arrived. at Campa, Konika also presented himself in the religious assembly of Mahavira. Not only Konika had visited Mahavira more than once, but also, after Mahavira's uvagacchitta.....evam vayasi.....jassanam devanuppiya damsarnam kamkhanti, jassanam devanuppiya.damsanam patthanti, jassanam deva drasanam abhilasanti jassanam deva nabhagottassavi savanattae hatthatuttha java hiyaya bhavanti senam samane bhagavam Mahavire.........campaenayarie uvanagaramgamam uvagae, ca:ipanagari pusnabhaddaccie samasariakame! Taenam devanu ppiyanam piyatathayae piyani vedemi piyanibhe bhavao ! Tattenam se Konie raya bhambhasaraputte tassa pavitti vauyassa antie eyayattham soccanisammahatthatutthe jaya hiyaye......... simhasanao abbhutthei.........egasadiya uttarasamgam karei......... amjali mauliya hatthe titthayara bhimuhe sattattha payai anugacitti .........tikattu evam vayasi............namotthunam arihamtanam ......... sampattanam......... Ibid, 11-18. The uttarasariga position is the one, in which a Jain layman bows down ; he has to mask his mouth with a scarf, which should be a single piece of cloth without any joints, in order not to kill the lives of air. Namotthunam, which is also known as Sakkathui, (Sakrastuti, is a hymn to pay homage to the Tirthaikaras. This also indicates that Konika was a Jain 'Sraraka'. 3. Namotthunam samanassa bhagavao Mahavirassa adikarassa, titha karassa Java sampaviokamassa mamadhammaigarassa dhammovadesagassa vamdaminam bhagavam tatthagayam ihagate pasaume bhagvam tathagae iahgayam tikattu, vamdarti namam samii". --Aupapatika Sutra, Samarasarana Adhikura, 18. 4. Ibid, 102--137.

Page #33
Dr. Jackobi's Second Approach Nirvana, he attended a meeting arranged by Suddharma Svami, the immediate successor of Mahavira, and put serious questions to him. In addition to these, we find a number of such conclusions in the Jain scriptrures, which make it crystal clear that Konika was a staunch follower of Mahavira and Jain religion. While, on the other hand, as Rhys Davids writes, "When the king of Magadha, the famous (and infamous) Ajatsatru, made his only call upon the Buddha, he is said to have put a puzzle to the teacher to test him......," and as we have already quoted Rhys Davids," "he (Ajatsatru) never, so far as we know, waited again either upon Buddha or upon any member of the order to discuss ethical matters......," Ajatsatru had little inclination towards Buddhism. What opinion, Buddha had for Ajatsatru becomes clear from his own words, he uttered: "O Bhiksus! the king of Magadha Ajatasatru is a friend to, an intimate of, mixed up with, whatever is evil," According to the Buddhist texts, Ajatasatru was, inter alia, a parricide, and a supporter of Devadadatta, the great schismatics. Again it was Ajatsatru according to the Buddhist canons, who incited by Devadatta, ordered his men to deprive Buddha of his life. 13 A similar is the case of Cetaka, the king of Vaisali. He was not only a maternal uncle of Mahavira', but also a 1. Parisisata Parva of Hema-Candracarya, cantos IV v. v. 15-54. 2. Buddhist India, p. 88. 3. Ibid, pp. 15-16. 4. Samyukata Nikaya, 1-81 (The Book of Kindred Sayings, Tr. by Mrs. Rhys Davids, Vol. I, p. 109. 5. Ibid, vol. I, p. 109. 6. Vinaya Pitaka, Culla Vagga, VII 3-6 (The Book of Discipline, Tr. by I.B. Horner, vol. V, p. 268). Cf. also "Shri Chand Rampuria" in chapter V of this Book. 7. Avasyaka Curni, part 1, leaf 245.

Page #34
Mahavira and Buddha staunch follower of Mahavira1. The Buddhist Tripitakas do not even mention the name of Cetaka, though they bear a long description of the Vajjis". Dr. Jacobi, himself, has observed that the reason of taciturnity of the Buddhist canonical texts about Cetaka is that Buddha's rival (i.e. Mahavira) was benefited by the great influence of Cetaka and that the Jains give respect to Cetaka, the maternal uncle of Mahavira, because Vaisali became a strong supporter of Jainism on account of Cetaka, whereas the Buddhists call it (Vaisali) a 'monastery of heretics, Hence, if, according to Dr. Jacobi, the Jain Agamas bear more extensive account of the events concerning Konika and Cetaka than the Buddhist Tripitakas, its natural and consistent reason is that they (Konika and Cetaka) were eminent disciples of Mahavira and Jain religion and 'heretics' in the view of Buddha and not, as Dr. Jacobi has inferred, that Mahavira survived Buddha. Dr. Jacobi's inference is based only on misunderstanding and misinterpretation, for we find that the Buddhist Tripitakas are replete with many such brilliant and candid descriptions, which show that Mahavira predeceased Buddha, while the Jain Agamas say nothing about Buddha's Nirvana. 14 In the light of the aforesaid discussion, the true inference should have been that Mahavira attained the Nirvana before Buddha and Buddha later than Mahavira, for the Jain scriptures maintain no record of Buddha's Nirvana and the Buddhist scriptures distinctly state that Mahavira died earlier than Buddha. The greatest flaw in 1. Ibid, uttarardha, leaf 164; Trisastisalakapurusa Caritra of HemaCandracarya, parva, X, cantos VI, v. 188; Upadesamala, (with commentary) leaf 238; Uttarapurana, p. 483. 2. Digha Nikaya, Maha-Parinivvana Sutta. 3. S.B.E., (Vol. XXII, Introduction, p. XIII.

Page #35
Dr. Jackobi's Second Approach 15 Dr. Jacobi's essay is that he has striven to prove the three allusions of the Buddhist Tripitakas which refer to Mahavira's Nirvanal, false and fictitious with a view to stabilize his own farfetched interpretation. He says that as these allusions occur in varying forms at different places, they are not credible. On the other hand, he also says that despite the variance in these allusions, they have one and the same objective in common, viz. giving the order of monks a message of love and unity by referring to Mahavira's Nirvana indirectly. It is worth noting that in spite of these three allusions being slightly variant from one another, the reference to Mahavira's Nirvana in all of them remains absolutely the same. The compilers of the scriptures might have embellished the prefaces with whatever style they choose, but it would be entirely unreasonable to think that they might have gone so far as to commit a blunder of calling, living Mahavira dead one. Para, the Place of Mahavira's Nirvana ?? Another argument placed forth by Dr. Jacobi in this context is that the city Pava depicted as the place of Mahavira's Nirvana in the Buddhist scriptures lay in the land of Mallas, where Buddha sojourned in his last days, whereas in accordance with the traditional belief of the Jains, Mahavira attained the Nirvuna in another Pava, situated near Rajagrha in Patna district. Hence, like the fictitious Pava, according to Dr. Jacobi, the whole story of Mahavira's Nirvana seems to be nothing but a mere fabri 1. See, for these allusions, 'The Event of Mahavira's Nirvana in Buddhist Tripitakas' in chapter VII of this Book. 2. Sramana, Vol. XIII, No. VI, pp. 14-15. 3. Ibid, p. 15.

Page #36
16 Mahavira and Buddha cation. Dr. Jacobi also holds that it is not justifiable to doubt the Jain traditions about the sacred place of Mahavira's Nirvana. Even if we may assume that the Buddhists had made this mistake on account of the identical name of Pava allotted by them, for such mistakes are liable to be committed, it can not be interpreted that the whole story about Mahavira's Nirvana is completely forged. As a matter of fact, Dr. Jacobi's caution against our expressing even the slightest possible doubt regarding the Pava accepted in the Jain tradition, has not only been rendered dubious on historical grounds, but it has also become baseless. Often there happens to be a striking contrast between history and tradition. The traditional Ksatriyakunda situated near Lichchhuad is supposed to be the birth-place of Mahavira but the research carried into it by modern history has proved it wholly un-authentic. According to the historical concept, the village Basadh, situated in Mujjaffarpur District, 27 miles away to the North of Patna is no other than the Ksatriyakunda, the birth-place of Mahavira. Thus the traditional birth-place lies far off to South of the Ganges, while the historically accepted place is situated to the North of the Ganges. So is the case of Pava. Traditionally accepted Pava lies in the South Bihar and the splendid temples standing there have made it to be the place of pilgrimage for the Jains. But history does not share the belief that it is the true place of Mahavira's Nirvana. According to the modern view, the Pava of Mahavira's Nirvana should be in the North of the Ganges, for the 18 kings of the republics of Mallas and Licchavis were present in Pava at the time of 1. Ivid, p. 16.

Page #37
Dr. Jacobi's Second Approach 17 Mahavira's Nirvana', and this can be more true only with regard to the Pava, situated in the North of the Ganges, since their kingdom lay stretched towards the North side, while the Pava situated in the South of the Ganges (near Rajaglha), lay entirely in the land of their enemy Ajatsatru, the king of Magadha. How could they be expected to be present in the land of their sworn enemy ? Many thinkers and historians such as Pt. Rahul Sankrityayana, Dr. Rajbali Pandey,3 M.A. D. Litt, Nathuram Premi, Dr. Nalinaksa Dutt, Shri Ranjan Suri Deo, Shri Shrichand Rampuria? Acharya Vijyendra Suri, etc. have confirmed this fact. All of them agree to the fact that Mahavira had died in the Pava of Mallas, that this Pava should be on the North of the Ganges and that the Pava situated in the South of the Ganges (near Rajagtha in Patna district) and tradi 1. Kalpa Sutra, 128 ; cf, S.B.E. Vol. XXII. 2. Darina Digdarsana, p 444n. 3. Bhagwana Mahavira ki Nirvana Bhumi Pava ki Sthiti, an artical In Mahavira commemoration volume, Vol I 1948-49, pp 45-9, and Bhartiya Itihasa ki Bhumika (Pracin Bharata), part I, p. 83. Jain Sahitya Aura Itihasa, p. 189. 5. Uttara Pradesa Mem Buddha Dharma ka Vikasa, p. 10. 6. Sramana, Vol. XIII, no. VI. p. 26. 7. Jaina Bharati, Vol. Jan. 1951 p. 17. 8. Vaisali, pp. 85-87. Pt. Rahul Sankrityanaya identifies it with the present Papahura, a village near Ramkola Rly. station in Gorakhapur Distt. (Loc. cit.); Cuuningham identifies it with Padarauna in Devaria Distt; while Dr. Rajbali Pandey (cf. op. cit. pp. 47-8) and Acharya Vijayendra Suri (cf. op cit. pp. 85-7) refute both these views on the basis of the geographical reasons and identify Pava, the place of Nirvana with the ruins of Sathiyamva Fazilanagara, 9 miles south east of Kusinagara in Meveria District. They have corroborated their views by quoting an archaeologist named Karlayle. who, on the basis of his archaeological Survey, had identified Pava with the above place.

Page #38
18 Mahavira and Buddha tionally believed to be the place of Mahavira's Nirvana has erroneously been adopted by the Jains, being oblivious of the true Pava. Thus, it becomes clear that the Pava, on the basis of which Dr. Jacobi rejects the Buddhist allusion about Mahavira's Nirvana by ascertaining them as false and unreal, happens to be the historically accepted Pava and confirms the authenticity of those allusions. Agamas and Tripilakas in Relatian to the Contemporary Condi tions, Dr. Jacobi's view that the Jain Agamas give a more comprehensive account of the contemporary conditions than what the Buddhist Tripitakas do, is also not trustworthy for, the events cited by Dr. Jacobi are not all contained in the original Agamas. The whole event of "The victory over vaisali which ensued after the Mahasila-Kantaka war and the Ratha-Musala war and wherein the monk Kulavalaya became the cause of the demolition of the ramparts of Vajsali, has been quoted by Dr. Jacobi himself from a later Jain work, Avasyaka Katha. The Agamas and the Tripitakas, which are the original canonical texts of the Jains and the Buddhists respectively, in fact, do not differ much regarding the description of the contemporary political conditions. Now, if we consider the later works of both traditions, the work of the Buddhist traditions like Mahavassa contain as much vivid descriptions as we find in those of the Jain traditions. Mahavansa contains even the chronology of the kings up to Asoka?. This by no means testifies to the fact that Buddha died later than Mahavira. 1. Mahavamsa, Pariccheeda, IV-V.

Page #39
Dr. Jacobi's Second Approach The Date of Mahavira's Nirvana Dr. Jacobi regards 477 B.C. as the date of Mahavira's Nirvana and 484 B.C. as that of Buddha's Nirvana. But he refrains from giving any specific indication throughout his essay why it became inevitable for him to accept these dates. He simply says, "Though according to the unanimous traditions of the Jains, Candragupta's accession took place 215 years A.V. (after the death of Mahavira), in accordance with the view propounded by Hemacandra, (Parisista Parva, 8-339) Candragupta acceded to the throne 155 A.V." Dr. Jacobi has supported his view by citing another Jain work, Kahavali, of Bhadresvara. 19 Now, the fact is that, as stated by Dr. Jacobi, it is unanimously accepted in all the Jain traditions that Candragupta's accession took place only 215 years after the Nirvana of Mahavira2 and not 155 years, as accepted by Acarya Hemacandra3. The view of Acarya Hemacandra would prove baseless, if tested on the touchstone of history. Also, the scholars have regarded it as a great blunder committed by Acarya Hemacandra. The most substantiated opinion in this regard is that, a king named Palaka was enthroned at Ujjain the very day on which Mahavira attained the Nirvana. He (or his dynasty) reigned for 60 years. After this, Nandas ruled for 155 years. Then ensued the Mauryan rule, that is to say Candragupta Maurya was enthroned 215 years after the death of Mahavira. This allusion has been extracted from 1. Op. cit. p. 10. 2. See, "Date of Mahavira's Nirvana" in Chapter VII of this book. 3. Evam ca sri Mahaviramuktervarsasate gate! Panc pncasadadhike Candragupto bhavennrpah !! -Parisista Parva, VIII, V. 339. 4. Titthogali Painnaya, 620-21.

Page #40
20 Mahavira and Buddha 'Titthogali Painnaya, which is supposed to be much older than both the books viz. Kahavali of Bhadresavara and Parisista Parva of Hemacandra. It seems that the period of 60 years of the reign of Palaka has completely been omitted in the calculation of Hemacandra's Parisista Parva. Mr. Purna Chandra Nahar, M.A., B.L., M.S., and Mr. Krishna Chandra Gosh, Vedantachintamani write1, "Hem Chandra-charaya must have omitted by oversight to count the period of 60 years of King Palaka after Mahavira's Nirvana." Dr. Jacobi has edited Parisista Parva2. He has observed in the preface to it that Hemacandracarya had composed that work in haste, as a consequence of which the work is studed with errors. Elaborating the subject in the preface itself, Dr. Jacobi has illustrated several compositional and grammatical errors comitted by Hemacandra with concrete evidences. It is quite probable that the verse on the basis of which Dr. Jacobi has inferred the date of Mahavira's Nirvana, might have also been composed with the same carelessness. The date of Mahavira's Nirvana accepted by Hemacandracarya himself, while stating the period of his own contemporary king Kumarapala is 527 B.C., and not 477 B. C. Hemacandracarya writes in Trisastisalakapurscaritra3: "When 1669 years will have been completed after the death of Mahavira, there will flourish a king named Kumarapala who will shine like a moon of Caulu 1. Epitome of Jainism, Appendix A, IV. 2. Published by Asiatic Society, Calcutta. 3. Asmin nirvanato varsasatya (ta) nyamayasodasa ! Navasastisca yasyanti yada tatra pure tada !! Kumarapalabhupalo, caulukyakula-candramah! Bhavisyati mahabahuh pracandakhandasasanah !! -Trisastisalakapurusacaritra, parva X cantos XII, vv. 45-46

Page #41
Dr. Jacobi's Second Approach 21 kya dynasty." Now it is unanimously accepted that Kumarapala's accession took place in 1142 A.D.1 But according to Hemacandracarya, the interval between this event and the date of Mahavira's Nirvana is 1669 years. In this way, Hemacandracarya himself has also accepted 1669-1142-527 B.C., as the date of Mahavira's Nirvana. The Date of Buddha's Nirvana Dr. Jacobi regards 484 B.C., as the date of Buddha's Nirvana, for according to him", "The southern Buddhists hold that Candragupta's accession took place 162 years after the death of Buddha. And the uncontroversial date of Candragupta's enthronement is 322 B.C. Hence (322+162)=484 B.C. is the date of Buddha's Nirvana." The fact regarding Candragupta's accession gleaned by Dr. Jacobi referring to the tradition of Southern Buddhists is taken from the Ceylonese chronicle-Mahavamsa3. But 1. An Advanced History of India by R.C. Majumdar, H.C. Raychaudhuri, and K.K. Datta, p. 202. 2. Saramana, vol. XIII No. VI. p. 10. 3. Ajatasattuputto tam, ghatetvadayabhaddako! Rajjam solasavassani, karesi mittadubbhiko !! !!! Udayabhaddaputto tam, ghatetva anuruddako! Anuruddhassa putto tam, ghateva mundanamako !! 2 !! Mittadduno dummatino, te pi rajjam akarayum! Tesam ubhinnam rajjesu, atthavassanatikkamum !! 3 !! Mundassa putto pitaram, ghatetava nagadasako! Catuvisati vassani, rajjam karesi papako !! 4!! Pitughatakavamsoyam, iti kuddhatha nagara ! Nagadasakarajanam, apnetva samagata !! 5 !! Susunagoti pannatam amaccam sadhu sammatam ! Rajje samabhisincisum, savvesim hitamanasa !! 6 !! So attharasa vassani raja rajjam akaryi; ! Kalasoko tassa putto atthavisati karyi: !! 7 !! Contd. on next page

Page #42
22 Mahavira and Buddha on one hand the Mahavarisa state that Candragupta's accession took place 162 years after Buddha's death, while on the other hand it shows 543 B.C. as the date of Buddha's Nirvana. Dr. Jacobi, too has hold it as the most popular date of Buddha's Nirvana accepted by the traditions. Now if Mahavamsa considering 543 B.C. as the date of Buddha's Nirvana, places Candragupta's enthronement 162 years after the death of Buddha, we get 381 B.C. as the date of Candragupta's accession. But it does not agree with the uncontroversial historical data of Candragupta's accession viz. 322 B.C. Hence, it is obvious that the date of Buddha's Nirvana fixed by Dr. Jacobi on the basis of the suspicious evidence of Mahavamsa' is not compatible. Inconsistencies The acceptances of the date of the Nirvana of Mahavira Atite dasame vasse, kalasokassa rajino ! Sambuddha parinivvana, evem vassasatam ahu !! 8 !! -Mahavamsa, Pariccheda, IV, 1-8 Kalasokass putta tu, ahesum dasa bhatuka ! Dyavisati te vassani, rajjam samanusasisum !! 14 !! Nava namdatatoasum, kameneva naradhipa ! Tepi dvavisa vassani, rajjam samanusasisum !! 15 !! Moriyanam khatiyanam vanase jatam siridharam ! Candaguttoti panatam, canakko brahmane tatto !! 16 !! Navamam dhananamdam tam, ghatetva candakodhava ! Sakale jambudipamsmim, rajie samabhi sinciso !! 17 !! -Mahavassa, Pariccheda, V, vv. 14--17. 1. Cf. Political History of Ancient India, by Dr. H.C. Raychaudhuri, p. 225; Bharata Ka Itihasa, by Prof. Shrinetra Pandey, Part I, (4th edition), p. 243. 2. Op. cit. p. 10. 3. It may be noted here that the chronology discribed in Mahavamsa the ceylonese chronicle has been found, in general, to be erroneous on historical tests ; see, for the detailed discussion of this, 'Inconsistencies in Ceylonese Chronology in chapter I of this book.

Page #43
23 Dr. Jacobi's Second Approach 23 and Buddha inferred by Dr. Jacobi also gives rise to many inconsistencies. In the Bhagavati Sutra, Gosalaka speaks of eight finalities in his last days and Mahasila-Kantaka war was also one of them. We deduce from it that Gosalaka died after the Mahasila-kantaka war had taken place. Again seven days before the death of Gosalaka, Mahavira had announced". "I shall remain alive yet 16 years from today without any hinderance like a supremely puissant elephant." In other words, even if we assume that MahasilaKaantka war broke out immediately after Konika's accession to the throne, there elapsed at least 17 years between Konika's accession and Mahavira's death. But this, by no means, goes beyond 15 years, according to the date fixed by Dr. Jacobi. Another inconsistency arising from Jacobi's findings becomes clear from the following event described in Jain literature : Once upon a time, the king Srenika asked Mahavira: 1. Tassavina vajjassa pacchanatthaaimaim attha carmaim pannavei, tamjaha-carime pane, charime geye, carime natte, carime anjalikamme, carime pokkhalassa sam-vattae mahamehe, carime seyanae gandhahatthi, carime Mahasila Kamtae Samgame, -Bhagvati Sutra, Sataka, XV. 2. Taenam samane bhagvam Mahavire Gosalam mamkhliputtam evam vayasi--no khalu aham, Gosala ! Tava tavena teenam anaitthe samane anto chanham masanam javakalam krissami ! Aham nam annaim solasavassaim jine suhatthi viharissami." Ibid, Saiaka. XV. 3. For, taking 484 B.C., as the date of Buddha's Nirvana, Konika's accession, which according to Dr. Jacobi took place 7 or 8 years before the Nirvana of Buddha, falls in 491-2 B.C., and the date of Mahavira's Nirvana is 477 B.C. Hence, the maximum possible interval is 15 years. 4. Punarvijnpayamasa Jinendram magdhadhipah ! Bhagvan kevaljnanam kasmin uvycchedamesyati !! Contd. on next page

Page #44
24 Mahavira and Buddha "Who will be the last Kevalin (omniscent)?" Mahavira, answering the king's question, said to him : "On the seventh day from today, this good named Vidyunmali, will be conceived in the womb of the wife of Rsabhadatta, a businessman in your city Rajagtha. That child will be named as Jambu-Kumara, and he will be the last Kevalin." Now, all the Jain traditions unanimously accept the fact that when Jambu-Kumara was 16 years old, he was initiated into monkhood by Sudharma Svamil the successor of Mahavira, in the same year in which Mahavira died.2 This means that Jambu-Kumara was conceived in the womb of his mother nearly 17 years before the Nirvana of Mahavira. At that time, king 'Srenika' was alive. But as we have seen, the reign of Konika began more than 16 years before the Niryana of Mahavira. Therefore, we infer that the end of 'srenika's' rule and the beginning of Konika's rule took place nearly 17 years before the Nirvana Nathapyakathayat pasya vidyunmali surohyasau ! Samaniko brahmendrasya caturdevi Samavstah !! Ahnomusmat saptamehni cyutva bhavi pure tava! Sresthi-rsabhadattas ya Jambu hutrontyakevali !! - Parisista Parva, cantos I, vy. 262-64. 1. Sudharma Svaminah padanapadainbhodhitarakan! Pancangasprsta-bhupithah sa pranmya vyajijnapat !! Samsarasagaratarim pravajyam parmesvara i Mama sasvajansyapi dehi dhehi krpam mayi !! Pancamah sriganadharo pyevamabhyarthitastada !! Tasmai saparivaraya dadau diksam yathavidhi !! Ibid, cantos III, vv. 287-89, The total age of Jambu Svami was 80 years, out of which 16 years were spent in the household life, the next 20 years as a monk in non-omniscent stage, and the last 44 years in the omniscent stage. Also, he attained the Nirvana 64 years after Mahavira's Nirvana. It means that he was initiated into monkhood in the same year in which Mahavira attained the Nirvana. 2.

Page #45
Dr. Jacobi's Second Approach 25 of Mahavira. But, the chronology proposed by Dr. Jacobi, allow a maximum interval of 15 years between these events. In this way the acceptance of these dates involves many objections. Conclusion The opinion that Mahavira attained the Nirvana in 527 B.C. has remained almost uncontroversial and unique. No date of Buddha's Nirvana has been taken to be so indubitable. A number of opinions about the date of Buddha's Nirvana were in vogue in ancient time and they continue to exist. even now. Nevertheless, in this essay, Dr. Jacobi has gone so far as to ascertain (484 B.C.), the date of Buddha's Nirvana as almost unique and has tried to reconcile the events of Mahavira's life with it through far-fetched interpretations. By doing so, Dr. Jacobi has stirred up a new polemic with regard to the contemporaneity of Mahavira. and Buddha. The view expressed by Dr. Jacobi has also been rendered obsolete for more than 33 years have elapsed. since what he wrote. In the mean time history has also renovated and modified to a very great extent. Hence it will not at all be reasonable to accept Dr. Jacobi's findings as final. Pandit Sukh Lal ji and Other Scholars Some thinkers of our age have accepted Dr. Jacobi's view regarding the chronology of Mahavira and Buddha. The famous Jain scholar Pandit Sukh Lal ji writes:3 "Prof. Jacobi has found out on the basis of a comparative study 1. See, Traditional Dates of Buddha's Nirvana, in chapter VII of this. book. 2. The essay of Dr. Jacobi was published originally in 1930. 3. Darsana Aura Cintana, Part II, pp. 47, 48.

Page #46
26 Mahavira and Buddha of the Jain and the Buddhist texts in the light of history that Mahavira attained the Nirvana decidedly certain years later than Buddha. Jacobi has made it clear by his deep research work that the war of the Licchavis and the Vajjis with Konika took place only after Buddha's Nirvana and during the life-time of Mahavira. For, the description of the war is found only in the Jain Scriptures, though the Licchavis and the Vajjis are mentioned in both the Jain and the Buddhist texts." The above quotation shows that Pt. Sukh Lal ji has accepted Dr. Jacobi's view as it is. He has not deliberated over the subject independently. Often we all do so, when a particular subject is not ours or when we do not get an occasion to go deep into it, we generally accept the view of some scholar of that subject regarding it. It is also quite natural that many scholars are required to solve many problems. There is, then, always a mutual exchange of views between the different scholars of different subjects. Pt. Sukh Lal ji has given importance to two thingsone is that while the Buddhist scriptures do not bear any description of the war of the Vajjis with Konika, the Jain Scriptures do. But, as we have already discussed, this is not at all important in deciding the present issue. The other thing is that the above war was precedent to the Nirvana of Buddha and antecedent to that of Mahavira. This view is based on the general belief that the Maha-Parinivvana Sutta contains only those events of Buddha's life that happened in his last days. The first event referred to by this Sutta, is the meeting of Vassakara, the chief minister of the king Ajatsatru (Konika) with Buddha. Their, Vassakara lays forth a plan of victory over the Vajjis before Buddha. This event, therefore, is believed to have been associated with the last days of Buddha.

Page #47
Dr. Jacobi's Second Approach 27 That most of the events described in the Maha-Parinivvana Sutta, are connected with the last days of Buddha's life is understandable, but that all the events contained in above Sutta are so, can not be accepted as a fact. It is to be noted that Sariputta's conversation with Buddha is also one of the subjects of the Maha-Parinivkana Sutta, whereas 1. The following is the translation of that chapter of the Maha parinivvana Sutta : "Now, when the Blessed one had stayed as long as was convenient at Ambalatthika, he addressed the venerable Ananda, and said : Come Ananda, let us go on to Nalanda." "So be it Lord !" said Ananda, in assent, to the Blessed one. Then the Blessed one proceeded, with a great company of the brethren of Nalanda, and there at Nalanda, the Blessed one stayed in the Pavarika mango grove. Now the venerable Sariputta came to the place where the Blessed one was, and having saluted him, took his seat respectfully at his side and said : "Lord ! Such faith have I in the Blessed one, that me thinks there never has been, nor will there be, nor is there now any other, whether Samana or Brahmana, who is greater and wiser than the Blessed one, that is to say, as regards the higher wisdom.' . Grand and bold are the words of thy mouth, Sariputta ! Verily, thou hast burst forth in a song of ecstasy ! Of course then thou hast known all the Blessed ones who in the long ages of the past have been Arahat Buddhas, comprehending their minds with yours, and aware what their conduct was, what their doctrine. what their wisdom, what their mode of life, and what salvation they attained to ?' 'Not so, O Lord ! But at last then, O Sariputta ! thou knowest me as the Arhat-Buddha now alive, and hast penetrated my mind (in the manner I have mentioned).' 'Not even that, O Lord !' "You see then, Sariputta ! that you know the hearts of the Arahat Buddhas of the past and of the future. Why, therefore, are your words so grand and bold? Why do you burst forth into such a song of ecstasy ? O Lord! I have not the Knowledge of the heart of the Arahat Buddhas that have been, and are to come, and now are. I only know the Contd. on next page

Page #48
28 Mahavira and Buddha it is unanimously believed that Sariputta, had died long before Buddha's Nirvana. The fact appears to be that Vassakara had called on Buddha, when, after Maha-Sila-Kantaka and the Ratha-Musala wars, Konika had besieged the city of Vaisali, and he and his minister had been further devising the various plans to devastate the walls of Vaisali. This belief is also substantiated by the fact that according to the Jain sources, Konika was advised to employ the insidious strategies to enable him to enter into the city of Vajsali and also according to the Buddhist Scriptures, Vassakara, the chief minister of Ajatasatru, after having talked with Buddha and having lineage of the faith just, Lord ! as a king might have a border city, strong in its foundations, strong in its ramparts and toranas, and with one gate alone; and the king might have a watchman there, clever, expert, and wise, to stop all strangers and admit only friends. And he, on going over the approaches all round the city, might not so observe all the joints and crevices in the ramparts of that city as to know where even a cat could get out. That might well be. Yet all living things of larger size that entered or left the city, would have to do so by that gate. Thus only is it, Lord, that I know the lineage of the faith. I know that the Arhat Buddhas of the past putting away all lust, ill will, sloth, pride, and doubt; knowing all those mental faults which make men weak; training their minds in the four kind of mental activity, throughly exercising themselves in the sevenfold higher wisdom, received the full fruition of Enlightenmtent. And I know that the Arahat Buddhas of the times to come will do the same). And I know that the Blessed one the Arahat Buddha of today, has (done so) now." Tr. by T. W. Rhy Davids, Buddhist Sutta the Sacred Books of the East Series, Vol. X, pp. 12-14. The renowned Buddhist Scholar Rahul Sankrityayana commenting on this chapter of Maha-Parinivvanna-Sutta writes that the name of Sariputta has been referred to here on account of the error committed by the Bhanakas (the persons who used to learn the Scriptures by heart) Buddha Carya, p. 525). If we suppose so, can it not be probable that the whole event of Vassakara is also compiled in the Maha-Parinivvana-Sutta only erroneously?

Page #49
29 Dr. Jacobi's Second Approach known about the invincibility of the Vajjis, decided to play the croocked trick of bribing the Vajjis, and thus creating a rupture in their unity. In the same way, both the traditions consider the honour paid by the Vajjis to the stupas and temples standing inside the walled city, to be the chief cause of their impregnability. In the Jain source, it has been said that as long as the stupa of Mallinatha remained standing, Konika would not be able to win Vaisali. According to the Buddhist text", Buddha says to Ananda "......so long as the Vajjis honour and esteem and revere and support the Vajjian shrines in town and country and allow not the proper offerings and rites, as formerly given and performed, to fall into destitude......may the Vajjins be expected not to decline, but to prosper." Then he addressed Vassakara, the Brahmana, and said, "So long as those conditions shall continue to exist among the Vajjins,... ...so long may we expect them not to decline but to prosper". There are many more such points which make it crystal clear that the opinion of Dr. Jacobi that Buddha's Nirvana was antecedent to the Vaisali war, is not correct. We find that like Pt. Sukh Lal ji the scholars such as Kasturmalji Banthia have accepted Dr. Jacobi's view firmly, but this has happened only on account of their partial consideration. Dr. Charpentier Another independent effort to solve the present enigma 1. Avasyaka Kathanka. 2. Maha Parinivvana Vol. XI, p. 3. Sutta, Tr. By T.W. Rhys Davids ; S.B.E.

Page #50
30 Mahavira and Buddha was made by Dr. Jarl Charpentier in 19141 (i.e. in between the first and the second approaches of Dr. Jacobi.) Dr. Charpentier's conclusion is that Mahavira attained the Nirvana after Buddha's Nirvana. According to him, the dates of the Nirvana of Buddha and Mahavira are 477 B.C. and 467 B.C. respectively. Dr. Charpentier's conclusion is mainly based on the following two assumptions : 1. Buddha died in 477 B.C. 2. Pava, the place of Mahavira's Nirvana, is different from Pava recorded in the Buddhist Pitakas. Now we find that these two fundamental notions have totally changed in the course of historical investigations. In past, at some time, 477 B.C. was considered by the historians to be the exact date of Buddha's decease. But in the modern history, the above date has no place at all. Secondly, Dr. Charpentier has tried to falsify the Buddhist account of the predecease of Mahavira on the basis that Mahavira died at Paya in South Bihar, whereas the Buddhist texts speak of Mahavira's Nirvana at Pava in North Bihar. But, as we have seen, almost all the modern scholars and historians are of the view that Pava situated in North Bihar, is the true place of Mahavira's Nirvana. Dr. Jacobi has quoted in his second approach, the above belief of Dr. Charpentier in support of his own view, but it is remarkable that Dr. Jacobi has not accepted the date of Mahavira's and Buddha's Nirvana, proposed by Dr. Charpentier. Actually it seems that the date of Buddha's Nirvana which was popularly accepted in the history at the time of Dr. Charpentier's writing was made by Charpentier the basis of his research work. Sixteen 1. Indian Antiquary, 'The date of Mahavira' Vol. XLIII, 1914, pp. 118 ff. 125 ff. 167 ff. 2. See, 'Mahavira's Nirvana in which Pava', in the Chapter III of this book.

Page #51
Dr. Jacobi's Second Approach years after this, when Dr. Jacobi made his second approach, the historical view regarding the date of Buddha's Nirvana had undergone a change, and hence, Dr. Jacobi accepted. the new date of Buddha's Nirvana. But we should not forget that Dr. Jacobi's second approach has become nearly thirty-two years old, and that during this long period new views about the chronology of Mahavira and Buddha, have come to light in the field of history. It is, therefore, necessary to reconsider the whole issue in the light of the new facts. 31

Page #52
CHAPTER IV Dr. K. P. JAYASWAL A renowned historian and editor of the Journal of Bihar and Orissa Research Society, Dr. K.P. Jayaswal has made a remarkable effort to solve this problem. Dr. Jayaswal's view on the present subject, in short, can be summarised thus : The allusions about Mahavira's death found in the Buddhist texts should not be neglected. According to the Samagama Sutta, Buddha had heard about Mahavira's death in his life-time and the popular belief is that Buddha died two years after this event. According to the Southern Buddhists, Buddha died in 544 B.C. Therefore, Mahavira should have attained the Nirvana in 546 B.C. Mahavira's Nirvana and Vikramaditya In order to reconcile this date (546 B.C.) of Mahavira's Nirvana Dr. Jayaswal has tried to give a new interpretation to the traditional belief that Vikramaditya flourished 470 years after Mahavira's Nirvana. Dr. Jayaswal's argument is? : "The view of the Jain-traditional chronology that the interval between Mahavira's Nirvana and the Vikram era is 470 years, is, in reality the one, which is given in the Pattavali of Sravasti Gaccha, and which states the above period to be the interval between Mahavira's Nirvana and the birth of Vikrma. Vikrma's enthronement is stated to have 1. Journal of Bihar and Orissa Research Society, XIII, pp. 240-246. 2. See, 'The Chronology of Mahaviru' in Chapter VII of this book. 3. Journal of Bihar and Orissa Research Society, XIII, p. 246.

Page #53
Dr. K.P. Jayaswal 33 taken place when he was 18 years old, and the event was marked by the beginning of the Vikrma era. Thus (470+18=) 488 years after Mahavira's Nirvana commenced the Vikrma era (58 B.C.). But the above 18 years were left out in the Jain Chronology. Thus, it was clearly a mistake to count a lapse of 470 years between Mahavira's Nirvana and the commencement of Vikrma era". In this way, according to Dr. Jayaswal : Mahavira attained the Nirvana in 488 +58=546 B.C. A Critique Dr. Jayaswal's view that the Buddhist allusions about Mahayira's predecease should not be neglected, is really justifiable. But his assuming an interval of two years between the deaths of Mahavira and Buddha on the basis of the popular belief about the Samgama Suttanta, and his computing the interval between Mahavira's Nirvana and the Vikrma era by adding 18 years to the traditional number 470, are not based at all on confirmed sources. The famous historians', commenting on the view, write: "The suggestion can hardly be said to rest on any reliable traditionMerutunga2 places the death of the last Jina or Tirthankara 470 years before the end of Saka rule and the victory and not birth of the traditional Vikrma." Also the belief that Buddha had heard about Mahavira's Nirvana in Samagama exactly two years before his own death, is a mere speculation. 1. Dr. R.C. Majumdar, Dr. H.C. Raychaudhari and Dr. K.K. Datta, An Advanced History of India, p. 85. Vikrmarajjarambha parao siri vira nivyui maniya ! Sunna muni veya jutto vikkama-kalau Jina-kala !! Vicara Sreni pp. 3, 4. 2.

Page #54
Mahavira and Buddha Dr. Raddha Kumud Mukherjee A prominent historian Dr. Raddha Kumud Mukherjee, M.A., Ph.D., D. Litt., has treated the problem in a similar way. He, in his famous work, Hindu Civilization, has clearly accepted the seniority and the predecease of Mahavira with respect to Buddha on the basis of the Buddhist Tripitakas. According to Dr. Mukherjee, these two facts are quite unequivocal. It is remarkable that he has approved his view of Mahavira's seniority to Buddha by citing several authoritative Buddhist works.? As far as the dates of Mahavira and Buddha are concerned, he has wholly accepted the view of Dr. Jayaswal, according to which Mahavira died in 546 B.C. and Buddha in 544 B.C. But it should be noted that by accepting these dates for the Nirvana of Mahavira and Buddha, Dr. Mukherjee has created self-contradiction in his view of Mahavira's siniority to Buddha. For the total age of Mahavira's was 72, and that of Buddha was 80, so that, if the above chronology is accepted, Buddha would become six years older than Mahavira. Thus, we can conclude that though Dr. Mukherjee has succeeded in proving Mahayira's siniority and predecease with respect to Buddha, he has failed to reconcile his chronology with these facts. Dr. Kamta Prasad Jain Dr. Kamta Prasad Jain, a Jain Digambara scholar and the editor of Ahimsa Vani, has also accepted the above date of Mahavira and Buddha. Though he is of the view that Mahavira predeceased Buddha, he clearly denies the belief 1. Hindu Sabhyata (Tr. by Dr. V.S. Aggrawal) pp. 210-224. 2. Ibid., pp. 216, 223, 224.

Page #55
Dr. K.P. Jayaswal that Mahavira was older than Buddha.1 In order to support his view, Dr. K.P. Jain has tried to falsify a Buddhist allusion that Buddha was younger than Mahavira, by interpreting it as an 'irony'2. But his effort is a good example of far-fetched and unnatural interpretation. Also he has taken no account of other explicit references3, found in the Buddhist texts, showing Buddha's juniority to Mahavira. Dharmananda Kausambi A well-known Buddhist scholar, Dharmananda Kausambi has discussed the contemporaneity of Mahavira and Buddha in some of his books. It is his belief that Buddha was definitely the yougest amongst the seven religious teachers of his time, and, that his order (Samgha) was the smallest of all. Sri Kausambi has, however, neglected the chronological aspect of the problem. His argument is": "Even if Buddha's birth-date is taken back or forth by a few years, it would not deteriorate his character. The importance should be given not to the date of his birth, but to the circumstances existing before his birth, and to how he found out a new path in them." 35 The main reason of his neglecting the chronology seems to be that it is too equivocal to be determined. Dr. Hoernle and Muni Jina Vijayji Dr. Hoernle has also discussed this problem in the 1. Bhagavana Mahavira Aura Mahatma Buddha, pp, 110-115. 2. Ibid, pp. 114, 115. 3. See, 'The Seniority of Mahavira' in Chapter VII of this book. 4. Bhagavana Buddha, pp. 33, 155. 5. Ibid., preface, p. XII.

Page #56
36 Mahavira and Buddha same way. According to him, Buddha died five years after Mahavira's Nirvana (484 B.C.). This makes Buddha three years senior to Mahavira. The main bases of Dr. Hoernle's view are almost the same as those which are already discussed in the present chapter in context of other scholars and hence need no further discussion. A well-known archaeologist Muni Jina Vijayji has accepted Mahavira to have predeceased Buddha on the basis of Dr. Jayaswal's view. 1. Hesting's Encyclopaedia of Religion and Ethics, p. 261. 2. Vira Nirvana Samvat Aura Jaina Kalaganana, preface, p. 1.

Page #57
CHAPTER V MUNI KALYANA VIJAYAJI An extensive effort has been made by a famous Jain historian, Muni Kalyana Vijayaji to solve the present problem. His work on the subject, titled, Vira Nirvana Samvat Aura Jaina Kalaganana is really a treasure book for the researchworkers. He has presented an independent solution to the problem of choronology of Mahavira and Buddha. His conclusion is that Buddha predeceased Mahavira by 14 years 5 months and 15 days. In other words, Buddha was 22 years older than Mahavira. The dates of the Nirvana. given by Muni Kalyana Vijayaji is as follows: Buddha's Nirvana .....542 B.C. (May) Mahavira's Nirvana .....528 B.C. (November) The date of Mahavira's Nirvana--527 B.C.?, which is accepted by Muni Kalyana Vijayaji, is based on a reliable tradition as well as direct evidences. Muniji has proved this date by citing various authorities and giving many reasons. Muni Kalyana Vijayaji has tried to prove that Buddha attained the Nirvana nearly fifteen years before Mahavira's Nirvana. He has argued that the story related in the Samagama Sutlanta, that Buddha had heard about the 1. The date of Mahavira's Nirvana, though precisely is November 528 B.C., is usually written as 527 B.C., the reason being thai there is only an interval of two months between January, 528 B.C. and November 528 BC. Muni Kalyana Vijayaji has also used the date (527 B.C.) frequently in his book.

Page #58
38 Mahavira and Buddha Mahavira's death, is not correct. According to Muniji, the event should have happened thus : When Mahavira was seriously injured by the Tejo-lesya of his Ajivaka rival, Gosalaka, there prevailed a rumour that Mahavira would die within six months, as foretold by Gosalaka. This rumour would have reached Buddha, and consequently the story about Mahavira's Nirvana would have become prevalent. Developing his line of argument, Muni Kalyana Vijayaji writes :2 "The belief of the Buddhist that Buddha died just one year after he had heard about Mahavira's deaths (precisely speaking, the rumour of the Mahavira's death) gives us a clue to find out the exact interval between the death of Mahavira and Buddha." Further, he states that according to the Bhagavati Sutra', Mahavira died 16 years after having been injured by the Tejo-lesya of Gosalaka. On this basis, he has fixed the date of Buddha's Nirvana. Muni Kalyana Vijayaji also claims that the date of Buddha's Nirvana inferred by him, is coincident with the Ceylonese date of Buddha's death. A Critique As far as the date of Mahavira's Nirvana is concerned, Muni Kalyana Vijayaji's view seems to be quite correct. But it appears that in deciding Buddha's date, he has nearly depended on guesswork. The allusions of the Buddhist scriptures, which relate the event of Mahavira's death, have been much distorted by him. Such far-fetched inter 1. See, Bhagwati Sutra, Sataka, p. 15. 2. Vira-Nirvana Samvat Aura Jaina Kalaganana, p. 15. 3. Sataka, p, 15. 4. Op. cit. p. 160.

Page #59
Muni Kalyana Vijayaji 39 pretations can never be regarded as historical facts. To call the date of Buddha's Nirvana decided by him (542 B.C.), to be coincident with the Ceylonese date of the Buddha's Nirvana (544 B.C.)1 is a good example of far-fetching technique used by him. There is a clear difference of two years, which can not be regarded negligible, as he has asked us to do so.2 One of the evidence, adduced by him to show Buddha's seniority to Mahavira, is3: "In the Buddhist texts, wherever the rival teachers of Buddha are enumerated, the name of Niggantha Nataputta (i.e. Mahavira) appears in the end of the lists. This has also happened, perhaps, because Mahavira was the youngest amongst the rivals of Buddha". The weakness of argument is obvious. Even Mahavira's name appears in the end of the list of Buddha's rivals, it does not at all mean that Mahavira was younger than Buddha. On the contrary, such references clearly indicate that all the six rivals (including Mahavira) of Buddha had already earned fame and influence long before Buddha appeared on the stage. As a matter of fact, it is also not true, that Mahavira's name appears in the end everywhere in such lists, as argued by Muni Kalyana Vijayjai. We find several such references in the Buddhist texts where Niggantha Nataputta is not the last". Mahavira Middle aged, Buddha-young In order to support his view, Muni Kalyana Vijayaji 1. See, The date of Buddha's Nirvana. in Chapter VII of this book. 2. Op. cit. p. 160. 3. Ibid, p. 3. 4. For example, in the Samyukta Nikaya, Dahar Sutta, 3-1-1, the name of Niggantha Nataputta appears in the third place; in the Digha Nikaya Samanyaphala Sutta, 1-2, it occurs in the fifth place (See the Hindi translation by Rahul Sankrityayana, p. 21).

Page #60
40 Mahavira and Buddha has tried to misinterpret the Sammannyaphala Sutta of the Digha Nikaya. Presenting his argument, he writes : "The minister of the king Ajatasatru tells? him 'O king! This Niggantha Nataputta is having an assembly (of Bhikkhus) and a crowd (of followers), and is the pontiff of the order, a well known teacher, a famous leader and considered excellent by the multitude. He is long-ordained and middleaged. This shows that Mahavira was middle-aged (i.e. fifty years old), while Buddha was old." Now, if we study the above chapter with its fullest context, we find that it clearly describes Mahavira as middle-aged, and Buddha as young. For, the minister, here, intends to narrate the merits of Mahavira, and the word 'middle-aged', when used to exhibit a merit, should imply seniority. Secondly, in the above chapter of the Digha Nikaya, all the other rival teachers of Buddha viz. Gosalaka, Sanjya Balatthiputta, etc. are also described as "long ordained" and, 'middle-aged', while in the context of Buddha, no such adjectives are 1. Op. cit. p. 4. 2. Avyam deva nigantho nataputto samghi ceva gani ca ganacariyo ca pato yasassi titthakaro sadhusmmato bahujanassa rattassu cirapavvajito addhagatavayo anupttati. -Digha Nikaya, Vol. 1, pp. 48, 49 (Quoted from ibid, p. 4). In the original Pali tex', here, two words--'addhagato' and 'Vayoanupatta' are used. We find a frequent use of these words in the Pali texts. See, for example, the Culla-vagga, Samgha Bhedaka Khandaka, Suita Nipata, Sabhiya Sutta ; Rhys Davids has translated these words as 'he' has accomplished a long journey ; and his term of life is nearly run.' (S B.E. Vol. XVII, p.......); V. Fousboll has translated them as 'advanced in years' and 'having reached old age' SB.E. Vol X. p. 26) Rahul Sankrityayana translates them as' adhvagata, and vauch anuprapta' (See, his Hindi Translation).

Page #61
Muni Kalyana Vijayaji used. This also proves that Buddha was younger than all. the six rivals of him. In connection with the above occasion the Sammannyaphala-Sutta of the Digha Nikaya further states that the king Ajatsatru, after having heard from his ministers about the merits of all the teachers went to Buddha for passing his. time in religious discussion. There he asked Buddha what the direct fruit of monkhood was, and also informed Buddha that he had asked the same question to the six religious teachers before. This was the first contact of Ajataatru with Buddha. Are not all these facts enough to show that Mahavira and other five religious teachers were: older than Buddha ? Testimony of the Later Works One of the testimonies advocated by Muni Kalyana Vijayaji to defend his view is? : "The Jain traditional record of Srenika and his queen Cellana shows that Srenika. was first a follower of Buddha and afterwards was converted to Jain faith. "But, as a matter of fact, this account is based only on later Jain stories and hence it has no historical importance. Moreover, Muni Kalyana Vijayaji has not men-- tioned in which authoritative work, the said account is. recorded. In a similar way, he has choosen five statements from the later Buddhist work to show the seniority of Buddha, and that too without mentioning the original references. Most of those beliefs seems to have no connection with the Buddhist Pitakas. Some of them even contradict the facts of the Buddhist Pitakas. 1. Op. cit. p. 2. 2. Op. cit. p. 2.

Page #62
42 Mahavira and Buddha Contradictions. The argument advanced by Muni Kalyana Vijayaji are not at all sufficient to prove the seniority of Buddha to Mahavira. In his effort to reconcile his view, he has contradicted some fundamental and well-established facts. For example, the Buddhist Tripitakas state Mahavira to have died earlier than Buddha. They also elucidate that Buddha himself had accepted his juniority to all the six religious teachers of his time. In addition to this, at several places Buddha's juniority is clearly indicated in them? Muni Kalyana Vijayaji has not been able to reconcile his view with all these facts. He has called everywhere such events as fabrication and falsifying. His trend regarding the Buddhist Tripitakas can not be called proper and justifying. It is to be noted that the historians-Eastern as well as Western, have recognised these scriptural evidences as fundamental facts in deciding the contemporaneity of Mahavira and Buddha. At some places Muni Kalyana Vijayyji has contradicted his own arguments. For example, in the beginning of his book, he has accepted the belief of the later Buddhist works that Buddha died in the 8th year of Ajatsatru's reign, as the basis of his view. Later on, he, on the basis of the fact that Gosala's enumeration of the eight finilaties (Caramas) at the time of his death, was made sixteen years before the Mahavira's Nirvana, concludes. "Mahavira lived for more than sixteen years after the accession of Ajatsatru while Buddha died in the eighth year of Ajatsatru's reign." 1. See for detailed discussion of all these references, 'Seniority of Mahavira' in Chapter VII of this book. 2. Op. cit. p. 7.

Page #63
Muni Kalyana Vijayaji 43 Now, as we have already seen, the belief that Buddha's Nirvana took place in the eighth year of the Ajatsatru's reign, is quite legendary and only based on later works. Even if we assume it to be correct for the sake of argument, it could not be reconciled with the fact that srenika had died seventeen years before Mahavira's Nirvana.2 For if we assume Buddha's Nirvana to have taken place in the eighth year of Ajatsatru's reign, the interval between Buddha's and Mahavira's Nirvana could not exceed nine years. But we have seen that Muni Kalyana Vijayaji himself states this interval to be 141 years. Thus, there is a self-contradiction in his views. If there are such inconsistencies, how the solution put forward by Muni Kalyana Vijayaji can be considered acceptable? In the field of history, one has always to think from a historian's point of view. Shri Vijayendra Suri Recently, a valuable effort was made by Shri Vijayendra Suri to simplify the problem of contemporaneity and chronology of Mahavira and Buddha. His novel treatise}, dealing with the life of Mahavira, is really a treasure of historical facts. Shri Vijayendra Suri has proved in this book by adducing a lot of authoritative references that the date of Mahavira's Nirvana is 527 B.C.4 Without making any critical remarks, he has accepted 544 B.C. as the date 1. See also the Editor's Notes for the contradiction between the belief and the Buddhist Scriptures. 2. See, for the establishment of this fact,-Contradictions' in chapter III of this book. 3. Tirthankar Mahavira (in two Volumes) published by Kasinatha Saraka Yasodharma Mandira, Bombay, 1963. 4. Tiriharker Mahavira, Vol. II, pp. 319-324.

Page #64
44 Mahavira and Buddha of Buddha's Nirvana. Thus, it can be said that Shri Vijayendra Suri has almost wholly supported the view of Muni Kalyana Vijayaji except the following modification. Regarding the allusion of Mahavira's death in the Buddhist texts, Shri Vijayendra Suri has accepted the view of Dr. A.L. Basham' that it was really the death of Gosalaka, and by mistake the Buddhist texts described it as Mahavira's death. This assumption of Shri Vijayendra Suri and Dr. Basham, is more speculative rather than logical. For, it is possible that for a while such misunderstanding could have prevailed, but how is it possible that it was retained by the Buddhists, in spite of the fact that Mahavira had lived for 16 years even after the death of Gosalka ? Again, as Shri Vijayendra Suri indicated}, the scholars believe that the Buddhist Pitakas were compiled two or three centuries after Buddha's Nirvana. Then, how could the above misunderstanding could have continued to exist for such a long time, even though both Mahavira and Buddha had lived contemporarily, preaching in the same limited area and both were the leaders of the same sramanic tradition ? There is also a self-contradiction in the view of Shri Vijayendra Suri. On one the hand he writes4 "Buddha, in fact, should have received the news of Gosala's death in the form of Mahavira's death." While on the other hand he states, both Buddha and Gosalaka had died sixteen years before Mahavira's Nirvana. But the Buddist texts indicate that Buddha had heard about Mahavira's death long before he (Buddha) died, then how is it possible that 1. Ajivikas, p. 75, 2. Tirtharkara Mahavira, Vol. II, p. 32. 3. Ibid. p. 326. 4. Ibid. p. 326. 5. Ibid. p. 326.

Page #65
Muni Kalyana Vijayaji 45 he would have really received the news of Gosala's death ? If one accepts the veracity of the Pitakas' evidence that the above event had really taken place, it is not reasonable to believe another testimony of the Pitakas that the event had happened years before Buddha's death ? Dr. Shanti Lal Shah A valuable work, titled 'Chronological Problems,' written by Dr. Shanti Lal Shah, has been published in 1934 from Bonn (Germany)'. The object of this book, in the words of the author himself, is? : Not alone to fix the death-years of Buddha or Mahavira or the coronation date of Candragupta and Asoka, nor to authenticate the Jain traditional account, but also to reconstruct the chronology of the whole history of Northern India from Ajatsatru to Kaniska is the aim of this book". The author has strived much to reconstruct the chronology of the kings from Ajatsatru to Kaniska to fulfil his object. He has also succeded in giving historical form to some beliefs, but his effort to authorticate the Jain traditional belief here and there, shows rather his opinionated tendencies. According to Dr. Shah, the dates of Mahavira's and Buddha's Nirvana, are 527 B.C. and 543 B.C. respectively. He has accepted these dates only by saying, "According to the traditional dates of the Nirvana of both Mahavira and Buddha, the former died 16 years after the later, (543527)." The traditional belief cannot be accepted as historical facts, unless they are substantiated by authentic evidences. But it seems that Dr. Shah has given no impor 1. Publisher's name is not printed on the book. 2. Chronological Problems, Preface, p. I. 3. Op. cit. p. 23

Page #66
46 Mahavira and Buddha tance to this necessity. He has tried to reconstruct the whole chronology from Ajatsatru to Kaniska, only on the basis of these two traditional beliefs, without having attested their authenticity. Also, he has accepted some beliefs of the later Buddhist works, without having considered their veracity. Consequently, many a unanimous historical facts have been contradicted in his new chronology. As for example, it is now almost undisputable that Candragupta's accession took place in 322 B.C. and also this date serves as a 'lighthouse in that dark period of Indian history. But, according to Dr. Shah's chronology the date of Candragupta's accession is 316 B.C. Regarding the date of Mahavira's Nirvana, it should be noted that 527 B.C. is traditionally as well as historically accepted date. But, the date of Buddha's Nirvana 543 B.C. is only based on the Ceylonese tradition and is found to be unauthentic in the historical investigations. Shri Shrichand Rampuria Shri Shrichand Rampuria, a well-known literateur, has collected a good deal of data on the present problem, in his article titled 'A Discussion on the age of Mahavira and Buddha. He has elucidated both the sides of the controversy and criticized the prevalent views on the issue, but he has not reached a definite conclusion. However he seems to be more inclined to the view that Mahavira was older than Buddha. He has successfully refuted the arguments 1. Op. cit. p. 68. 2. See, 'Date of Buddha's Nirvana in Traditions' in Chapter VII of this Book. 3. Jain Bharti (Weekly), year 12, No. 1, Jan. 1951 ; pp. 5--21.

Page #67
Muni Kalyana Vijayaji of Dr. Jacobi as well as Muni Kalyana Vijayaji, which they advocated to prove Buddha's seniority to Mahavira. Another remarkable point in the above article is that according to Shri Rampuria, there are only two allusions found in the Buddhist Pitakas, which make the seniority of Mahavira a little dubious. Citing the first allusion, he writes: "The Buddhist scriptures clearly show that Mahavira was alive when Ajatsatru acceeded to the throne of Magdha. 47 "Again, they also state that once Mahavira had asked Abhaya Kumara (The minister of Magdha) to see Buddha and to have a discussion with him. The subject of discussion was connected with the following event.3 "Then Devadatta, rising from his seat, having arranged his upper robe over one shoulder, having saluted the Lord with joined palms, spoke to the Lord; "Lord, the Lord is now old, worn, stricken in years, he has lived his span and is at the close of his life; Lord, let the Lord now be content to live devoted to abiding in ease here and now, let him hand over the order of monks to me. It is I who will lead the order of monks." "Enough, Devadatta, please do not lead the order of monks. And a second time......And a third time Devadatta spoke thus to the Lord: "Lord the Lord is now old, worn, stricken in years.........It is I who will lead the order of monks. "I, Devadatta, would not hand over the order of 1. Ibid. p. 15. 2. Majjhima Nikaya, Abhaya Kumara Suttanta. 3. Vinaya Pitaka, Cullavagga, VII, 3-41. Translated by Oldenberg, S.B.E., Vol, XVIII.

Page #68
48 Mahavira and Buddha monks even to Sariputta and Moggallana. How then could I to you, a wretched one to be vomited like spittle ? Then Devadatta, thinking: 'The Lord in an assembly which included a king disparaged me by (using) the term, 'one to be vomited like spittle,' while he extolled Sariputta and Moggallana, angry, displeased, having greeted the Lord, departed keeping his right side towards him. "And this was the first time that Devadatta felt malice towards the Lord." "Then Devadatta approached Prince Ajatsatru; having approached, he spoke thus to prince, Ajatsatru "Formerly prince, people were long-lived, now-a-days they are short-lived, and it is possible that you, while still a prince, might pass away. Well now, do you, prince, having slain your father, become king. I having slain the Lord, will become the Awakened One. And Prince Ajatsatru, thinking: Now, master Devadatta is of great psychic power, of great majesty; master Devadatta must know (what is right), having fastened a dagger against his thigh, at an early hour (although) afraid, anxious, fearful, alarmed, entered the (King's) private quarters forcibly. But the chief ministers in attendance in the private quarters saw him. Seeing hi n, they laid hold of him. These examining him, and having seen the dagger bound against his thigh, spoke thus to Prince Ajatsatru : What is it that you, prince, want to do? "I want to slay my father." "By whom are you being incited ?" "By master Devadatta". Then King Seniya Bimbisara of Magadha spoke thus to Prince Ajatsatru. "Why do you, prince, want to slay me?"

Page #69
Dr. K. P. Jayaswal "Sire, I have need of a kingdom." "If it be that you, prince, have need of a kingdom this kingdom is yours and handed over the kingdom to prince Ajatsatru. Then Devadatta approached prince Ajatasatru; having approached, he spoke thus to prince Ajatasatru: 49 "Your majesty, command your men so that they deprive the recluse Gotama of life." Then prince Ajatsatru commanded his men saying: "My good men, do whatever master Devadatta says." Then Devadatta enjoined the men, saying: "Go along, friend, the recluse Gotama is staying at a certain road," and he set two men on that road, saying: "Whatever man comes alone along this road, having deprived him of life, come back by this road." "Then that one man approached Devadatta; having approached, he spoke thus to Devadatta: Honoured sir, I am not able to deprive that Lord of life, that Lord of great psychic power, of great might." "All right, friend, do not you deprive the recluse Gotma of life. I myself will deprive the recluse Gotama of life." "Now at that time the Lord was pacing up and down in the shade of Mount Vulture Peak. Then Devadatta, having climbed Mount Vulture Peak, hurled down a great stone, thinking: With this I will deprive the recluse Gotama of life.' But two mountain peaks, having met, crushed that stone, and (only) a fragment of it, having fallen down, drew blood on the Lord's foot. Then the Lord, having looked upwards, spoke thus to Devadatta: "You have produced great demerit, foolish man, in that you, with your mind maliganant, your mind on murder, drew the Truth finder's blood." Then the Lord addressed the monks,

Page #70
Mahavira and Buddha saying 'This, monks, is the first deed whose fruit comes with no delay accumulated by Devadatta since he, with his mind malignant, his mind on murder, drew the Truthfinder's blood." 50 "Now at that time there was a fierce elephant in Rajagrha, a man-slayer, called Nalagiri. Then Devadatta, having entered Rajagrha, having gone to the elephant stable, spoke thus to the mahout: "We, my good fellows, are relations of the kings. We are competent to put in a high position one occupying a lowly position and to bring about an increases in food and wages. Well now, good fellows, when the recluse Gotama is coming along this carriage road, then, having let loose this elephant, Nalagiri, bring him down this carriage road." "Then the elephant Nalagiri, suffused by the Lord with loving-kindness of mind, having put down his trunk, approached the Lord; having approached, he stood in front of the Lord. "Then the elephant Nalagiri, having taken the dust of the Lord's feet with his trunk, having scattered it over his head, moved back bowing while he gazed upon the Lord. "People looked down upon, critised, spread it about, saving: How evil is this Devadatta, how inauspicious, in that he tried to murder the recluse Gotama who is of such great psychic power, of such great might, and Devadatta's gains and honours declined; the Lord's gains and honours increased. "Then Devadatta approached Kokalika, Katamorakatissaka, the son of the lady Khanda, and Samuddadatta; having approached, he spoke thus to Kokalika, Katamorakatissaka, the son of the lady Khanda, and Sammudda

Page #71
Dr. K. P. Jayaswal datta : "Come, we, your reverences, will make a schism in the recluse Gotama's Order a breaking of the concord." "Then Devadatta together with his friends approached the Lord; having approached, having greeted the Lord, he set down at a respectful distance, Devadatta spoke thus to the Lord : Lord the 'Lord in many a figure speaks in praise of desiring little......whoever should eat fish and flesh, sin would besmirch him." "'Enough, Devadatta', he said. "Whoever wishes, let him be a forest dweller;whoever wishes; let him stay in the neighbourhood of a village whoever wishes, let him be a beggar for alms; whoever wishes, let him accept an invitation; whoever wishes, let him be a reg-robe wearer; whoever wishes, let him accept a householder's robes. For eight months Devadatta, lodging at the root of a tree is permitted by me. Fish and flesh are pure in respect of three points : if they are not seen, heard or suspected (to have been killed on purpose for him)." Then Devadatta, thinking "The Lord does not permit these five items joyful, elated, rising from his seat with his friends, having greeted the Lord, departed keeping his right side towards him. Then Davadatta having entered Rajaglha with his friends, taught the people by means of the five items, saying: 'We, friends, having approached the recluse Gotama, asked for five items, saying: 'Lord, the Lord in many a figure speaks in praise of desiring little.'......' "Monks heard these people who.....spread it about. Those who were modest monks......spread it about, saying: "How can this Devadatta go forward with a schism in the Order, a breaking of the concord ?' Then these monks told this matter to the Lord. He said : 'is it true, as is

Page #72
52 Mahavira and Buddha said, that you, Devadatta, went forward with a schism in the Order, a breaking of the concord?' "It is true, Lord." "Enough, Devadatta, do not let there be a schism in the Order, for a schism in the Order is a serious matter, Devadatta. Whoever, Devadatta, splits an Order that is united, he sets up demerit that endures for an aeon; he is boiled in hell for an aeon. "Devadatta saw the venerable Ananda walking in Rajagrha for alms-food; seeing him, he approached the venerable Ananda; having approached, he spoke thus to the venerable Ananda: 'Now from this day forth will I, reverend Ananda, carry out observance both in contradistinction to the Lord and in contradistinction to the Order of monks and will (so) carry out (formal) acts of the Order." "As he was sitting down at a respectful distance, the venerable Ananda spoke thus to the Lord : "Just now, Lord, I, having dressed in the morning, taking my bowl and robe, entered Rajagrha for almsfood. Devadatta, Lord, saw me walking in Rajagrha for almsfood; seeing me, he came up; having came up, he spoke thus to me: 'Nowfrom this day forth will I..... (so) carry out (formal) acts of the Order. To-day, Lord, Devadatta will split the Order. Then the Lord having understood this matter, at that time uttered this utterance: "Easy is good for the good, good for the evil is hard, Evil for the evil is easy, evil for the noble ones is hard." Now at that time as many as five hundred monks, Vajjis of Vesali, were newly ordained and were not properly versed; and these thinking: This is the rule, this is discipline, this is the Teacher's instruction, took voting tickets.

Page #73
Dr. K. P. Jayaswal Then Devadatta, having split the Order, set out for Gaya Head taking as many as the five hundred monks. Then Sariputta and Moggallana approached the Lord; ****** "Can there not be for you, Sariputta and Moggallana compassion for these newly ordained monks? Go you along, Sariputta and Moggallana, before these monks fall into trouble and distress." 53 "Very well, Lord," and Sariputta and Moggallana having answered the Lord in assent, rising from their seats, having greeted the Lord, keeping their right sides towards him, approached Gaya Head. Then Sariputta and Moggallana, taking those five hundred monks approached the Bamboo Grove. "Then the Lord addressed the monks, saying:... Monks because he is possessed of these eight qualities, Sariputta is fit to go a message. "Monks, Devadatta, overcome and his mind controlled by eight wrong conditions, is doomed to the Downfall, to Niraya Hell, staying there for an aeon, incurable. Mahavira had asked Abhaya Kumara to question Buddha regarding the propriety of the harsh words spoken by Buddha to Devadatta. The question to be asked by Abhaya Kumara was framed thus: 'Can the Blessed One (Buddha) utter the words which are unpleasant to others?' If Buddha would have answered in negative, the cross-question was going to be: 'Then, why did the Blessed One utter harsh words to Devadatta ?' On the other hand, if Buddha would have replied to the above question in affirmative, the cross question would have been : 'Then, what is the difference between a layman and the Blessed One? "The above occasion points out that Mahavira should

Page #74
54 Mahavira and Buddha have lived at least for some years after the event of Buddha's utterence of harsh words to Devadatta. It should also be noted that Devadatta had made the schism in Buddha's order after Ajata satru's accession and that the news of Mahavira's death had reached Buddha during the life time of Sariputta. The Buddhist writers are unanimous about the fact that Sariputta had died during the life time of Buddha.1 "Now, all these fragments of truth, supplied by the Buddhist texts, when joined together, at once manifest that the event of Mahavira's Nirvana must have taken place in between the event of utterance of harsh words by Buddha and that of the death of Sariputta. Again, it is believed that Buddha died in the eighth year of Ajatasatru's reign. If this is true, Mahavira's death should have taken place not later than this period of Ajatasatru's reign, and not ealier than the commencement of his reign. "Let us see, what conclusion we reach if we assume that Mahavira attained the Nirvana in the first year of Ajatasatru's reign. This would mean that when Mahavira died at the age of 72, Buddha was 73 years old. Secondly, when Mahavira attained omniscence at the age of 42, Buddha was 43, and when Mahavira was initiated into the ascetic life at 30, Buddha was 31. Lastly, when Mahavira was born, Buddha was one year old." The conclusion drawn by Shri Rampuria in the above passage holds good only if the belief that Buddha died in the eighth year of Ajatasatru reign, is true. But Shri Rampuria has himself based his calculation on the dubious, statement "If this is true'. As already sh own before, the above belief 1. The Life of Buddha, by Edward J. Thomas, pp. 140, 141.

Page #75
Dr, K. P. Jayaswal of Buddha's Nirvana in the 8th year of Ajatasatru's reign is based on the erroneous chronology1 adopted in the Ceylonese Chronicle, Mahavamsa.2 Thus, the whole mention of the above conclusion that Mahavira was younger than Buddha, shatters down. The second allusion giving rise to ambiguity with respect to Mahavira's seniority to Buddha, is described by Shri Rampuria as follows: When Buddha was lying on the death-bed, the following event took place1: "Now at that time, a mendicant named Subhadda, who was not a believer, was dwelling at Kusinara. And the mendicant Subhadda heard the news: "This is very day, they say, in the third watch of the night, will take place the final passing away of the Samana Gotama." 55 Then thought the mendicant Subhadda....... Now a certain feeling of uncertainity has sprung up in my mind and this faith have I in the Samana Gotama, that he, me thinks, is able so to present the truth that I may get rid of this feeling of uncertainity.' "Then the mendicant Subhadda went to the Sala Grove of the Mallas, to the Upavattana of Kusinara, to the place where the venerable Ananda was.' "" "And when he had come there he said to the venerable Ananda :...... 1. For the detailed discussion of this, see, 'The Chronology' in chapter VII of this Book. 2. Ajatasatru Mathame Yasse Buddhe Parinivvaute. Mahavamsa. 3. Op. cit. p. 17. 4. Maha-Parinivvana Sutta, Digha Nikaya Tr. by T.W. Rhys Davids S.B.E. Vol XI, p.p. 103 To 106.

Page #76
56 Mahavira and Buddha "Now the Blessed one overheard this conversation of the venerable Ananda with the mendicant Subhadda. And the Blessed One called the venerable Ananda, and said 'It is enough, Ananda : Do not keep out, Subhadda, Subhadda, Ananda, may be allowed to see the Tathagata. Whatever Subhadda may ask of me, he will ask from a desire for knowledge, and not to annoy me. And whatever I may say in answer to this question, that he will quickly understand." "Then Subhadda, the mendicant, went into the place where the Blessed One was......And, when he was thus seated, Subhadda, the mendicant, said the Blessed One : 'The Sramanas and the Brahmans by saintliness of life, Gotama, who are heads of companies of disciples and students, teachers of students, well-known, renowned, founders of schools of doctrine, esteemed as good man by the multitude to wit, Purana Kassapa, Makkhali of the cattla-pen, Ajita of the garnient of hair, Kakkayana of the Pakhuda tree, Sanaya the son of the Belatth slave girl, Nigantha of the Natha clan-have they all according to their own assertion, horoughly understood things ? Or have they not ? or are there some of them who have understood, and some have not ?" "Enough Subhadda : Let this matter rest whether they, according to their own assertion have thoroughly understood things, or whether they have not, or whether some of them have understood and some have not! The truth, Ananda will I teach you. Listen well to that and give ear attentively, and I will speak.' " 'Even so, Lord !' said the mendicant Subhadda in assent, to the Blessed One. "The above event raises a question in our mind

Page #77
57 Dr. K. P. Jayaswal whether Mahavira was alive up to the last day of Buddha's life. But again we may ask whether the question of Subhadda was about the living Tirtharkaras or merely a discussion of the views of deceased Tirtharkaras ?" The above question shows that Shri Rampuria has vigilantly reflected upon the situation. It often happens. that such questions are put up only in the form a 'wont'. The above question of Subhadda definitely seems to be a. customary usage of speaking together the names of all the six Tirthankaras. This is also proved by the fact that the names of Makhali Gosalaka and Purana Kassapa also appear in the above list of Subhadda, whereas it is unanimously believed and definitely known that both of them had died long before Buddha's Nirvana.1 1. Mankhali Gosalaka died 16 years before Mahavira's Nirvana (see. Bhagvati Sutra, Sataka 15). In the chronology adopted by Dr. Jacobi, Dr. KP. Jayaswal, Muni Kalyana Vijayji, Dr. A.L. Basham, Gosalaka's death occurs before the Nirvana of Buddha as well as that of Mahavira. Purana Kassapa had also died during the life-time of Buddha ; see, Dhammapada Attha Katha, 4-2. (Also, Buddhacarya, by Pt. Rahul Sankrityayana, p. 86.)

Page #78
CHAPTER VI HISTORIANS' VIEW Much has been written on the present issue by the Western as well as the Eastern historians. A detailed discussion of all the different views would be too lengthy a task to be discussed in the present treatise. We quote, here a view, which can be regarded as a theme of the present-day historians' approach. In An Advanced History of India, written by the top-most historians of India, Dr. R. C. Majumdar, Dr. H. C. Raychawdhri, and Dr. K. K. Datta, the subject has been elucidated to a great extent. It is to be noted that this work consisting of more than 1100 pages, has been prescribed as a text-book of history for the post graduate studies in almost all the Universities of India. In the first part Ancient India of the above treatise, in the context of Nirvana the authors observe? : The event is said to have happened 215 years before the Mauryas, and 470 years before Vikrama. This is usually taken to refer to 528 B.C. But 468 B.C. is preferred by some modern scholars, who rely on a tradition recorded by the Jain monk Hemacandra that the interval between Mahavira's death and the accession of Candragupta Maurya was 155, and not 215 years. The latter date does not accord with the explicit statement found in some of the earlier Buddhist texts that Mahavira predeceased Buddha. The earlier date is also beset with difficulties. In the first place it is at variance with the testimony of Hemacandra, who places Mahavira's Nirvana only 155 years before Candragupta Maurya. Again some Jain texts place the Nirvana 470 years before the birth of Vikrama and

Page #79
Historians' View 59 not his accession and as this event, according to the Jains, does not coincide with the foundation of era of 58 B.C. attributed to Vikrama the date 528 B.C. for Mahavira's death can hardly be accepted as representing unanimous tradition. Certain Jain writers assume an interval of 18 years between the birth of Vikrama and the foundation of the era attributed to him and thereby seek to reconcile the Jain tradition about the date of Mahavira's Nirvana (58+18 +470=546 B.C.) with the Ceylonese date of the great dicease of Buddha (544 B.C.). But the suggestion can hardly be said to rest on any reliable tradition. Merutunga places the death of the last Jina or Tirthankara 470 years before the end of Saka rule and the victory, and not the birth of the traditional Vikrama. The date 528 B.C. for the Nirvana of the Jnatrika teacher can to a certain extent be reconciled with the Cantonese date of the death of Buddha 486 B.C. But then we shall have to assume that Mahavira died shortly after Buddha's enlightenment, forty-five years before the Parinivvana, when the latter could hardly have become a renowned religious teacher of long standing as the Buddhist (canonical) texts would lead us to belief. Certain Jaina Sutras seem to suggest that Mahavira died about sixteen years after the accession of Ajatasatru and the commencement of this war with his hostile neighbours. This would place the Nirvana of the Jain teacher eight years after Buddha's death, as according to the Ceylonese chronicles, Buddha died 8 years after the enthronment of Ajatasatru. The Nirvana of the Tirthankara would, according to this view, fall in 478 B.C., if we accept the Cantonese reckoning (486 B.C.) 1. Here, instead of 'forty-five years' it should be 'forty-two years'. It seems that it is printed through a mistake (for 528-486=42; by taking 45, Buddha could not achieve enlightenment at that time.

Page #80
60 Mahavira and Buddha as our basis, and in 538 B.C., if we prefer the Ceylonese epoch. The date 478 B. C. would almost coincide with that to which the testimony of Hemacandra leads us and place the accession of Candragupta Maurya in 323 B.C. which cannot be far from truth. But the result in respect of Mahavira himself is at variance with the clear evidence of the Buddhist canonical texts, which make the Buddha survive his Jnatrika rival. Tha Jain statement that their Tirtharkara dies some sixteen years after the accession of Konika (Ajatasatru) can be reconciled with the Buddhist tradition about the death of the same teacher before the eighth year of Ajatasatru, if we assume that the Jain, who refer to Konika as the ruler of Campa, begun their reckoning from the accession of the prince to the Viceregal throne of Campa while the Buddhist make the accession of Ajatasatru to the royal throne of Rajaglha the basis of their calculation." Express their views on the date of Buddha's Nirvana; the learned historians observe.1 "The date of his great decease (Parinivvana) is a subject of keen controversy." If, the Ceylonese tradition, that 218 years intervened between the Parinivvana and the consecration of Priyadarsana (Asoka) has any value, the day cannot be far removed from 486 B.C., the starting point of the famous 'dotted record' at Canton". A Critique The most remarkable thing in the above view of the renowned historians is that they have given no place to the date of Buddha's Nirvana proposed by Dr. Jacobi, and Dr. Charpentier. As pointed out before, the main reason behind this is that during the long period that has passed 1. Ibid, p. 84.

Page #81
Historians' View 61 since the publication of the view of Dr. Jacobi and Dr. Charpentier, new conceptions have entered the field of history, concerning the pre-christian period. With regard to the date of Mahavira's Nirvana, these historians have given importance to two fundamental facts and have insisted on their complete inviolation, while unravelling the present problem. The first is that out of the three dates, which are in vogue, 528 B.C. is the most veracious one. The second fact concerns the allusion of the Buddhist Pitakas regarding the death of Mahavira. Dr. R.C. Majumdar and his colleagues have definitely accepted the veracity of the Pitakas' statement that Mahavira predeceased Buddha. They have also expressed a need of such a chronology that can be reconciled with the above facts. The only limitation of the above view of the famous historians is that though they have tried to make the lifeevents of Mahavira and Buddha consistent with each other, they have failed to present a completely consistent chronology. For, they have adopted 528 B.C. as the date of Mahavira's Nirvana and the Cantonese reckoning 486 B. C. as the date of Buddha's Nirvana thus creating an interval of 42 years between the Nirvanas of the two teachers. With such a long interval in between the deaths of Mahavira and Buddha, we cannot reconcile their life-events with each other. Thus we have to discover such a chronology which is compatible with the true life-events of Mahavira and Buddha

Page #82
CHAPTER VII RESEARCH AND CONCLUSION Need of an Exhaustive Research An unprejudiced survey of the efforts made up to now by the various scholars shows that the problem of contemporaneity of Mahavira and Buddha, was, first of all, tried to be unravelled on the basis of general historical facts, then available. At a later stage, some scholars carried research into it in the light of the Buddhist scriptures, while others reached for its solution with the help of the Jain scriptures. The result was that on the one hand, the research based on general historical facts was in itself incomplete without bearing the imprint of the scriptural evidences, while on the other hand, the one-sided approach solely based on either the Jain scriptures or the Buddhist scriptures coloured the whole issue with sectarian tint. Some scholars regarded each and every word of the Jain scripture as a principle evidence and attached little significance to the Buddhist scriptures, whereas other did the vice versa. This cannot be the method of historical research. To arrive at the perfect solution, we have to think over the issue giving proportionate value to the general historical facts, the evidences of the Buddhist Tripitakas as well as the testimonies of the Jain Agamas. We shall also have to pay heed to the fact that the Agamas and the Tripitakas are taken to be the original and genuine evidences of the Jain and the Buddhist traditions respectively, while the evidences of the other traditional works are valid only so far as they conform to the original canons.

Page #83
63 Research and Conclusion The Evidences of the Buddhist Tripitakas The testimonies of the Buddhist Tripitakas are the most. evident, obvious and direct ones out of the various evidences, which come across while considering the contemporaneity of Mahavira and Buddha. Hence, it necesstiates a thorough and systematic analysis of these evidences of the Buddhist Tripitakas. We consider them here one by one. The Event of Mahavira's Nirvana in Tripitakas The allusions of the Tripitakas in which the event of Mahavira's Nirvana is discussed, are as follows : 1. "The Exalted One (i.e. Buddha) was once dwelling among the Sakkas, at Samagama. Now at that time, Nigantha Nataputta (i.e., Mahavira) had just departed from life in Pava. After his death the Niganthas (i.e. the Jains) were divided into two groups. They making quarrels, making strife, falling into disputes were wounding each other with the weapons of the tongue, and were saying to each other...... 'You do not know this law of discipline': I know this law of discipline'; 'You cannot know this law of discipline you are having false beliefs, I am having true beliefs'; 'My statement is meaningful, your's is not'; You uttered the matter to be spoken first; last' ; 'Your doctrine is lacking thoughtfulness, and hence, it is wrong'; 'You started the quarrel; you are unfit to be argued with'; 'Off with you! Stray you to be free from quarrel; 'If you can, end it. Thus the Niganthas of the Nataputta were as if warring with each other. "The disciples of the Niganthas who were wearing white robes and were householders were as much dis 1. Majjhima Nikaya, Samagama Sutta, 3/1/4.

Page #84
64 Mahavira and Buddha interested in, disgusted with and indifferent to those Niganthas (monks) of the Nataputta (Mahavira) as they were with respect to the religion of Nataputta, which is not wellmeaning, not well-founded, unable to carry one to the Nirvana, unable to bring peace of mind, not expounded by an enlightened. One baseless, (supported on) broken pillars, and unfit to be stayed in. "At that time, Cunda Samanuddesa, after having passed his rainy-season at Pava, went to Samagama and approached the venerable Ananda. Having approached, having greeted the venerable Ananda he sat down on one side. So seated, he said to the venerable Ananda. 'Re. verend Sir, Nigantha Nataputta has just departed from lite in Pava. After his death, the Niganthas were divided into two groups. They are making quarrels......which is unfit to be stayed in. "Thereupon, the venerable Ananda said to Cunda Samanuddesa : "Reverend Cunda, this news is worthy to be presented to the blessed one. Come reverend Cunda, let us go to the Lord. Having gone there, let us, tell this matter to the Lord.' "Yes, reverend Sir!' "Then, the venerable Ananda and Cunda Samanuddesa approached the Exalted One, saluted and sat down at one side. So seated, the venerable Ananda said to the Exalted One: 'Lord! This Cunda Samanuddesa says so, 'Nagantha Nataputta has just departed...............unfit to be stayed in. Now, Lord ! it seems to me that after (the Nirvana of) the Blessed One, such a dispute may not occur in the order. If it occurs, it will be for the disadvantage of the many, for the unhappiness of the many, for the unwelfare of the many, for the disadvantage and unhappiness of gods and men.'

Page #85
Research and Conclusion 65 "Do you, then believe, Ananda, that even two monks have different opinions regarding the truths, such as........., preached by me, after having directly experienced them. "Lord! I do not see difference of opinions of even two monks regarding the truth, such as................ preached by the Lord. After having directly experienced them. But, Lord! when the body, which is sustained by the Lord, will exist after the Lord's Nirvana, there may occur a dispute in the Order, regarding the livelihood and the rules of discipline. That dispute will be for the disadvantage. of gods and men'". 2. "Thus have I heard : "The Exalted One was once staying among the Sakkas, in the palace of the Sakkas in the Mango Grove called Vedhanna. "At that time, Nigantha Nataputta had just departed from life in Pava. After his death, the Niganthas (i.e. the Jains) were divided into two groups. They making quarrels, making strifes, were wounding each other with the weapons of the tongue and were saying to each other : 'You do not know this law................ unfit to be stayed in.' "At that time Cunda Samanuddesa, after having passed...............unfit to be stayed in.' "Thereupon the venerable Ananda.........to the Lord! "Yes, reverend, sir ! "Then, the venerable Ananda..... unfit to be stayed in." "Then the Lord said to Cunda: "Cunda, the religion (i.e. doctrines) of the order in which the master is not perfectly enlightened one is not well-meaning....... 1. Digha Nikaya, Pasadika Sutta 3/6.

Page #86
66 Mahavira and Buddha "Therefore, Cunda, the religion which has been preached by me after having attained the enlightenment; should be understood well by all of you unitedly and undisputedly." 3. "Thus have I heard: "The Exalted One while making a tour among the Mallas together with the large order of monks, numbering five hundred, arrived at Pava, a town of Mallas. He was staying there at Pava in Mango Grove of Cunda, the son of the silversmith. "At that time, the new and lofty assembly-house (Saristhagara) of the Mallas the natives of Pava, was just built and no recluse (sramana) or Brahmana cr man had so far lived in it. The Mallas, the natives of Pava, heard- 'The Lord has arrived at Pava, while making tour among the Mallas, and the Lord is now staying in the Mango Grove of Cunda, the son of the silversmith. Then the Mallas, the natives of Pava, approached the Lord. They having approached and having greeted the Lord, sat down at one side. So seated, they said to the Lord, 'Lord ! A new and lofty assembly house...... ......So far lived in it, Lord! the Lord is requested to use it as a dwelling place for the first time. The Mallas, the natives of Pava will use it as a dwelling place after the Lord has used it as a dwelling place. This will be for the advantage and happiness of the Mallas, the natives of Pava, for a long time.' "The Lord accepted the invitation by keeping silence. "Then, the Lord, having dressed of taking his bowl and robe, together with the Order of monks, went to the assembly-house. Having gone......sat down. 1. Digha Nikaya, Sangiti Paryaya Sutta 3/10.

Page #87
67 Research and Conclusion "Then the Lord, having addressed the Mallas, the natives of Pava, by a talk on dhamma..... said. "Vasistas ! The night of yours is over. Now do what seems good to you.' "Well, Lord ! ......the Mallas after standing up from their seats and greeting, went away. "Then, in a little while after Mallas had gone away, the Lord, having seen the Order of monks completely soundless, addressed Sariputta............' Sariputta, the Order of monks is completly soundless. Sariputta, address the monks with a talk on dhamma ; my back aches and I will stretch it.' "The venerable Sariputta addressing the monks...... said: "Nigantha Nataputta, your reverences, has just departed from life in Pava. After his death the Niganthas (i.e. the Jains) were divided in two groups. They making quarrels ......to be stayed in. But your reverences the dhamma (Doctrines) of our Lord is well-meaning, wellfounded, able to carry to the Nirvana (final emancipation)" able to bring peace of mind, and expounded by the Enlighted One. Here, all should stay without controversy and dispute, so that this Order may endure for a long time, and this will be for the advantage and happiness of many....... "...... Then, the Lord, having awoke, addressed Sariputta ......Excellent Sariputta ! Excellent SEriputta ! Sariputta, you have given a good talk to the monks on the way of unity.' "The venerable Sariputta said this; the master (Buddha) agreed with him (on this point). The monks also, having satisfied with the speech of Sariputta, greeted it."

Page #88
68 Mahavira and Buddha A critical Examination The three allusions quoted above, though they differ slightly in their outer forms, contain essentially the same idea. In the first allusion, Buddha, after having received the news of Mahavira's Nirvana preaches Ananda ; and in the second one, he preaches Cunda. In both the allusions, the exhortations are worded differently, yet, they have the same intention. In the first and the second allusions, Buddha receives the report from Cunda in Samagama (a village among the Sakayas) and also admonishes Ananda and Cunda in Samagama. In the third allusion, Sariputta preaches the monks the way of unity in Pava by referring to Mahavira's Nirvana and the quarrels in his order after that event. Now, some scholars have not accepted the validity of these allusions, because in their view they contradict one another. But the reality is as follows: History may not accept each and every word of any scriptural evidence as true. If the fundamental point of any such allusion is unequivocal, history adopts it as a valid proof. As far as the above allusions are concerned, the actuality is that their essences are not at all contradictory. If in the first allusion, Ananda is admonished by Buddha and in the second one Cunda is given injuction, many an intelligible reason are possible for it. It is plausible that both of them might have heard the sermons simultaneously, but later on, the compilers of the first allusion by their own discernment, have deemed one of them more significant than the other and those of the second one by their own discernment might have deemed the vice versa. Another plausibility is that Buddha might have preached Ananda and Cunda one by one intermittently. The third allusion is already independent in itself and also confirms the first two allusions. For,

Page #89
Research and Conclusion the whole incident of Mahavira's Nirvana referred to above had happened in Pava, and hence, it is quite natural that on arriving at Pava, Sariputta must have referred to it. All the three allusions bear the description of the ideological split among the disciples of Mahavira after his Nirvana. Though the Jain tradition itself does not give any direct clue to such an event, the possibility of some mutual discussion over the issue of Mahavira's successorship, cannot be ruled out. For, Indrabhuti (Gautama Svami) was the first Ganadhara i.e. chief disciple in the charge of the sub-order (Gana) and hence, in normal state of affairs, he should have been ordained as Mahavira's successor, but, as the traditional history informs us, Sudharma Svami, the fifth Ganadhara was ordained as the successor of Mahavira and that too, under the rule that Kevalin (i.e. omniscent) can not succeed to the Tirthankara and Gautma Svami was a Kevalin while, Sudharma Svami was not Kevalin. Now it is plausible that this rule might have come into existence as a result of the above discussion. The possibility of a sort of dispute between the monks who were the disciples of Gautam Swami and the monks who were the disciples of Sudharma Svami, can also not be wholly ruled out. The fact that the Svetambar a tradition of the Jains regards Sudharma Svami as the first successor of Mahavira, while, the Digambara tradition of the Jains regards Gautama Svami as the first successor, also affords a slight hint towards the above possibility. Moreover the wordings...... 'The disciples of the Niganthas who were wearing white robes' used in the Buddhist allusions quoted above, also points out to the dispute between the white clothed' (i.e. Syetambaras) and 'the unclothed (i.e, Digam

Page #90
Mahavira and Buddha baras) Nirgranthas.1 It is also probable that the Buddhists might have presented it in an exaggerated form in the above three allusions. It generally happens that the persons belonging to one sect often express even a trifling event of the rival sect in an exaggerated form. Dharmannda Kausambi, the renowned Buddhist scholar has, accordingly, regarded the undermining delineation of Gosalaka in the Jain Agamas as an exaggeration.2 70 One of the arguments given by Dr. Jacobi against the authenticity of the above allusions is that the Mahaparinirvana Sutta, which affords us the account of the events of Buddha's last days, says nothing about this event. But this argument of Dr. Jacobi does not prove at all that the aforesaid allusions are inconsistent. At the most it only proves that the event described in the above allusions had not happened in the last days of Buddha's life. Muni Kalyana Vijayaji has regarded the whole event alluded in the Buddhist Pitakas to be a mere consequence of a misunderstanding of the Buddhist compilers. Muni Kalyana Vijayaji, in his interpretation of the above allusions of the Buddhist Tripitakas, has observed that the event of Mahavira's Nirvana, which is described in the Buddhist canons, is merely the result of the rumour prevalent at the time of Mahavira's serious illness due to the injury caused by the Tejolesya of Gosalaka. He has also traced the origin of the post-Nirvana dispute among the Nirgranthas (Jain 1. 1. The plausibility suggested is only conjectural. Yet it is possible on the basis of the hints given in the above allusions that the origin of the schism of the Jain order into Svetambara and Digambara Sects, may lie somewhere here. The researchers should pay attention to this. 2. See, Parsvanatha ka Caturyama Dharma. 3. Op. cit. p. 11.

Page #91
Research and Conclusion monks), referred to in the Buddhist allusions, to the schism in the Jain order caused by Jamali during the life time of Mahavira. He writes: "The Buddhist delineation of the dispute and quarrel among the Niganthas after the Nirvana of Mahavira, is, in fact, the grotesque form of the dispute. between Jamali and Indrabhuti narrated in the Jain canon Bhagvati Sutra." As already pointed out, such efforts of 'reconciliations' can, in no way, be regarded as historical. It is in fact, a misuse of the word 'reconciliation'. For, the whole event of Gosalaka's dispute with Mahavira had happened at "Sravasti', whereas the disputation between Jamali and Indrabhuti had taken place at Campa.3 Both the events have no concurrence of the place and time, nor, the subject of these events are related to each other. Hence, the argument of Muni Kalyana Vijayaji is not at all competent to prove the aforesaid three allusions as fallacious. 71 Again, it should be noted that all the three allusions explicitly mention Pava to be the place of the event of the Nirvana, and the event of post-Nirvana dispute. How is it reasonable to relate with them the events having taken place at 'Sravasti' and Campa? Moreover, how can it be plausible that a rumour about the death of a distinguished man of the age like Mahavira, might be conected and might continue to have its sway over the people for so long a time? In addition to this, the whole event was narrated again by Sariputta during his speech, and that too in Pava itself. If Mahavira had not really died by that time, Sari 1. Ibid. pp. 12-13. 2. Bhagvati Sutra Sataka XV. 3. Ibid. Sataka IX, uddesaka VI, sutra 386-87.

Page #92
72 Mahavira and Buddha putta must have been informed of the reality by the people of Pava. If there had been even a single reference in the Jain Agamas contradicting the fact stated in the above three allusions viz. Mahavira predeceased Buddha, it could have created a doubt over the credibility of these allusions. But, because we do not get any such contradictory description in the Jain Agamas, we should not doubt the veracity of these allusions. Secondly, had there been a fourth allusion in the Buddhist Tripitakas, stating something about Buddha's predeceasing Mahavira, it would have been necessary for us to ponder over the above three allusions seriously. But in absence of any such contradictions, it would not in the least be inequitable to accept these allusions, which are unequivocal in themselves, as the valid testimonies for the discovery of truth. The Events of Mahavira's Seniority in Buddhist Tripitakas Besides the above quoted three allusions, the Buddhist canons are replete with numerous allusions which show that Mahavira was older than Buddha. Most of the scholars, so far, have mainly discussed the aforesaid three allusions only. Only God knows why they have lost sight of other relevant allusions wherein it is explicitly stated and even Buddha himself accepts that he is the youngest of all the religious leaders of his time. We quote here three such allusions1: "Thus have I heard : The Exalted one was once staying near Savatthi, at the Jeta Grove, in Anathapindika's Park. Now the king, Kosalana Pasenadi, came into the presence of the Exalted 1. Samyutta Nikaya, Dahara Sutta 3/1/10 (Cf. The Book of the Kindred Sayings, Tr. by Mrs. Rhys Davids, vol. 1, pp. 93-96.)

Page #93
Research and Conclusion 73 One, and after exchanging greetings with him and compliments of friendship and courtesy, sat down at one side. So seated he said to the Exalted One : "Does master Gotama also make no claim to be perfectly and supremely enlightened ? "If there be anyone, sire, to whom such enlightenment might rightly be attributed, it is I. I verily, sire, am perfectly and supremely enlightened.' "But, master Gotama, there are recluses and brahmins who also like yourself) have each their order of disciples, their attendant followers, who are teachers of disciples, well-known and reputed theorizers, highly esteemed by the people-I mean Purana-Kassapa, Makkhali Gosala of the Cowstall, the Nigantha Nataputta Nata's son ie. Mahavira. Sanjaya Belatthi's son, Kaccayana of the Pakudhas, Ajita Kesa Kambli of the Hairblanket. Now they, when I have asked this same question of them, have not laid claim to perfect and supreme enlightenment. How can this be ? For (as compared with them) master Gotama is young in years, and is a novice in the life of religion.' "There are four young creatures, sire, who are not to be disregarded or despised, because they are youthful. What are the four ? A noble prince, a snake, a fire, an almsman (Bhikkhu). Yes, sire, these four young creatures are not to be disregarded or despised because they are youthful.' "Thus spake the Exalted One. And the Blessed One so saying the Master spake again on this wise : "A princely youth, by birth with fortune blest, Off spring of well-born families, let none Disdain for being youthful nor despise.

Page #94
174 Mahavira and Buddha The time may come when he, as lord of men, Comes to his heritage, and in his wrath May with a despot's weapons seek revenge With heavy hand. Hence from such attitude Let everyone who guards his life refrain. "Or if a man do walk within the woods And see a snake glide by, let him not say Disdainful : 'Tis a young one,' and despise. In divers shapes and with an ardent force Fareth the snake. Should he attacking strike, He bites the heedless, be it man or maid, No matter when. Hence from such attitude Let everyone who guards his life refrain. "A fire ablaze with appetite immense And swarthy trail let none despise as young Since it was lit, nor hold of no account. If it but win to fuel, growing great, It may attack the heedless, man or maid, And burn no matter when. From this therefore Let everyone who guards his life refrain. "The forest burnt by fire, the swarthy trailed, After the lapse of many nights and days, In shoots and seedlings springs once more to life. But he whom almsman, strong in righteousness, Burneth with ardent flame, may look in vain For child, or offspring 'among his stock. No wealth His heire may find ; childless and without heirs, Like to a palm-tree stump such men become. Hence with these four-the serpent and the fire, The prince of high estate, the saintly friarLet the wise man, his own goodwill in sight, Conduct himself as seemly is and right.

Page #95
Research and Conclusion 75 "When these things had been said, King Pasenadi, the Kosalan, spoke thus to the Exalted One : "Most excellent, Lord, most excellent ! Just as if a man were to set up that which has been thrown down, or were to reveal that which is hidden away, or were to point out the right road to him who has gone astray, or were to bring a lamp into the darkness so that those who have eyes could see external forms- just even so, Lord, has the truth been made known to me, in many a figure by the Exalted One. I, even I, Lord, betake myself to the Exalted One as my refuge, to the Norm and to the Order. May the Exalted One accept me as a follower, as one who from this day forth as long as life endures has taken his refuge therein." At one time Bhagavan i.e. Buddha was dwelling at Rajagsha in Venuvana, in Kalandakanivapa. At and that time some questions were recited to Sabhiya, the Paribbajaka (a wandering mender mendicant), by an old benevolent diety (who had in a former birth been a relation of his) : 'He who, O Sabhiya, be it a sramana or a Brahmana, explains these questions to thee when asked, near him you should live a religious life.' "Then Sabhiya the Paribbajaka having learnt the questions from the deity, went to whatever Sramanas and Bhramanas there were, who had an assembly (of Bhikhus), and a crowd (of followers), and were well-known teachers famous leaders and were considered excellent by the multitude, such as (1) Purana, Kassapa (2) Makkhali Gosala, (3) Ajita Kesakambali, (4) Pakuddha Kaccayana, (5) Sanjaya Belatthiputta, and (6) Nigantha Nataputta, (i.e. Mahavira). Those he want to and after going to them, asked these questions. They, being asked the questions by Sabhiya, the Paribbijaka, did not succeed (in answering

Page #96
76 Mahavira and Buddha them), and not succeeding they showed wrath and hatred and discontent, and they also in return put questions to Sabhiya the Paribbajaka. "Then this came to the mind of Sabhiya, the Paribbajaka : 'Whatever Sramanas and Brahamanas there are, that have an assembly (of Bhikkhus) and a crowd of followers), and are well-known teachers, famous leaders, considered excellent by the multitude, as Purana Kassapa, Makkhali Gosala, Ajita-Kesa Kambali, Pakuddha Kaccayana, Sanjaya-Ballatthiputta, and Nigantha-, Nataputta they being asked questions by me, did not succeed in answering them, and not suceeeding they showed wrath and hatred and discontent, and they also in return put questions to me in this matter, surely I think I shall go back to what I have left, and enjoy sensual pleasures.' "Then this came to the mind of Sabhiya, the Paribbajaka: "This Sramana Gautama, i.e. Buddha, too has an assembly (of Bhikkhus) and a crowd (of followers), and is a wellknown teacher, a famous leader, and is considered excellent by the multitude ; surely I think I shall go to him and ask him these questions'. Then this came to the mind of Sabhiya, the paribbajaka. Whatever Sramanas and Brahmanas there are, decayed, old aged, advanced in years havings reached old age, experinced elders, long ordained having assemblies (of Bhikkhus) crowds (of followers), being teachers well-known, famous leaders, considered excellent by the multitude, such as (1) Purana Kassapa, (2) Makkhali Gosala, (3) Ajita Kesakambali, (4) Pakuddha Kaccayana, (5) Sanjaya Belatihiputta : and (6) Nigantha Nataputta, i.e. Mahavira) and they, being asked questions by me, did not succeed (in answering them) and not succeeding they showed wrath and hatred and discontent and they also in return put questions to me in this matter. (I should like to know) whether

Page #97
Research and Conclusion 77 Sramana Gautama (i.e. Buddha), will be able to explain them to me, for Sramana Gautama is both young by birth and new in ascetic life.' Then this came to the mind of Sabhiya the Paribbajaka: 'Sramana Gautma is not to be slighted because he is young; even if the Sramana Gautama is young, yet is mighty and powerful: surely I think I shall go to Sramana Gautama and ask these questions."" 3. Thus have I heard : "Once the Exalted One was staying at Rajagrha in the Mango Grove of jivaka Komarbhacca, together with the large order of monks, numbering one thousand two hundred and fifty. Now at that time, when it was the night of the fullmoon day of the observance-day, the full-moon day being the Kaumudi of rainy-season (i.e. the full-moon day in the month of Asvina or Kartka2, Ajatasatru, the king of Magadha, the son of Vaidehi, surrounded by the ministers of the kingdom, was sitting on the terrace of the best palace. Then king Ajatasatru expressing praise of the observance day (i.e. the full-moon day), said 'Ah'! 1. Suita Nipata Sabhiya Sutta, III-6 (Cf. Tr. by. V. Fausboll S.B E., vol. X, part II, pp. 85-86). It may be remarked here that in the canoncial literature of the Buddhist, the Mahava of the Sutta Nipata is considered to be very old. V. Fausboll has observed: "The collection on discourses of (Sutta Nipata) which I have here translated is very remarkable, as there can be no doubt that it contains some remains of primitive Buddhism, consider the greater part of Mahavagga Sutta Nipata) and nearly the whole of, Atthaka vagga as very old, (Cf. op. cit. Introduction p. I). 2. Digha Nikaya, Samnnayaphala Sutta, 1/2. (Cf. Dialogues of the Buddha, Tr. by T.W. Rhys Davids, vol. I p. 51). 3. Kaumudi is full-moon day in Asvina or Kartika Cf. Sanskrit-English Dictionary of Prin Vaman Shivaram Apte Ed. by P.K. Gode and C.G. Karve part I, p. 611.

Page #98
Mahavira and Buddha How charming is the night illuminated by the light of the full-moon ! How beautiful is the night illuminated by the light of the full moon !! How handsome is the night illuminated by the light of the full-moon !!! How pleasant is the night illuminated by the light of the full-moon !!! How exquisite is the night illuminated by the light of the full-moon !!! (At such a pleasant time) to which Sramana (recluse) or Brahmin should we go to pass our time in the company of the good (man), so that his company may please our minds ?' "On his saying so one of the ministers of his kingdom said to Ajatasatru, the king of Magadha the son of Vaidehi : "Sire ! there is one Purana Kassapa, who has his order of disciples and his crowd of followers who is the teacher of disciples, well-known and reputed founder of a school of doctrine, esteemed as good man by the multitude, experienced, long-ordained, advanced in years and having reached old age. The king, sire, should have a religious discussion with Purana Kassapa. The religious discussion with Purana Kassapa even for a little time will delight your heart'. On his saying so, Ajatasatru, the king of Magadha the son of Vaidehi, kept silence. "Anotlier minister said this to Ajatasatru the... Vaidehi : 'Sire, there is one Makkhali Gosala (i.e, of the cattle pen) who has his order of disciples, ... ... reached old age. The king, sire, should have religious discussion with this Makkhali Gosala. The religious discussion with Makkhali Gosala even for....., kept silence.

Page #99
Research and Conclusion "Another minister said this......there is one Ajita Kesa Kambali who has......old age. The king with this Ajita Kesakambali.... The religious discussion with Ajita Kesakambali even for...... kept silence. "Another minister said this......there is one Pakuddha Kaccayana who has......old age. The king......with this Pakudda Kaccayana. The religious discussion with Pakuddha Kaccayana even for......kept silence. 79 "Another minister said this...... there is one Sannajaya Belatthiputta who has.........old age. The king......with this Sannajaya Belatthiputta. The religious discussion with Sannajaya Belatthiputta even for...... kept silence. "Another minister said this......there is one Nigantha Nataputta (i.e. Mahavira) who has......old age. The king ......with this Nigantha Nataputta. The religious discussion with Nigantha Natputta even for......kept silence. "At that time Jivaka Komarabhacca was sitting silently near Ajatasatru, the king of Magadha, the son of Vaidehi. Then Ajatasatru, the king......Vaidehi, said to Jivaka Komarabhacca. 'Why, good Jivaka you are keeping complete silence? "Sire, this Lord the Perfected One and the wholly Awakened. One (i.e. Buddha is staying in my Mango Grove together with a large order of monks numbering one thousand two hundred and fifty. The auspicious fame of such Lord Gautama has spread thus-he is the Lord the Perfected One, the wholly Awakened One, having knowledge and conduct, having reached the best life (Sugata), knower of the world, an unparalleled whip for restraining people (i.e. for bringing people on the virtuous path) the instructor (i.e. preacher) of the Gods and men, and the Enlighted One Sire; Your Majesty should go

Page #100
$80 Mahavira and Buddha to him and have religious discussion with him. By having a religious discussion with him, perhaps Your Majesty's heart will be delighted." A Critical Examination These three allusions are so explicit in themselves to prove the seniority of Mahavira to Buddha that it would be entirely needless to reconcile or explain them. In this way the three allusions (quoted before) prove that Mahavira predeceased Buddha and the other three allusions (quoted now) prove that Mahavira was senior to Buddha, and that too not only from the point of view of age but also from the point of view of knowledge, influence and period of Monkhood. These allusions themselves speak eloquently that when Buddha had just started his preaching work, Mahavira, by that time, had already done a good deal in that direction. The veracity of the above allusions is also proved by the fact that the Buddhist Tripitakas themselves accept the juniority of Buddha. If Buddha had been regarded senior from the point of view of age, period of Monkhood and influence by Buddhist Tripitakas, we would have questioned their credibility. On the ground that the compilers of the Buddhist scriptures might have done so in order to enhance the glory and fame of their religious preceptor, but acknowledging the juniority of one's religious preceptor cannot be regarded as a means of fostering the sentiment of sectarian egoism. The already stated fact. viz. Mahavira was a senior, contemporary of Buddha, is also substantiated by the fact that the Jain canons are as reticent about Buddha as the

Page #101
81 Research and Conclusion Buddhist canons are eloquent about Mahavira. possible reasons thereof are as follows. The A budding religious leader generally speaks much about his senior rivals. He has psychologically a feeling of equating himself with his senior rivals, and, hence, he endeavours to show himself superior and his rivals inferior. Consequently, he refers every now and then to the weak points of his rivals. This very process is reflected in the Buddhist canons which are replete with the allusions about Nigantha Nataputta (and also other five religious teachers) and the doctrines of the Niganthas (i.e. the Jains)'. On the contrary the Jain canons do not mention even the name of Buddha as the sponsor of Buddhism. This also signifies the same fact that those who have already earned the name and fame and become dignifying and dominating figures, shrink from giving an importance to the rival budding power all of a sudden. Another possible reason is that the teachings of Mahavira had already been complied in the form of 12 Arigas, comprising the most original portion of the Jain canonical literature, by the eleven Ganadharas soon after Mahavira's attainment of omniscence. Now because Buddha's advent was not even 'in the air' at that time, how could we expect to find allusions in those canons about the life of Buddha ? Also, on the other hand, if Buddha were really a senior contemporary of Mahavira, how the Jain canons could 1. See, for the detailed discussion of these allusions the author's article titled Pali Varnaya Mem Ehagavana Mahuviru in Bhik suSmrti Grantha, part II, pp. 6-10.

Page #102
Mahavira and Buddha have refrained from referring to the events of Buddha's life. Again because Buddha was a junior contemporary of Mahavira and the Buddhist canons were compiled after the Nirvana of Buddha by his perfected disciples, it is quite natural that the Tripitakas afford us with a lot of allusions, about Mahavira's life. Contemporaneity and Chronology On the basis of the facts discussed in the preceding sections, we indubitably reach the conclusion that Maha. vira predeceased Buddha and that Mahavira was a senior contemporary of Buddha. Now it remains to decide the period of their contemporaneity i.e. how long they lived in the presence of each other. But we can know this completely only after chronologizing the chief events of their life. Though the Agamas and the Tripitakas afford us the account of the days and the months of their birth and death, they do not mention the years of these events in terms of any prevalent era. This might have happened on account of the fact that no such systematized era, was in vogue at that time. Thus the only means at our hand to determine their correct dates is the use of other chronicles after having attested their veracity on the touchstone of history. First we shall consider the chronology of Mahavira, for it is rather more unequivocal and less controversial than that of Buddha. 1. Though in the Jain canons such as the Sutrakrtanga Sutra, etc., we find a mention of some beliefs of the Buddhists, it is quite negligible. Also. because the later patriarchs of Jainism possesing the knowledge of the Puryas (the most important portion of the Jain canons, but not available now) had made additions and altertations in the original Angas, the above stated fact is not violated.

Page #103
Research and Conclusion 83 Chronology of Mahavira : In the foregoing chapter it has already been elucidated that the most unequivocal date of Mahavira's Nirvana is 527 B.C. This date is substantiated by an extraordinary evidence: History accepts 322 B.C. as the date of the accession of Candragupta Maurya to the sovereignty of Magadha.? The historians call this date a 'light house' in that dark period of Indian history. They decide the chronology of hundred of years, posterior and prior to this period, on the basis of this unanimously accepted and definitely verified date. According to the chronology adopted by some ancient Jain traditional works, such as Titthogali Painnaya, Titthodhara Prakrana. Merutunga's Vicara-sreni, etc., the event of Mahayira's death had taken place 215 years before Candragupta's accession. It should also be remarked here that the above works speak of Candra 1. Many an authoritative historians and scholars have approved this date; see for example, (a) Mahama hopadhyaya Raya Bahadura Gouri Sankara Oyra, Jain-Satya Parakasa Vol. II, Nos. IV-V, pp. 217-81. )) Dr. Baladeva Upadhyaya, Dharma Aura Darsana, p. 89. (c) Dr. Vasudeva Sharan Agraval, 7'irtharikara Mahavira. Vol. II, preface, p. XIX. (d) Dr. Hira Lal Jain, Tattva Samuccaya, p. 6. (e) Mahamahopadhyaya Pt. Vishveshar Nath Rey, Bharata ke Pracina Rajavamsa, Part II, p. 436. 2. Candragupta Maurya and His Times, by Dr. Radha Kumud Mukherjee, pp. 44-46; Bharata ka Brhata Itihasa part 1, (Pracina Bharata), by Shrinetra Pandeya, 4th Edition, p. 242. 3. To these sources, Indian history is also indebted for what has been called 'the Sheet-anchor' of its choronology, for the startingpoint of Indian chronology is the date of Candragupta's accession to sovereignity. --Candragupta Maurya and His Times, by Dr. Radha Kumud Mukherjee, p. 3. Also, see, Ancient India, by Rapson, pp. 20-21.

Page #104
84 Mahavira and Buddha gupta's accession to the throne of Avanti, and not that of Magadha. It is also a historical fact that in 312 B.C. (ie. 10 years after Candragupta's accession to the throne of Magadha) Candragupta acquired the kingdom of Avanti. Thus, the Jain chronology and the historical chronology endorse each other and the date of Mahavira's Nirvana is confirmed in 312+215=527 B.C. The Vikrama Era The above date of Mahavira's Nirvana is also supported by the historical dates of Vikrama, Saka and Gupta eras. The ancient chronicles and works of Jain tradition state that Mahavira's Nirvana took place 470 years before the 1. The date 313 B.C. for Candragupta's accession, if it is based on correct tradition, may refer to his acquisition of Avanti in Malva, as the chronological datum found in a verse, where the Maurya king finds mention in the list of successors of Palaka, the king of Avanti. -Political History of Ancient India, by Dr. H.C. Raychaudhuri The Jain date 313 B C., if based on correct tradition, may refer to his acquisition of Avanti (Malva). -An Advanced History of India, by Dr. R.C. Majumdar, Dr. H.C. Raychaudhuri, K.K. Datta, p. 99. Although the date 313 B.C. for Candragupta's accession is based on correct tradition it refers to his victory over Malva or Avanti, because the verse, in which this chronology is adopted, mentions Candragupta in the list of the successors of king Palaka of Avanti. -Shrinetra Pandey, op. cit, pp. 245-246.

Page #105
Research and Conclusion commencement of the Vikrama era. According to the unanimous opinion of historians, the Vikrama era started 1. (a) Jam rayanim Kalagao, ariha tittharkaro mahaviro. Tam rayanim avamivai, ahistto palao raya !! 1 !! Satthi Palayaranno (60), Panavannasayam tu hoi nandanam (155) Asthasayam muriyanam (108), tisa cciya pusamittassa (30) !! 2!! Balamitta-bhanumitta satthi (60), vari-sani catta (4) nahavane! Taha gaddabhilla-rajjam terasa (13), varisa sa gassa cau (varisa) (4) !! 3 !! Sri Vikramadityasca pratibodhitastadrajyam tu sri virasaptati catustaye (470) sarnjatam !" -Tappagaccha Pattavali by Dharmasagara Upadhyaya (Ed. and Tr by Panyas Kalyan Vijayji), pp. 50-52. (b) Vikramarajjarambha parao siri vira nivvui bhaniya ! Sunna muniveya jutto vikkama kalau jinakalo !! Vikramakalajjinasya virasya kalo jinakalah sunyah (0), muni (7), veda (4) yuktah! Catvarimsatani saptatvadhikavarsani srimabaviravikramadityayorantaramityarthah ! Nanvayam kalah viravikramayoh katham ganyate, ityaha vikramarajyarambhat paratah pascat sriviranirvrttiratra bhanita ! Ko bhavah sriviranirvanadinadanu,470 varse vikramadityasya rajyarambhadinamiti ! -Vicara-sreni by Merutunga pp. 3-4. (c) Punarmannirvanat saptyadhikachatu satavarse (470) Ujj ayinyam srivikramadityo raja bhavisyati......svanamna ca samvatsarapravstim karisyati ! - Sri Saubhagyapancamyadiparvakathasamgraha, Dipamali ka Vyakhyana, pp. 56 57. (d) Mahamukkha gamanao palaya-nanda-candagutta iraisu bolinesu causaya satterahim vikkamaicco Taya hohi ! * Tattha satthi varisanam palagassa rajjam, panapannam nandanam, atthottara sayam moriyam vansanam, tisam pusamittassa, satthi, balamitta-bhanumittanam, calisam naravahanasya, terasa geddabhillassa, cattari sagassa! Tao vikkamai cco ! Vividha tirthakalap (Apapabrhat-kalpa), pp. 38-39.

Page #106
86 Mahavira and Buddha in 57 B.C.1 This clearly implies that Mahayira died in 57+470=527 B.C. The Saka era According to both the traditions of Jains-Svetambara and Digambara, the Saka era commenced 605 years and 5 months after Mahavira's Nirvana.? According to history, 1. An Advanced History of India, p. 118, Gupta Samrajya ka Itihasa, Vol. I, by Dr. Vasudeva Upadhyaya, pp. 182-183. 2. (a) Jam rayanim siddhigao, araha titthamkaro Mahaviro ! Tam rayanimavantie, abhisitto palao raya !! 620 !! Palaya ranno satthi, puna pannasayam viyani nadanam ! Muriyanam satthisayam, panatisa pusamittanam (ttassa) !!621!! Balamitta-bhanumitta, sattha cattaya honti nahasene ! Gaddabhasayanyegam puna, padivanno to sagoraya. !! 622 !! Panca ya masa panca ya, vasa chachceva honti vasasaya ! Parinivvuassarihato, toauppan (Padivanno) sago raya !! 623 !! ---Titthogali Painnaya, Vss. 620-623. (6) Shri viranirvrtervarsah sadbhih pancottaraih sataih ! Saka samvatsarasyaisa pravsttirbharate(a)bhavat !! - Merutunaga's Vicara-Sreni (Jain Sahitya-Samsodhana, Vol. II, Nos. III-IV, p. 4). (c) Chttham vasana saehim pancahim vasehim pancamasehim ! Mama nivvana gayassa u upajjissai sago raya !! --Nemi Candra's Mahavira Cariyam, leaf, 94-1. Vs. 2169, (d) Panachassayavassam panamasajudam gamiya vira-nivvuido! sagarajo to kakki Cadunavatiya-mahiya sagamasam !! 850 !! --Nemicandra Siddhanta-cakravarti's Trilokasara Vs. 65. (e) Varsanam satsatim tyaktya pancagram masapancakam ! Muktim gate Mahavire sakarajastato(a)bhavat !! -Jinasenacarya's Harivamsa Purana, Adhyaya IX Vs. 549. (f) "Nivvane virajine chavvasa sadesu pancvarisesu! Panamasesu gadesu samjado saganio ahava !! -Tiloyapannatti, part 1; 341. (8) "Parca ya masa pamca ya vasa chacceva honti vasasasaya ! Sayakalena ya saniya thaveyavvo tado rasi !! Dhavala, (Jain Siddhanta Bhavana, Ara), leaf 537.

Page #107
Research and Conclusion 87 the Saka era started in 78 A.D. Hence, the date of Maha vira's Nirvana comes out to be, 605-78=527 B.C. The Gupta Era Dr. Vasudeva Upadhyaya, M.A., Ph. D. discussing about the Gupta era, writes in his famous historical work on Gupta period, 2 "On the basis of the account given by some Jain writers of centuries prior to Alberuni, it is found that there is an interval of 241 years between the Saka and Gupta eras. One of these writers, Jinasena, who flourished in the 8th century A.D., states that 605 years and 5 months after Mahavira's Nirvana, the Saka king flourished and 231 years after the Saka, Gupta's reign began, during which was born the Kalakiraja. Another Jain auther Gunabhadra writes in his work Uttara puranal (889 A.D.), that 1000 years after Mahavira's Nirvana, the Kalakiraja was born. The statements of Jinasena and Gunabhadra are seconded by a third writer, Nemicandra. "Nemicandra writes in his work Trilokasaras, "Sakaraja was born 605 years and five months after Mahavira's Nirvana 1. An Advanced History of India, p. 120; Gupta Samrajya ka Itihasa, Part I, pp. 182-183. 2. Ibid, part 1, p. 382. 3. Guptanam ca satadvayam...... ! Ektrimsacca varsani kalavidbhirudahytam...... !! Dvicatvarimsadevatah Kalkirajasya rajata......! Tato (a) jitamjayo raja syadindrapura-saristhitah...... !! Varsani satsatia tyaktva pancagram masapancakam...... ! Muktim gate Mahavire sakaraja tato(a)bhavan. ..... !! -- Jinasena Harivamsa Purana, Adhyaya LX, VSS. 547-49. 4. Indian Antiquary, Vol. XV, 143, 5. Pana chasayi assam panamasa judam gamiya virani vuido Sagaraja to Kalkicadukakatiya mahiya Sasamasa. Trilokasara, p. 32.

Page #108
88 Mahavira and Buddha and Kalakiraja was born, 394 years 7 months, after the Saka era'. Thus, 605 years 5 months+394 years 7 months, = 1000 years. In this way on the basis of these three Jain writers, the time of Sakaraja as well as that of Kalakiraja are ascertained. "In this way, after ascertaining the times of Saka and Kalaki on the basis of some Jain works, Dr. Vasudeva Upadhyaya has proceeded further to find out the interval between the Saka era, and the Gupta era on the basis of Khoha inscription of king Hastina. In conclusion of the whole discussion, he writes! : "On the basis of the above discussion, it can be said that adding the number 241 to a date in Saka era, we get the corresponding date in Gupta era. Also, the statement of Alberuni is substantiated by this extensive discussion. It can be definitely concluded that the Gupta era began 241 years after Saka era (i.e. in 319 A.D.)." The above quotation shows how the date of Mahavira's Nirvana has become the base of the chronology upto the beginning of Gupta era. Dr. Upadhyaya, as shown above, has reached at the date of the Gupta era by starting from the date of Mahavira's Nirvana. Now, if we employ just the reverse process we reach back to the date of Mahavira's Nirvana as 527 B.C. For, The beginning of Gupta era-319 A.D. Interval between Mahavira's Nirvana and the beginning of era-846 years. :. Date of Mahavira's Nirvana-527 B.C. Astrological Calculations The learned Acaryas of Terapantha have also accepted 527 B.C. as the date of Mahavira's Nirvana. They have supported their belief by the astrological calculations. 1. Op. cit. 181.

Page #109
Research and Conclusion According to the Jain scriptures, at the time of Mahavira's death, an asterism of ashes (Bhasma-graha) entered into the sign of Zodiac under which Mahavira was born (the birthrasi) and it continued to stay for 2000 years.1 According to the fourth Acarya of Terapantha, Srimad Jayacarya, that asterism left the sign of Zodiac of Mahavira's birth in the year 1531 of Vikrama era". Again, the scriptures have predicted that a comet (Dhumaketu) of duration of 333 years, will set in, 1990 years after Mahavira's death3. According to Srimad Jayacharya, the comet left the sign of Zodiac of Mahavira's birth in the year 1853 of Vikrama era. On the basis of the above to astrological evidences, we reach 527 B.C. as the date of Mahavira's Nirvana as follows: Total duration of asterism of ash--2000 years. Date of its leaving the birth-rasi----1473 A.D. Date of Mahavira's Nirvana--527 B.C. Similarly, 1990+333 years after Mahavira's death, the comet left the birth-rasi, so that Total duration of comet--2323 years. Date of its leaving the birth-rasi--1796 A.D. Date of Mahavira's Nirvana---527 B.C. maggie d Traditional Era of Vira Nirvana. The era of Mahavira's Nirvana, which is in vogue at present in the Jain traditions, is also based on the date 527 B.C. It is remarkable that this era is unanimously and uncontrovertibly accepted by all the sects of Jains. At 1. Kalpa Sutra, vs. 129 (S.B.E. Vol. XXII). 2. Bhrama Vidhavamsanam, Preface. 3. 4. Bankaculia. Op. cit. 89

Page #110
90 Mahavira and Buddha present, in the year 1963 A. D., the era of Mahavira's Nirvana is 2490, which is 527 years ahead of Christian era, as it should be. Chronology of Mahavira's Life. After having decided the date of Mahavira's Nirvana, now we can easily chronologize the important events of Mahavira's life as follows: B.C. Event 599 Birth 569 Initiation into ascetic life. 557 Attainment of omniscence. 527 Final emancipation. Traditional dates of Nirvana It is not so easy to discover a unique date for Buddha's Nirvana as in the case of Mahavira. More than a millenium ago, there existed ambiguity about it and even today it persists to a great extent. Famous Chinese traveller Fa-Hien, who visited India in 400 A.D., remarks!. "Up to now, 1497 years have passed since the Nirvana of the Blessed One (Buddha)." Another well-known Chinese traveller HiuenTsang who toured in India in 630 A.D., wrote". "Lord Buddha lived for 80 years. There is a great controversy over the date of his Nirvana. Some believe that Buddha attained the Nirvana on the full-moon day of Vaisakha, while the Sarvastivadins take the full-moon day of the month Kartika as the day of Nirvana. Some people say that 1200 years have passed since the Nirvana, while others contend that 1500 years have passed, and some other believe that 900 1. Bharatiya Pracina Lipimata, by Rayabahadura Mahamahopadhyaya Gourishankar Hirachand Ojha. 2. Ibid.

Page #111
Research and Conclusion On and a few more years have passed since the Nirvana." the basis of these beliefs, the dates of Buddha's Nirvana come out to be 570 B.C., 870 B.C. and a few years earlier than 270 B.C. respectively. But all these dates have no more value than the legends. At present, there are several dates prevalent on the basis of different Buddhist traditions. One of these is based on the Ceylonese chronicle, Mahavamsa1. According to this, the Nirvana of Buddha took place in 544 B.C. (This is popularly known as 'Ceylonese date'). Another date is based on the "dotted record of canton.2" Sanghabhadra brought this news to China. The people of Canton established a "Dotted record", the starting dot of which synchoronised with the year of Buddha's Nirvana. Then, every year a dot was added to it. This tradition continued up to 489 A.D. When all the dots were counted, they were found to be 975, on this basis, the date of Buddha's Nirvana was calculated to be 486 B.C. 91 There is a third date, prevailing in Chinese Turkestan. This is also known as 'Khotan tradition." "It place, Dharma-Asoka 250 years after the Nirvana of Buddha, and makes him contemporary with Chinese emperor Shih HuangTi (Chin), the builder of the great wall, who came to throne. in 246 B.C., became universal emperor in 221 B.C. and reigned up to 210 B.C." On the basis of this tradition, some scholars affirm that Buddha died in 246+250-496 B.C.*. 1. Early History of India, by Vincent A. Smith, p. 49 2. Journal of Royal Asiatic Society, Great Britain, 1905, 51. 3. Sarat Chandra Das, Journal of Asiatic Society, Bengal, part, I, 1886, pp. 193-203, Tchang, Synchronismes Chinois; Early History of India by V.A. Smith, pp.49-50. 4. Buddhakaltina Bharata, by Janardana Bhatt, p. 371.

Page #112
$92 Historian's Date of Buddha's Nirvana It is really suprising that in spite of the extensive research work, that has been carried into the problem of Buddha's date, the historians failed to reach an unanimous decision regarding it. Most of the scholars have put forth a new opinion, and thus, they have elongated the list of these dates. The dates, suggested by the prominent scholars are enlisted here: Name of the scholars Mahavira and Buddha E. J. Thomas and a Japanese Scholar1 Rhys Davids Max Muller and Jarl Charpentier1 Gen...Cunnigham5 and Diwan Bahadur Swami Kanna Pilley Oldenberg' Ferguson (Date of Buddh's Nirvana in B.C.) 386 412 Dr. Buhler9 Dr. Wheeler, Geiger1o, Dr. Fleet11, In between 483 & 471 483 1. B.C. La Commemoration Volume, II, pp. 18-22. 2. Buddhism, pp. 212-13. 3. Introduction to Dhammapadda, S.B.E.. Vol. p. X, XII. 4. Indian Antiquary, Vol. XLIII, 1914, pp. 126-133. 477 478 480 481 5. Corpus Inscriptionum. Indicarum, Vol. I, Introduction, p. II. 6. An Indian Ephamenish, part 1, 1922, pp. 471 ff. 7. Introduction to Vinaya Pitaka, S.B.E., Vol. XIII p. 22 and The Religions of India by E.W. Hopkins, p.310. 8. Journal of Royal Asiatic Society. IV, p.81. 9. Indian Antiquary, VI, p. 149, ff. (Also, see, Buddhism in Translation, p. 2). 10. Mahavamsa, Geigar's Translation, XXVIII and Journal of Royal Asiatic Society, 1909, pp. 1-134. 11. Journal of Royal Asiatic Society, 1908, pp. 471 ff.

Page #113
Research and Conclusion Tukaram Krisna laddu', Pt. Rhaul Sankrityayana', Dr. Jacobi Dr. H.C. Ray Chandhrit, Dr. Smith's later view(r). 487 Prof. Kern 488 Dr. Smith's Earlier View?, Dharmananda Kausambie 543 Pt. Bhagawan Lal Inderji' 638 It can easily be inferred, from the above list that out of the twenty two opinions quoted, ninteen hold that Buddha's Nirvana took place later than 527 B.C. If 527 B.C. is accepted to be the correct date of Mahavira's Nirvana Buddha can be considered as a Junior contemporary of Mahavira in opinion of the above 19 scholars. Though in course of time, new changes have entered in the opinion regarding the date of Buddha's Nirvana, not a single view has been propounded so as to reconcile the events of Buddha's life connected with Mahavira, Gosalaka, Bimbisara (Srenika). Ajatasatru (Konika), etc. This suggests that there has remained some fundamental mistake in our way of approach to the problem. It is nothing but the adoption of the chronology of Ceylonese chronicles as the basis. 1. Quoted from Vira Nirvana Samvat Aura Jaina Kalaganana, p. 155. 2. Buddhacarya, preface, p.I. 3. Op.cit, p. 11. 4. Political History of Ancient India, p. 227. 5. Early History of India p.46. 6. Der Buddhisumus, Jar--Telling, II, p. 63. 7. Early History of India, 1924, pp-49-50. 8. Bhagvana Buddha, p. 89. 9. Indian Antiquary, XIII, 1884, pp-411ff.

Page #114
Mahavira and Buddha Problem of Chronology There are mainly three sources, which throw light on the ancient chronology of India : 1. Puranic, 2. Jain, 3. Buddhist The first of these, viz. the Puranic chronology is based on the Purana such as Visnu Purana, Matasya Purana, Vayu Purana, Ehagvat-Purana, etc. The second one i.e. the Jain chronology is found in the ancient works of Jain tradition such as, Titthogali Painnaya, Merutunga's Vicara Sreni, etc. The Buddist chronology is based on the Ceylonese chronicles Dipavamsa and Mahavamsa. The first of the above sources is the earliest of all. The Puranas cited above according to the historians, were compiled in the fourth century B.C. Titthogali Painnaya, the work of the Jain tradition describing the chronology of ancient India, is believed to be composed in the 3rd or the 4th century A.D. 1. The Purana certainly existed in any form in the fourth century B.C., for we find in Kautilaya's Arthasastra, a reference to the Purana.-- Janardana Bhatt, Bhaudha Kalina Bharata, p. 3. In the opinion of scholars, the administrative system, described in Kautilya's Arthasastra is, in reality, an elaborated discussion of Candragupta Maurya's administration. So, the date of Arthasastra is, in no case, later than 3rd century B.C. Hence, it can be said that the Puranas were composed much earlier than the 3rd century B.C. Shri Baladeva Upadhayaya, Arya Samsksti Ke Muladhara, p. 164. 2. Muni Kalyan Vijayaji, op. cit--, p. 30n.

Page #115
Research and Codclusion 95 The Ceylonese chroinicles, date back, according to the scholars' to the 4th or 5th century of our era. The Puranic and the Jain chronologies are wholly Indian, and endorse each other". It is worth noting that the authority of the Puranic chronology has been accepted by the historians. The Buddhist chronology is non-Indian, in as much as the Ceylonese chronicles were composed in Ceylon. Dr. Rhys Davids writes :4 "In the fourth century of our era, some one collected such of these pali verses, as referred to the history of Ceylon, piecing them together by other verses to make a consecutive. He called his poem, thus constructed, the Dipavainsa, the Island Chronicle..." "As generation afterwards Mahanama wrote his great work, the Mahavamsa. He was no historian, and has, besides the material used by his two predecessors, only popular legends to work on." This quotation of the renowned scholar clearly indicates of the unauthenticity of the Ceylonese chronicles. The greatest weakness of the Ceylonese chrono 1. Dr. Vincent A. Smith, Early History of India, p. 11. 2. Muni Kalyan Vijayaji has discussed this point at length in his Vira Nirvana Samyat Aura Jaina Kalaganana, pp. 15-29. 3. Modern European writers have inclined to disparage unduly the authority of the Puranic lists, but closer study finds in them, much genuine and valuable historical tradition. Dr. V. A. Smith, op. cit., p. 12. The modern scholars have now accepted the view that the Puranas give authentic account of ancient chronology. The facts described in them have been corporated by the edicts, the coins and the reminicences of the foreign travellers. The learned historians, therefore, state that these materials should be regarded as genuine and acceptable. Shri Baladeva Upadhyaya, op. cit, p. 167. 4. Buddhist India, pp. 277-78.

Page #116
96 Mahavira and Buddha logy is that it shows a great discrepancy with the Puranic and the Jain chronologies. Reconstruction of chronology We have already reached a definite conclusion about the following dates : Birth of Mahavira 599 B.C. Accession of Ajatasatru 544 B.C. Death of Gosalaka 543 B.C. Nirvana of Mahavira 527 B.C. Accession of Candragupta (at Magadha) 322 B.C. Accession of Candragupta (at Avanti) 313 B.C. Now, we should try to reconstruct the whole chronology from the king Sisunaga, the founder of the Sri Sunga dynasty to the end of Nandas rule. As we have seen, the Jain sources assign 60 years to the rule of Palaka dynasty and 155 years to that of Nanda dynasty over the kingdom of Avanti, after the death of Mahavira in 527 B.C. Thus in Avanti, the Palaka dynasty rule from 527 B.C. to 467 B.C., and the Nanda dynasty ruled from 467 B.C. to 312 B.C. Now regarding the chronology of Magadha, we find that after the Nirvana of Mahavira, the Sjsunaga dynasty 1. It is to be noted that the Buddhist tradition runs counter to the Brahmanical and Jain traditions. Candragupta Maurya and His Time by Dr. Radha Kumud Mukherjee, p. 20. Muni Kalyan Vijayaji (op. cit. pp. 25-29) and Dr. Tribhuvandas Laherchand Shah (Pracina Bharata Varsa) have on the basis of a comparative study of the Jain, Purinic and Buddhist traditions, computed the regnal period of the kings of Sisunaga and Nanda dynasties. We refer our readers to these sources for the detailed discussion of the topic.

Page #117
Research and Conclusion 97 continued to rule for 54 or 53 years,' after which the Nanda's rule began in Magadh. In terms of chronology, rule of the Sisunaga-dynasty ended and that of Nanda-dynasty began in Magadha in 474-3 B.C. Again, according to the Puranas, the ten kings of Sisunaga-dynasty reigned Magadha for 333years. 1. According to Dr. T.L. Shah (op. cit.), after the death of Mahavira, Ajatasatru reigned for 30 years, Udayi for 16 years and Aniruddha-Munda for 8 years, thus, assigning Mahavira's death in 527 B.C., the rule of Sisunaga dynasty at Mahavira's death in 473 B.C. Accordinng to Muni Kalyan Vijayaji (op. cit. p. 28), Ajatasatru and Udayi reigned for 37 and 33 years respectively. But Mahavira's death took place 17 years after the accession of Ajatasatru. Thus, 53 years after the death of Mahavira, ended the rule of Sisunaga dynasty, so that 474 B.C. is the starting point of Nanda's rule at Magadha. 2. Nanda's rule at Magadha started in 474-3 B. C. and at Avanti, it started in 467 B. C. It is a wellknown historical fact that at that time, there was a keen struggle between the kingdoms of Magadha and Avanti. It is quite probable that 6 or 7 years after having established his reign at Magadha, the first Nanda king would have conquered the kingdom of Ayanti. It is unanimously accepted by the historians that the Nandas had established 'Ek rat j.e. One umbrella kingdom in India (See, Political History of Ancient India by Dr. H.C. Raychaudhuri, p. 234, Age of Nandas and Mauryas by Nilkantha Shastri, pp. 11-20). 3. According to T.L. Shah (op. cit.) 'Sisunaga was the founder of the Si sunaga dynasty (cf. Vayu Purana, ad II C, VS 314). After the death of Asavasena, the king of Kasi and the father of 23rd Tirtharkara of Jain Lord Parsvanatha, Sisunaga established his kingdom in Kasi. Then Sisunaga himself went to Magadha and enthroned his son Kakavrana in Kasi' (cf. Matsya Purana, ad CCLXXI, V-5). 'Sisunaga was followed by Kakavarna KsemVardhana and Ksemajita. The fifth king of the Sisunaga dynasty was Prasenjita (The name of Prasenjita is omitted in the Puranas, (Contd. on next page)

Page #118
98 Mahavira and Buddha Hence, the beginning of sisunaga dynasty dates back to 807 B.C. Thus, the rule of the ten kings of Sisunaga-dynasty in Magadha lasted from 807 B.C. to 474 B.C. by accepting the regnal period given in the previous foot-note, the accession of Bimbisara falls in 582 B.C.2 As we have already seen 36 50 >> , but according to the Jain tradition the famous king Bimbisara was the son of Prasenjita. Also, the Buddhist work Divyavadana (p. 369) enlist Prasenjita in the successors of Sisunaga and Kakavarna, cf. Raychaudhuri, op. cit., p. 222.) 'It was Prasenjita, who transferred his capital from Kuthalnagar to Girivrija, Prasenjita was succeeded by Bimbisara, Ajtaasatru, Udayi Anuruddha and Munda.' (The Puranas enumerate Nandivaradhana and Mahananda as the successors of Udayi, while the Buddhist chronology enlist Anuruddha-- Munda. It will be shown below, Nandivaradhana and Mahanandi were Nanda kings, and not Sisunagas). "The regnal period of each of these ten kings is as follows: 1. Sisunaga 60 Years 2. Kakavarna 3. Ksemvaradhana 4. Ksenajita 5. Prasenjita 6. to 10. Bimbisara to Munda 108 Though the Puranas ascribe slightly different regnal-periods to these kings, the above regnal-period assigned by T.L. Shah seems to be more correct. 1. It may be remarked here that though the puranas state that the 10 kings of the Sisunaga-dynasty reigned for 362 years, the total of the regnal period assigned by them to these kings come out to be 333 years, (Cf. vayu purana, a ic, vss. 315-321, Pracina by Mahamabopadyaya Vishaveshar Nath Reu, Vol. II, p. 54). Sisunaga 807 B.C. 747 B.C. Kakavarna 747 B.C. 711 B.C. Ksemavardhana 711 B.C. 661 B.C. Ksemajita 661 B.C. 625 B.C. Prasenjita 625 B.C. 582 B.C. 36 43 >> )

Page #119
99 Research and Conclusion Ajatasatru's reign began 17 years before the death of Mahavira (527B. C.) and ended 30 years after it. Thus, Ajatasatru reigned from 544 B.C. to 497 B.C. Then, Udayi' reigned for 16 years i.e. from 497 B.C. to 481 B.C. The Sisunaga dynasty ended with the 8 years rule of Ajatasatru and Munda in 473 B.C. As stated before the Sisunaga dynasty was succeeded by the Nanda dynasty. The first Nanda, probably called as Nandivardhana, acceded to the throne of Magadha in 473 B.C. 1. The Puranus insert Darsaka in between Ajatasatru and Udayi. Also the famous Sanskrit play Syapanavasavadatta speaks of Darsaka as the King of Rajaglha. But it seems that Darsaka was really a king of viceregal throne at Rajagsha and not that of the regal throne of Magadha at Campa or Pataliputra. (cf. Muni Kalyan Vijayaji) (op. cit. pp. 22-23) some scholars have considered it probable that Darsaka might be one of the many sons or grand sons of the King Bimbisara (cf. Dr. Sita Nath Pradhan, Chronology of Ancient India, p. 217. "The order of succession in the Visnu Purana, which inserts Darsaka between Ajatasatru and Udayasva must be rejected. Also cf. ibid, p. 212- Darshaka may be one of Bimbisara's many sons who managed the state affairs during the life time of his father, Also, cf Raychaudhuri, op cit. p. 130; Geiger, Mahavamsa, parichhedo IV, VV 1-2). Hence, in the chronological list of the main Sisunaga-dynasty, we need not count Darsaka. According to the Buddhist chronology Aniruddha-Munda were succeeded by Magadasaka (Mahavassa parichhedo IV, vs. 4) and Sisunaga (ibid, parichhedo IV, vs). Nagadasaka and Susunaga are ascribed 24 and 18 years respectively as their regnal periods. (Ibid. 1.c. cit). On the other hand, the Puranas assign Darsaka and Nandivardhana a period of 24 and 42 or 40 years respectively, Vayu Purana, II c. vs. 320 Matsya Purana, ad. CCLXXI, Vs-10). Now, it seems that Darsaka of the Purana and Nagadasaka of the Ceylonese chronicles are one and the same person. (cf. E. J. Rapson, Cambridge History of India, p. 279; Dr. Radha Kumud Mukherjee, Hindu Sabhyata, p. 265). This Darsaka or Naga-dasaka, (Contd. on next page) 2

Page #120
Mahavira and Buddha This Nandivardhana conquered the kingdom of Avanti and established the Nanda's rule there in 467 B.C., thus ending the rule of the Palak dynasty or "Pradyotas."1 100 after having ruled for 24 years at Rajagrha (Viceregal throne), acceeded to the regal throne of Magadha at Pataliputra. Because he belonged to the Sisunaga dynasty, he can be called as "Sisunaga". He it seems then assigned a new name "Nandi Vardhana" and found as a new dynasty--the Nanda-dynasty after his new name. He must have reigned for 16 or 18 years, for the Buddhistchronology assign this period to Susunaga. Also, the Puranas have ascribed 40 or 42 years out of which 24 were spent at Rajagrha as "Darsaka" and the remaining 16 or 18 years must have spent as "Nandivardhana". It should also be remarked here, that Udayi and Aniruddha Munda reigned for 24 years at regal-throne of Magadha and at the same time, Darsaka reigned at Rajagrha for the same period. Thus the Puranas count 24 years of Darsaka twice which is an error, while the Buddhist-chronology counts it only once which is correct. 1. According to the Puranas (Vayu Purana, a Ic, vs. 309-314, Matsya Purana, ad CCLXXI, vvs, 1-4), Pulaka (or Sunaka) killed his master Ripunjaga, the last king of the Brhadratha-dynasty, and enthroned his son Pradyota. Thus, when the rule of Vitihotras and Brhadrathas ended in Avanti, the rule of the kings called Pradyotas commenced. The following five kings are called pradyotas: 1. Pravdyota (Mahasena or Candpradyota) 2. Palaka (Son of Pradyota) 3. Visakhyupa 4. Ajaka or Gopalaka 5. Avantivardhana (Or Vartivardhana). As we have already seen, according to the Jain tradition, Palaka acceeded to the throne of Avanti on the very day on which Mahavira died, and his dynasty reigned for 60 years. Now, the Puranas assign 20 years to Palaka's reign (cf. Pargiter, Dynasties of the Kali age, p. 19, note 26. In some Puranas, 24 years are assigned; but the scholars have relied on the above version. cf. Dr. Shanti Lal Shah, Chronological Problems, p. 26). The third Pradya (Contd. on next page)

Page #121
Research and Conclusion 101 After conquering Avanti, it seems that Nandivardhan attacked Kalinga and brought a Jain-statue to Magadha. On the basis of the Hathigumpha inscription of Kharavela, this event should have been taken place in 466 B.C. Thus, king Visakupa is assigned a period of 53 (or 85) years. But the scholars, on the basis of other literary works like Mrcchakatika, have proved that Ajaka or Gopalaka succeeded Palaka and therefore Visakpyupa should be omitted from the Palaka dynasty, (Cf. Dr. Shanti Lal Shah Chronological Problems, p. 27, "What about Yisakhyupa who occurs in the Puranas in between Palaka and Aryaka? According to the family-history of Pradyota which we have seen just now, there is no place for Visakhyupa in between Palaka and Ajaka as reported; "also cf. Majumda Shastri Journal of Bihar and Orissa Research Society; vol VII., p. 116. "Visakhayupa has been introduced between Palaka and Ajaka, but as that name does not occur, in all Mss, we ought to take no notice of him.", also, cf. Dr. Ramashanker Tripathi, Pracin Bharata ka Itihasa, p. 72. "The Puranas insert a third name-Visakhayupa in between Palaka and Ajaka, which is probably a mistake." Ajaka is assigned a regnal period of 21 years, after which his son Avantivardhana or Vartivardhana reigned for 20 years. Thus the three kings Palaka, Ajaka and Avantivardhana ruled for 61 years. Then, the rule of Pradyotas ended. Thus both the Jain and Puranic chronology agree that the Palaka-dynasty reigned for 60 or 61 years. (cf. Dr. Shanti Lal Shah, chronological problems, pp. 25-27). A Nanda king is twice mentioned in the Hathigumpha inscription of king Kharavela of Kalinga (orissa) (cf E. J.) Rapson, Cambridge History of India, Vol I, p. 280). The sixth line of the inscription is: "Pancame cedari vase nandaraja-ti vasa-sata ogahitam tarilsuliya-vatabandi (mn) nagararii pavesayati)......", (which means, "And now in the fifth year (of his reign), he (Kharavela) brings in to capital Tosala or Tamsuliya (or entered a particular town through or executed some public work associated with) the canal excavated by the king Nanda 300 years before". Though the word 'tivasa -- Sata" has been translated as "in 103rd years (of Nanda king) by some scholars, the conscientious scholars like Dr. K. P. Jayaswal, Dr. R. D. Banerjee, etc. have (Contd. on next page)

Page #122
102 Mahavira and Buddha after having established the rule of the Nanda-dynasty translated it as "300 years" (cf. Journal of Bihar and Orissa Research Society, Dec. 1917, pp. 425 ff) Dr. Shanti Lal Shah has made the following remark: "That ti-vasa-sata means" 300 years and not 103, is certain. See Dr. Banerjee's artical in J. B. O, R. S. Vol. III, p. 496 ff. 9 May add here that because the years are expressed in compound the word 'Sata' is used in the singular instead of the plural." (Op cit. p. 41 n.) Thus, the above Nanda king flourished 300 years bebore the fifth year of Khara vela's reign Dr. Jayaswal has also shown that this Nanda king was no other than Nandivardhana cf. op. cit. Vol. XIII op. 240). Again, the sixteenth line of the inscription shows that the thirteenth year of Kharavela's reign synchronized with 165th year of Maurya Era. The inscription reads: "Panamtariya sathivasasata Raja Muriyakala, rocainam ca coyatiaga sataka turiyam Upadayati", which means, "He (Kharavela) caused to be made (the things described in the foregoing lines) in the 165th year of the Raja Muriya Era (of which) 164th year has just terminated Vocinam)". Here. also, though some scholars translate the above line in a different way and deny the existence of any date in the above inscription, others have critically refuted their view (cf Dr. Shanti Lal Shah, op. cit., pp. 47, 48), The famous historian E. J Rapson has made the followingre mark : "Even the fundamental question whether the inscription is dated or not is still in dispute. Some scholars contend that a passage in the sixteenth line can only be interpreted to mean that the inscription was engraved in the 165th year of the Maurya kings, or of the Maurya king), while others deny the existence of any such date. The discussion of problems of this kind does not fall within the scope of the present work ; but it may be pointed out here that the acceptance of the supposed date would seem to involve no chronological impossibilities, and that, in any case, the inscription probably belongs to about the middle of the second century B. C. We know from analogous instances that the origin of imperial eras is usually to be traced to the regnal years of the founder of the empire. A Maurya era, therefore, would naturally date from the accession of (Contd. on next page)

Page #123
Research and Conclusion 103 Candragupta C. 321 B. C.; and, if such an era is actually used in the present instance, the inscription must be dated c. 156 B. C. and the beginning of Kharavela's reign c. 169 B C. With this hypothetical chronology other indications of date seem to agree. Epigraphical consideration shows that the Hathigumpha inscription of Kharavela and the Nanaghata inscription of Naganika, the queen of Satakarni, belong to the same period as the Nasika inscription of Krsna. (Buhler, Archaeological Survey of Western India, V, p. 71 ; Indishe Palaeographie, p. 39). Even, therefore, if it must be admitted that the Hathigumpha inscription is undated, there is still reason to believe that Kharavela may have been contemporary with Satakarni in the first half of the second century BC. Moreover, a Satakarni is actually mentioned in the Hathigumpha inscription is Kharavela's rival ; and it appears most probable that he is to be identified with the Satakarni of the Nanaghata inscription. (Op. cit. pp, 481, 482) Thus, by taking 322 B.C., the date of Candragupta's accession, as the year of beginning of Maurya Era, Kharavela's accession should fall in 170 B.C., and the fifth year of his reign in 166 B. C. Consequently, Nanda-raja's (i. e. Nandivardhana's) attack on Kalinga must have taken place in 466 B.C. This Nanda-king is again mentioned in the 12th line of the inscription, which means, "In the twelfth year of his reign, Kharavela produced consternation among the king of Uttarapatha, created fear in the people of Magadha, made his elephants to enter into 'Sugana geya,' humbled Brihaspatimitra, the king of Magadha and brought back to Kalinga the Jain statue which had been carried away by the Nanda-king, and also gained some Jewels from Anga and Magadha as an evidence of victory" (Cf. Journal of Bihar and Orissa Research Society, Vol. IV, p. 401, Vol. XIII, p. 732). This line also confirms the date of Kharavela, decided above. For, 'Brihaspatimitra' mentioned in the inscription is identified with Pusy mitra, the Sunaga-king, who flourished in 185-150 B.C. according to the Puranic chronology, and the 12th year of Kharavela's reign falls in 159 B C. which synchronises with the reign of Pusyamitra. (Cf. Chiman Lal Jee Chand Shah, M. A. Jainism in North India, (Gujarati Translation), pp. 159-162 ; Dr. V. A. Smith, (Contd. on next page)

Page #124
104 Mahavira and Buddha within 16 or 18 years, Nandivardhana, the first Nanda king died in 456 B.C.1. It may be remarked here that this date (474-456 B. C.) of Nandivardhana, the first Nanda king, is also corroborated by the date of famous grammarian Panini, who is proved to be his contemporary and to have lived in 480-410 B. C.?. Journal of Royal Asiatic Society, 1918, p. 554 ; Dr. K. P. Jayaswal, op. cit. Vol. III, p. 447, Dr. Shanti Lal Shah, op. cit, pp. 53-55). Our view that this Nandaraja was no other than Nandivardhana, is supported by some famous historians. Dr. V. A. Smith observes, "The Nanda-Raja reffered to appears to be Nandivardhana, the ninth Sisunaga king of the Puranas. It seems to be necessary to treat him and his successor Mahanandin, No. 10 as Nandas distinct from the nine Nandas who come between No. 10 and Candragupta. In the third edition of Early History of India (1914) I placed the accession of Nandivardhana about 418 B. C. He must now go back to c. 470 B. C. or possibly to an earlier date." ( Journal of Royal Asiatic Society, 1918, p. 547). E. J. Rapson, the editor of Cambridge History of India (Vol. 1.), concludes: "If tivasa-sata in line 6 of the inscription can mean 'three centuries before (the fifth year of Kharavela's reign), we must suppose that in the middle of the fifth century B. C., Kalinga was under the rule of a Nanda king, and it is natural to associate him with the wellknown predecessors of the Mauryas." --op. cit. p. 484). This date is also approved by the fact that according to Alberuni, the Nanda era commenced 400 years before the Vikrama-era (56 B. C.) (Cf. Dr. K. P. Jayaswal, op. cit, vol. XIII, p. 240, also, cf. Ganga Prasad Maheta. Pracina Bharata. p. 103). It is quite probable that to mark the death of the founder of Nanda-dynasty, the Nanda-era was started in 456 B. C. The ancient Brahmanical as well as Buddhist traditions show Panini to be contemporary with a Nanda king. It is mentioned by Taranath, the famous Tibetan writer, that Panini was a friend of the Nanda-king, Mahanandin, the father of Mahapadma Nanda. 1. 2. (Contd. on next page)

Page #125
Research and Conclusion 105. Nandivardhana was succeeded by his son Mahanandina, whose regnal period according to the Puranas is 83 years?. Thus, in 413 B.C., Mahapadma Nanda acceeded to the throne of Magadha. He is said to have established "Ek rat" Kingdom in India?. He is assigned a regnal period of 88 years by the Puranas,and hence, his rule must have (History of Buddhism, p. 1608). The Buddhist work ManjusriMulakalpa records. Tasyarantro raja Nandanama bhaviysati ! Puspakhye nagre Sriman mahasa inyo mahabalaka. Bhavisyati tada kale brahamanastarkika bhuvi !! Tebhi parivarito raja vai ! asyapyanatamah sakhyah Paninirnama manavah !! Pasal III, pp. 611.12; Studies on Masijusri-Mulakal by Jayaswal p. 14. This means "There will be a Nanda-raja in Puspapura (Patli Putra) and a Brahman called Panini will be his intimate friend. In the court of the king, there will be many Brahmanas who will be logicians and the king will honour them by gifts." Besides these evidences, Somadeva's Kathasaritsagara and Ksemendra's Brhatkathamangiri bear testimony to the contemporaneity of Panini with the Nanda--raja the records of the Chinese traveller Hieun-Tsang also support this view. (Cf. Dr. Vasudeva Saran Aggrawal, Paninikalina Bharatavarsa, pp. 467-480). Dr. Vasudeva Saran Aggrawal has shown on the basis of literary, historical and traditional evidences that the correct date of Panini is about 480-410 B.C. Dr. Aggrawal has also endorsed the view of Jain chronology that the Nanda-dynasty ruled in C473-323 B. C. (op. cit, p. 473). Dr. Aggrawal has also accepted that in 465 B.C. Nandivardhana, the first Nanda king was reigning at Pataliputra op.cit. p. 474). Dr. Aggrawal has also cited an allusion from the grammar of Panini, which records that Nandivardhana was the first Nanda king and that Mahanandin his son was the second Nanda-king. (Loc. cit.) 1. Vayu Purana, adh, ICV 320 ; Matsya Purana adh CCLXXI, vs. II.. 2. Vayne Purana, adh, Ic, V. 327 3. lbid, loc. cit.

Page #126
106 Mahavira and Buddha ended in 325 B.C." The remaining Nandas are assigned totally 12 years as their regnal period, and hence, the Nanda dynasty should have ended in 313 B.C.2. Thus, we have reconstructed a complete chronology of the kings from the foundation of Sisunaga-dynasty to that of Maurya-dynasty. We give it here in a tabular form: Event Date (B.C.) Foundation of Sisunaga-dynasty. 807 Accession of Sisunaga Kakavarana 747 Ksemavardhana 711 Ksemajita 661 Prasenjita 625 Bimbisara 582 Ajatasatru Udayi (in Patliputra) 497 Darsaka or Nagadasaka in Rajaglha , Aniruddha-Munda 481 544 497 1. It is remarkable that Dr. Smith, who has established his chro nology on different basis, has also ascribed the period of 88 years from 413 B.C. to 325 B.C. to Mahapadma Nanda. Candragupta Maurya acceeded to the throne of Magadha in 322 B.C., but the Nandas continued to reign at Avanti, upto 313 B.C. As already discussed before, Candragupta Maurya acquired the kingdom of Avanti in 313 B.C., and this ended the rule of the Nanda-dynasty. Some historiaus have called the first two Nanda-Nandivardhana and Mahanandi as old Nandas and Mahapadama Nanda and his dynasty as Neo-Nanda (Nanira-Nanda) or new Nandas. (Cf. Dr. Shanti Lal Shah, Chronological Problems, pp. 34-37; also Cf.E. J. Rapson Cambridge History of India, pp. 279-280; Dr. K. P, Jayaswal, Journal of Bihar and Orissa Research Society, Sept, 1915, p. 21).

Page #127
107 Research and Conclusion Foundation of Nanda-dynasty 474 Accession of Nandivardhana (in Patliputra) (in Avanti) 467 , , Mahanandi 456 Mahapadama Nanda 413 , eight sons of Mahapadma 325 Foundation of Maurya-dynasty (in Magadha) 322 Accession of Candragupta Maurya (in Magadha) Candragupta, Maurya (In Avanti) 3131 519 503 00 1. Cf. the following chronologies supplied by the Mahavamsa, Dr. Smith and Dr. Shanti Lal Shah respectively : ((c)) Mahavamsa, Pariccheda IV, V. (Taking Buddha's Nirvana in 544 B.C., the eighth year of Ajatasatru's reign; the dates refer to the accession of the kings mentioned) Regnal Period B.C. Ajatasatru 551 Udayibhadda Aniruddha-Munda Nagadasaka 495 Sisunaga 471 Kalasoka Kalasoka's sons Nava Nandas 403 Candragupta 381 Dr. Smith : (Early History of India) Bimbi-ara Ajatsatru Darsaka 527 Udayi 503 Nandivardhana 480 Madanandin 456 Mahapadma Nanda 413 Song of Mahapadma Nanda 325 Candragupta 313 (Contd, on next page) 453 425 to 10 582 551 OWO

Page #128
108 Mahavira and Buddha Inconsistencies in Ceylonese Chronology Some inconsistencies in the chronology described by the Ceylonese chronicles are so obvious that it surprises us how they were accepted as the authoritative sources by the historians. For instance, the Puranic and the Jain chronologies assign 100 and 150 years respectively to the Nanda dynasty, whereas the Mahavamsa ascribes only 22 years to the whole dynasty, and more surprisingly, we find that no place is given to this important dynasty of India in the chronological list supplied by the Dipavamsa. Another inconsistency of the Ceylonese chronology is that whereas in the Puranas the king Sisunaga Kakavarna, etc. are enumerated as the predecessors of Ajatasatru, the Ceylonese 551 519 501 Dr. Shanti Lal Shah (Chronological Problems) Ajatasatru Darsaka Udayina The Old Nandas Nandivardhana Kakavarna add Mahanandina The New Nandas Nanda (Barber) Nanda II (Mahapadma) Candragupta 467 447 404 382 316 1. Refer to Muni Kalyan Vijayji, op. cit. p. 24, for a detailed discussion of the topic Prof. Lassen had observed long ago. "In den Berichten die Nandas herrschtin den Singhalesischen Schriften offenbareine Verwirrung." (Indian Antiquary, Vol. II, p. 61) "The account about the Nandas recorded by the Singhalese chronicles reveal a confusion". Dr. Smith (op. cit.) and Dr. Radha Kumud Mukherjee (Hindu Sabhyata, p. 267) have explicitly refuted this belief of Ceylonese chronicles.

Page #129
Research and Conclusion 109 works enlist them as the successors of Ajatasatru.1 This can be said to be an untolerable blunder from the historical point of view. Besides such inconsistencies, the chronological beliefs of the Mahavamsa such as "Buddha's death in the 8th 1. The greatest blunder committed by the historians in believing the Ceylonese chronology which states Sisunaga as the successor of Ajatagatru, is probably due to the misinterpretation of the following verse of the Puran. Astatrimsacchatam bhavya pradyotahpancate sutah ! Hatva tesam yasth rtsanamsisunako bhavisyati !! The meaning of this verse becomes clear in the light of the foregoing discussion. To make it more clear, we should know that in Puranas, the name of the king of the dynasties of Kali age are mentioned in the following order: (2) The king of Pandava-dynasty from Abhimanyu, who fought in the Mahabharata war, to Ksemaka, the fourth king to reign after Udayan, the contemporary of Buddha. This dynasty first reigned at Hastinapura and later on removed the seat of its rule to Kausambi, during the reign of Nicaksus, the successor of Adhisimakrisna. (ii) The king of Iksavaku-dynasty from Brhadvalo, who fought in the Mahabharata war, to Sumitra, the fourth king to reign after Prasenjita, the contemporary of Buddha. This dynasty reigned at Sravasti in Kosala. (iii) The king of Lunar dynasty of Pandava and successors of Brhadratha from Sahadeva, who fought in the Mahabharata war to Ripunjya, the predecessor of Canda Pradyota (Mahasena), the contemporary of Buddha. The successors of Bahadratha (i.e. Barhadrathas) are also called Magadhas probably because they belonged to the dynasty of Brhadratha, Jarasandha, etc. who were the rulers of Magadha, and also Somadhi, the son of Sahadeva established his reign at Girivraja in Magadha after the Mahabharata war. But, after giving the chronology of the twenty-two kings, the Puranas say: Purna varsasahasram vai tesam rajyam bhavisyati! (Contd. on next page)

Page #130
110 Mahavira and Buddha Brhadrathesvatitesu vitihotresvavantisu! Pulakas svaminari hatva svaputrmabhiseksyati !! (Vayu Purana, adh. Ic, VV, 309-310; Matsya Purana adh. CCLXX V. 30; ad. CCLXXI, V.1) These verses explicitly indicate that when the rule of the kings: Viihotras and Brhadrathas was over in Avanti, Ripunjaya the last king was killed by his minister Pulaka (or Punika or Sunaka) and his son Pradyota was enthroned. (We have already discussed Pralyota's rule in Avanti.) Thus, though the rule of the Barhadrathas was established in Magadha in the time of Somadhi, later on it must have been transferred to Avanti. (iv) The kings of Pradyota dynasty from Pradyota to Avanti vardhana. This dynasty reigned in Avanti. (v) The king of sisumaga-dynasty from Sisunaga to Mahanandi. This dynasty reigned in Magadha. Those dynasticlists clearly show that the dynasties mentioned are not in succeeding order but are more or less contemporary. Udayan of the first dynasty, Presenjita of the second dynasty, Pradyota of the fourth dynasty and Ajatasatru (and Bimbisara) of the fifth dynasty are undoubted by contemporary kings of Vatsa, Kosala, Avanti and Magadha respectively. (cf. Rapson, C.H.I.p. 277) Thus, it would be a mistake if we take the fifth as the successor of the fourth dynasty, although the fourth dynasty is explicitly mentioned to have succeeded the third dynasty. Also, because the Barhadrathas transferred their seat from Magadha to Avanti, tho Sisunagas are justified as the rulers of Magadha and the conteinporaries of the later Barhadrathas of Avanti. The only question which remains still to be answered is that during whose reign the Barhadrathas changed their seat from Magaddha to Avanti. It is possible that when Sisunaga became powerful in northern India and when he established his kingdom in Magadha (in c. 807 B.C.) the Barhabrathas king ruling at that time in Magadha would have escaped to Avanti and established his kingdom there. Then onwards, the Sisunagas ruled in (Contd. on next page)

Page #131
Research and Conclusion Magadha and the Barhadrat has in Avanti contemporarily. The Barhahrathas were succeeded by the Pradyot as, who, as already shown, were succeeded by Saisunaga Nandivardhana, the first Nanda king. The above interpretation of the Puranic verses is also compatible with the chronology described therein, According to the Puranas, the twenty two kings of the Farhadratha-dynasty ruled for 1000 years as follows. Name of the King (1) Somadhi (2) Srutasrva (3) Ayutayusa (4) Niramitra (5) Suksketra (6) Brhatkarma (7) Senajita (8) Srutanjaya (9) Mababahu (10) Suci (11) Ksema (12) Bhuvrata (13) Dharmanetra (14) Vivrti (15) Suvrata (16) Drdhasena (17) Mahinetra (18) Sucala (19) Sunetra (20) Satyajita (21) Visvajit (22) Ripunjaya Regnal period 58 Years 60 36 40 56 Total 23 50 40 28 64 28 64 35 58 38 48 33 32 40 * 83 35 50 99 33 d. 12 27 33 33 dw 22 21 ******* .. " 111 29 999 years Thus 1000 years for 22 kings are exactly computed. Also by taking airthmetical average of these regnal periods. we find that each king is alloted 45.45 years. This means "that the last six kings ruled for (Contd. on next page) 33

Page #132
112 Mahavira and Buddha year of Ajatsatru's reign", "Asoka's coronation (anointment) 45.45 X 6 =) 273 years, which is also the exact total of the last six rulers. Now, we know from other sources that Pradyota acceeded to the throne of Avanti (by ending the rule of Ripunjaya) in 549 B.C. (see "Tibetan Tradition' in chapter VIII of this book). This means that Ripunjaya's rule ended in 549 B.C. By calculating the dates of the last six kings and by comparing them with those of the first six kings of the Sisunaga dynasty, we find that their contemporaneity is surprisingly proved : Barhadatha king Date (B.C.) Saisunaga king | Date (B.C.) 599-549 Bimlisara 582-544 (1) Ripunjaya (2) Visvajita (3) Satyajita 634--599 Prasenjita 625--552 717-634 Ksemajita 661-625 (4) Sunetra 757-717 Ksomavardhana (5) Sucala 789_757 Kakavarna 711--661 747--711 807--747 (6) Mahinetra 823--789 sisunaga Ajatsatru the 7th king of the Sisunaga dynasty and Prodyota, the 7th king in the line of Avanti-rulers also become contemporary as follows: Ajatasatru : 544.497 ; Pradyota 549-527. Thus, the whole chronology becomes complete. It may be indicated here, that the date of Mahabbarat is also fixed to a great certainty in c. 1559 B.C. This is also confirmed by another chronological fact of the Puranas and the Mahabharata that the Nanda's rule commenced 1050 years after the Mababharat war, which is thus, dated in 474+1050=1524 B.C. (Cf. Vayu Purana adh. To v.v, 217-329 ; Matsya Purana, adh. CCLXX v.v. 30 adh. CCLXXI, v.v. 1-20 adh. CCLXXII. v. 35 Mahabharata XIV-66--70, also ef. Buddha Parva ka Bharatiya Itihasa, by Missra & Missra, pp. 30-171 Pargiter, The Dynasties of Kali age, pp. 20 ff. 65 ff. ; Dr. Sita Nath Pradhana, chronology of ancient India pp. 100-230. 1. Cf. Editor's Note, p.-XII.

Page #133
Research and Conclusion 113 218 years after Buddha's Nirvana" contradict not only Tripatakas and more genuine literary works, but also run counter to the fundamental historical facts. Dr. Vinsent Smith had long ago warned the historians against the over-estimation of the value of the Ceylonese (4) Cf, T.W. Rhy Davids, Introduction to the Mahaparinirvana Sutta S.B.E. vol. XI, p. XLV : "According to the Raja-parampara or line of kings, in the Ceylon chronicles, the date of great decease would be 543 B.C., which is arrived at by adding to the date 161 B.C. (from which the reliable portion of the history begins), two periods of 146 and 236 years. The first purports to give the time which elapsed between 161 B.C. and the great Buddhist church council held under Asoka, and in the eighteenth year of his reign at Patna ; and the second to give the interval between that council and the Buddha's death. "It would result from the first calculation that the date of Asoka's coronation would be 325 B.C. (146+161+18). But we know that this must contain a blunder or blunders, as the date of Asoka's coronation can be fixed, as above stated with absolute certainty within a year or two either way of 267 B.C. Would it then be sound criticism to accept the other, earlier period of 236 years found in those chronicles a period which we cannot test by Greek chronology-and, by simply adding the Ceylon calculation of 230 years to the European date for the 18th years of Asoka (i.e. circa 249 B.C.) to conclude that the Buddha died in or about 485 B.C. ? "I cannot think so. The further we go back, the greater does the probability of error become, not less. The most superficial examination of this earlier period shows that they are unreliable and what reliance would it be wise to place upon the total, apart from the details, when we find it mentioned for the first time in a work Dipavamsa, written eight centuries after the date it proposed to fix ? If further proof were needed, we have it in the fact that the Dipavamsa actually contains the details of another calculation-based on the lists of kings (Rajaparampara), but on a list of Theras (Theraparam para) stretching back from Asoka's time to the time of great Teacher-which contradicts this calculation of 236 years".

Page #134
114 Mahavira and Buddha chronicles." Dr. H.C. Raychaudhuri has also maintained that these Ceylonese legends cannot be made basis of the historical conceptions." Dr. Shanti Lal Shah has already found out the reason of the discrepancy which is found in the Ceylonese chronicles, and which he terms as a deliberated perversion. He writes :4 "The peculiarity of the Buddhist tradition (The Ceylonese tradition) is that it confines itself firstly to the history of the Hinayana Buddhism and secondly to the history of its development in Ceylon, since Buddhism although originating in India, had found its development in Ceylon. Because of this territorial limitation, which has been a great factor for the preservation of the history of Ceylon, the account of this tradition about Ceylon is much more prefect than that about India. One who is acquainted with the scheme and content of the Dipavamsa and Mahavamsa will hardly fail to notice that the account of the North Indian kings in these two books is only occasional and of minor importance. This conclusion is absolutely borne out by the typical construction of the Dipavamsa and Mahavanga.5" 1. Early History of India, p. 11 2. Political History of Ancient India, p. 6. 3. Chronological Problems, p. 41. 4, Op. cit., p. 19. 5. The content of Maharamsa are as follows: 1. The visit of the Tathagata. 2. The race of Mahasammata. 3. The first council. 4. The second council. 5. The third council. 6. The coming of Vijaya. 7. The consecration of Vijaya. 8. The consecration of Pandu Vasudeva. 9. The consecration of Abhaya, See Giger Tr, of Dr. Mahavamsasa, p. VIII.

Page #135
Research and Conclusion 115 In spite of all these inconsistencies, in the most of the approaches made up to now to fix the date of Buddha's Nirvana, the Ceylonese chronology has been accepted as the main basis. This seems to be the main reason responsible for the discrepancy created between the chronology of Buddha and the genuine life-events of Buddha. The Chronology of Buddha In such a condition, when the chronology of Buddha itself is dubious and uncertain, in order to compute the period of contemporaneity of Mahavira and Buddha, their life-events depicted in the Agamas and the Tripitakas, serve as the most authentic means. Out of the six contemporary rivals of Buddha, Mahavira was the most prominent one. The Tripitakas bear testimony to their intimate relations, either bad or good. Hence, a complete consistency in their life-events will reveal their period of contemporaneity, and consequently, the chronology of Buddha. According to the Jain canon Bhagvati Sutra, Makkhali Gosalaka, the leader of the Ajivakas, died 16 years before the Nirvana of Mahavira. Also, as we have already proved, Bimbisara's (Srenika's) death and Ajatsatru's accession took place 17 years before the Nirvana of Mahavira. On the basis of the foregoing discussion, it has also become clear that Ajatasatru fought the Maha. Silakantaka war and the Raihamusala war with the Vajjis of Vaisali, in the first year of his reign. The following four facts are quite obvious in the light of the foregoing discussion of the life-events of Mahavira and Buddha, as dipicted in Agamas and the Tripitakas. 1. See, 'Inconsistencies' in Chapter III of this book.

Page #136
1:16 Mahavira and Buddha 1. Mahavira was elder than Buddha, the former having lived for 72 years, while the latter for 80. 2. Mahavira's omniscience is antecedent to Buddha's enlightment, Mahavira attained omniscience at the age of 42, while Buddha attained enlightenment at the age of 35.. 3. When Gosalaka died, Mahavira was 56 years old. 4. Buddha's enlightenment had taken place before the death of Gosalaka', i.e. Mahavira. Buddha as well as Gosalaka were alive at the time of Maha-Sila-Kantaka war. On the basis of the above facts, the following conclusion can easily be deduced - When Mahavira was 56 years old, Buddha must be at least 35. So the maximam possible seniority of Mahavira could be 21 years, and because Mahavira died at 72 and Buddha at 80, the maximum possible interval between their Nirvanas could be 29 years. 1. The Tripitakas tell us that the six religious teachers-Purana Kassapa, Makkhali Gosalaka, Niganth Nataputta, Ajita Kesakambali, Sanjya Vellathiputta and Pakuddha Kaccayana had already announced themselves as "Tirtharkaras' and had started preaching their religions before the enlightenment of Buddha. Also, when Buddha attained the enlightenment, all of them were alive. Makkhali Gasalaka was the founder of the Ajivaka sect. When, just after having attained the onlightenment, Buddha was travelling from Gaya to Saranatha in the way he met an Ajivaka monk called U paka. Buddha said to him, "I have attained enlightenment." But Upaka, being not convinced of this, paid no heed to him, Having said, "May be, perhaps, Upaka went away by another road. Vinaya Pitaka, Mahavagga, 1, also see Buddhacarya by Rahul Sankrityayapa. p. 21 and Bhagvana Buddha by Dharmapanda Kausambi, p. 137. This incident makes it clear that at the time of Buddha's enlightenment, Makkhali Gosalaka had already become an eminent religious leader.

Page #137
Research and Conclusion Again, as stated above, Mahavira attained omniscience 14 years before Gosalaka's death. Consequently, on the basis of fact No. 2, Buddha could not have attained the enlightenment prior to this. At the most, he could have attained it in the same year. If we suppose so, Buddha would be 35 and Mahavira 42 at that time. Therefore, the minimum possible seniority of Mahavira could be 7 years and the minimum possible interval between their Nirvana could be 15 years. 11.7 Thus Mahavira's seniority to Buddha lies between 21 and 7 years, and the interval between their Nirvanas lies betbeen 29 and 15 years. We get another way to reach a more definite period within the possible range stated above. The Atthakatha of Anguttara Nikaya supplies us a complete chronological list of the places where Buddha passed his rainy seasons after his enlightenment. According to the above work, in Rajagrha, Buddha spend his 2nd, 3rd, 4th, 17th and 20th rainy seasons after the enlightenment.2 Now according to the Sammnnuaphala Sutta of Digha Nikaya, the event of Ajatasatru's only call upon Buddha, during which the king Ajatasatru asked Buddha a question about the fruitfulness of monkhood and repented for murdering his father, took place during 1. Anguttara Nikaya, Atthakatha, 2-4-5. 2. According to Rhys Devids, Buddha passed his 4th rainy-season in Mahavana (Vaisali): (Buddhism by Rhys Davids quoted by M.N. Shastri in Buddha: His Life, His Teaching, His Order p. 120). But the Attakatha states that the 5th rainy season was spent at Vaisali in the same way Attakatha states that Buddha passed his 6th rainy-season at Mankula Parvata." While Rhys Davids has stated that he passed the 5th rainy-season, at Mankula Pravata. It seems, that in the calculation of Rhys Davids, there is an error of 1 year.

Page #138
118 Mahavira and Buddha one of the rainy seasons passed by Buddha at Rajagrha.1 Again, this event should have happened in the first year of Ajatasatru's reign, in as much as soon after his accession, he had transfered his capital to Campa, on account of the great sorrow he felt over his father's death. Now, if we suppose that the above event recorded by the Sammannua-` phaia Sutta had taken place in the 17th or 20th rainy-season after Buddha's enlightenment, the fact No. 2 (stated above) is violated. For, as shown before,2 Ajatasatru's accession took place in the 13th year after Mahavira's attainment of omniscience. So the possibility of the above event taking place in 17th or 20th rainy-season is ruled out. Consequently the event should have taken place either in the 2nd or 3rd or the 4th rainy-season after Buddha's enlightenment. Thus it was the 13th year after Mahavira's omniscience and the 2nd, the 3rd, or the 4th year after Buddha's enlightenment. This means that Mahavira was, at that time 55 years old, and Buddha either 36, 37 or 38. In other words Mahavira was 19, 18 or 17 years older than Buddha, and attained the Nirvana 27, 26, or 25 years earlier than Buddha. Further to reach at a definite conclusion out of these three alternatives, we fortunately get a small way out-If we suppose that the event of Sammannya-phala Sutta, had taken place in the 2nd or 3rd rainy season after Buddha's enlightenment, it would mean that Ajatasatru's accession and Bimbisara's death took place only one or two years after Buddha's enlightenment, that is to say, the contemporaneity of Bimbisara with enlightened Buddha was of one or two years. But a closer study of the Buddhist Tripitakas reveal 1. This Sutta has been quoted in Seniority of Mahavira, in this Chapter. 2. See, 'Inconsistencies' in Chapter III of this book.

Page #139
Research and Conclusion 119 that it should be slightly wider than this. Therefore, it will be consistent to take the 4th rainy-season after enlightenment to be the year of Ajatasatru's accession. This will allow a period of three years which is enough long, for the contemporaneity of Bimbisara with enlightened Buddha. Thus by taking the last alternative, we reach the final conclusion that : 1. Mahavira was 17 years older than Buddha. 2. Mahavira attained the Nirvana 25 years earlier than Buddha. 3. The total contemporaneity of their life was 55 years, the contemporaneity of their life as religious leaders was 20 years. It should be borne in mind that the above conclusion is based only upon the life-events of Mahavira and Buddha. Even if we suppose them to have lived in any period of history, this conclusion will hold good. In order to accomplish our discussion, it is essential to think over it from the chronological point of view. It has already been made clear that the chronology of Buddha is in itself quite uncertain. Also, it has been shown that the chronology of Mahavira in itself is almost unanimous and certain. Hence, on the basis of the unequivocal date of Mahavira, the above conclusion can be put in chronological terms. The date of Mahavira's Nirvana is 527 B.C. Therefore, that of Buddha's Nirvana should be 502 B.C. Now as we have found out the date of Nirvana, we can easily compute the dates of the important events of his life as follows: 1. Dr. Radha Kumud Mukherjee has rightly remarked, "Chrono logy is essential to biography. An individual cannot rank as a historical person, unless his life and work are placed in time". Candragupta Maurya and His Times, p. 2,

Page #140
120 Mahavira and Buddha Date Event of Buddha's life 582 B.C. 554 B.C. 547 B.C. 502 B.C. Birth Renunciation Enlightenment Nirvana The comparative chronological table of the important events of their life is as follows: Mahavira Buddha Birth 599 B.C. 569 B.C. 557 B.C. 582 B.C. 554 B.C. 547 B.C. Renunciation Enlightenment (Omniscence) Niryana 527 B.C. 502 B.C. Thus Mahavira and Buddha lived comtemporarily from 582 B.C. to 527 B.C. i.e. for 55 years. As religious leaders, their contemporaneity lasted from 547 B.C. to 527 B.C. for 20 years. It should also be noted here that Buddha had attained Nirvana in 42nd year of Ajatasatru's reign; and that Candragupta Maurya and Asoka acceded to the throne of Magadha 180 and 229 years after Buddha's Nirvana respectively.

Page #141
CHAPTER VIII CORROBORATION OF THE CONCLUSION We have reached the above conclusion regarding the date of Buddha's Nirrana solely on the basis of historical and mathematical methods. Hence it can be regarded as a 'self evident' fact. But, because it is being disclosed in. the field of history for the first time, it will not be unnecessary to corroborate it by some other evidences. We get some historical and traditional evidences which directly corroborate the above conclusion. They are as follows : 1. Tibetan Tradition : According to the Buddhist tradition of Tibet, the day on which Buddha was born, was also the birthday of the king Canda Pradyota (also known as Mahasena) of Avanti. The same tradition also records that Buddha's. enlightenment and Pradyota's accession took place on the same day. The king Pradyota is mentioned in all the three traditions-Buddhist, Jain and Puranic. According to the Puranas. such as Vayu Purana", Matsya Purana, 4 Bhagvat Purana, etc.. and the famous literary works like Kathasaritsagara, Svap 1. Life of Buddha by Rockhill, p. 17. 2. Ibid. p. 32. 3. Vayu Purana, Adhyaya IC V. 312. 4. Matsya Purana. Adhye ya CCLXXI V. 3. 5. Bhagvat Purana Skandha, XII Adhyaya V. 3. 6. Kathasaritsagara 3/5/58.

Page #142
122 Mahavira and Buddha anavasvadatta,1 Mrcchakatikaetc. and the Jain works like Avasyaka--Niryukti-Dipika,3 Pradyota was succeeded by his son Palaka. Now, as we have already seen the king Palaka acceded to the throne of Avanti in the same night on which Mahavira passed away. Thus, it becomes clear that the king Pradyota was born on the day of Buddha's birth, he acceded to throne on the day of Buddha's enlightenment, and lastly, his reign ended on the day of Mahavira's Nirvana. The puranic chronology unequivocally ascribe 23 years to Pradyota's rule. "Trayovimsat samaraja bhavita sa narottamah's that is "He (Pradyota) ruled for 23 years." Thus, when Buddha attained the enlightenment at the age of 35, Pradyota became the king, and when Mahavira attained the Nirvana at the age of 72, Pradyota's rule ended. Therefore, at the time of Pradyota's accession, Mahavira must be 72-23=49 years old, and Buddha was 35 years old. Hence, we conclude that Mahavira was 14 years older than Buddha. This conclusion nearly endorses our conclusion that Mahavira was 17 years older than Buddha. 2. The Traditional Date af Chinese Turkestan Our conclusion is also quite consistent with the tradi 1. Svapanavasavadatto of Bhasa. 2. Mrcchakatika of Sudraka. 3. Ayasyaka-Nirukti-Dipika part II pp. 110-11, V. 1282. Tithogalipainnya-quoted in 'The Date of Mahavira's Nirvana in Chapter VII of this book. 5. Vayu Purana Adhyaya IC V. 311. 6. Pradyota's reign ended in 527 B.C. Hence, his accession should have taken place in 527+23=550 B.C. Cf. foot note.

Page #143
Corroboration of the Conclusion 123 tional date of Buddha's Nirvana, prevalent in Chinese Turkestan,' and also known as "Khotan Tradition." This tradition places the King Asoka 250 years after the Nirvana of Buddha by taking him as a contemporary of the Chinese emperor Shih-Huang-Ti. Some scholars, on the basis of the fact that Shih-Huang-Ti's accession took place in 245 B.C., have accepted (246+250=) 496 B.C. as the date of Buddha's Nirvana. It may be noted that there is only a nominal difference of 6 years between this date and our conclusion. But, it seems that the interval of 250 years between Buddha's Nirvana and Asoka should, in reality, be the one between Buddha's Nirvana and the famous third Buddhist council, that had taken place in the 18th year after Asoka's consecration, and according to historians, in 252 B.C. Hence, the date of Buddha's Nirvana, on the basis of the above tradition should be 252+250=502 B.C. which exactly coincides with our conclusion. 3. Asoka's Edicts The stone (rocks) and pillars inscribed by Asoka the great Mauryan emperor, are, in fact the foundation-stones and foundation pillars of Indian history. Many a doubtful facts regarding history were made undoubtful on the basis of the above inscriptions. The present conclusion regarding the date of Buddha's Nirvana is too corroborated by these edicts. The edicts are mainly divided in the following types : 5 Minor Rock Edicts 14 Rock Edicts 4 Minor pillar Edicts 1. See Traditional Dates of Buddha's Nirvana in Chapter VII of this book. 2. See, for example Janardan Bhatt, Buddha Kalina Bharata, p. 213. 3. Dr. Ramashankar Tripathi. Pracina Bharat ka Itihasa, p. 129.

Page #144
124 Mahavira and Buddha 7 Pillar Edicts 3 Cave Edicts 6 Miscellaneous Edicts. The following is the text of the Minor Rock Edicts: No. 1, which is found at Rupanatha, Sahasarama and Vairata ;' "Devanam piye evam aha (:-) Satilekani adhatiyani vaya sumi paka savake no cu vadhi pakate; satilake cu. chavachare ya sumi hakam samghe upete. "Badhi cu pakate yi ! imaya kalaya jambudipamsi amisa deva husu te dani misa Kata! Pakamayi hi esa phale ! Noca esa mahatata papotave khudakena hi ka ! "Pi parumaminena sakiye pipule pi svage arodhave ! Etiya athaya ca sato kate Khudaka cha udhala ca pakamuta ti! ata pi ca janamtu iyam pakakha. "Kiti (?) cirathati ke siya Iya hi athe vadhi vadhisiti vipula ca vadhisiti ! Apalaghiyena didhiya vadhisata (1) iya ca athe pavatisu lekhapeta valatahadha ca (1) athi. "Silathame silathambhasi lakhapata vayata Etina ca vayajanena yavataka tupaka ahaee sayara vivasetavayuti ! Vyuthena savane kate 256 Satavivasata !" The following is the translation : Thus saith His sarced Majesty : For more than two and a half years I was a lay disciple, without, however exerting myself strenously. But it is more than a year since I joined the Order, and have exerted myself strenously. "During that time the Gods who were regarded as true all over India have been shown to be untrue. 1. Asok a ke Dharma Lekha, by Janardan Bhatt. 2. The edicts of Sahasarama and Vairata read "Upasake".

Page #145
Corroboration of the Conclusion 125 "For this is the fruit of exertion. Nor is this to be attained by a great man only, because even by the small man who chooses to exert himself immence heavenly bliss may be won." "For this purpose has the precept been composed : 'Let small and great exert themselves.' "My neighbours too should learn this lesson: and may such exertion long endure." "And this purpose will grow, yea it will grow immensely at least one-and-a half-fold will it increase in growth." "And this purpose must be written on the rocks, both afar of and here; and wherever there is a stone-pillar, it must be written on stone-pillar." And according to this text, so far as your jurisdiction extends, you must send it out everywhere." "By (me) was the precept composed, when 256 years had passed since the Nirvana of Buddha." In the Minor rock Edict No. 2, which is found at Brahmagiri Sidhapur, and Jatinga-Rameshwar, we find the same thing repeated with a slight difference. Emperor Asoka writes there :1 "Suvamnagiri te ayaputasa mahamayama ca vacanena isilasi Mahamata arogiyam vataviya hevam ca vataviya ! Devanam piye anapayati ! "Adhikani adhati yani vaya sumi ......diyadhiya valhisiti ! iyam ca savane savapate vyudhena 256. The translation is by command of the Prince and high officials at Suvaranagiri, the high official at Isila are to be addressed with greetings, and further addressed as follows: 1. Asoka ke Dharmlekha, by Janardan Bhatt.

Page #146
126 Mahavira and Buddha His sacred majesty gives this instruction: 'For more than two......And the precept quoted above was preached by? (me) in 256th (years) after Buddha's Nirvana.' There are mainly two things in the above edicts to be noted: The first is concerning Asoka's joining order, which - is expressed by the words "Samghe upete;" the second one -the date inscribed in the end of the edicts viz. 256 years after Buddha's Nirvana, expressed by the words "Vyuthena savane kate 256 Satavivasata." The words "Samghe upete" used in the above Edicts have become a matter of controversy amongst the scholars and different scholars have tried to interpret them in different ways. Dr. Radha Kumud Mukherjee, discussing about this controversy, writes: "It is difficult to understand what Asoka exactly intends by the expression on Samghe upete, which has been translated above to mean that he lived with, entered or visited the Samgha, and the opinion of the scholars is sharply divided on this point. Some scholars hold that Asoka actually became a Buddhist monk (Bhikkhu). Others, however, take the expression simply to mean that Asoka made a state-visit to the samgha and publicly proclaimed his faith as the Sinhalese chronicle informs us. The former view is, however, supported by the statement of I-tsing that he actually saw a statue of Asoka dressed as a monk. A third possibility is that Asoka lived with the samgha for more than a year, without taking orders. "Among those who assume that Asoka became a monk, there is again a difference of opinion. Some hold that 1. The Age of Imperial Unity, (The History and Culture of Indian People, Vol. II), pp. 75-76.

Page #147
Corroboration of the Conclusion 127 during the period Asoka was a monk, he must have ceased. to be a monarch, for monastic life is hardly compatible with royal duties. Others, however, point out actual examples of kings who were monks at the same time and find no reason for the assumption that Asoka, even temporarily abdicated the throne. "Whatever may be the right interpretation of this association with the Sangha, there is no doubt that since this event, Asoka exerted himself with unflagging zeal for the propagation of Buddhism, or at least that part of it which he accepted as his Dharma. He not only set up a net-work of missions to preach the doctrine both in and outside India, but himself undertook tours for this purpose and took various other steps to the same end.' Dr. Mukherjee has not emphasised a particular view regarding the interpretation of the expression, Samghe upete. Nevertheless, it is easily understood, even by glancing at the different interpretations, that the event of Asoka's "Sanghe upete" is related with his historical religious tour or pilgrimage, which is explicitly mentioned even in Asoka's own edicts. In the Rummindei Pillar Edict, Asoka writes :: "Devan piyena piyadasin lajina visati vasabhisitena atana aga ca mahiyite ! hiya budhe jate sakya muniti silavigala bhiva kalapita silathame ca usa papi te hiya bhagavam jate ti luminigame uvalike kate athabhagiye ca?." It means, "His Sacred and Gracious Majesty the King, when he had been consecrated twenty years, having come in person, did reverence; and because "Here Buddha was 1. Asoka ke Dharama-lekha, by Janradan Bhatt. 2. Asoka, by Vincent A. Smith, p. 199.

Page #148
128 Mahavira and Buddha born, the Sakya sage," a great (?) railing of stone was prepared and a stone pillar erected. Because "Here the Venerable one was born" the village of Lumini was made free of religious cesses and declared entitled to the eighth share (of the produce claimed by the crown). In addition to this, the way in which the famous Buddhist work Asokavadana describes the pilgrimage of Asoka, suggests that the expression "Samghe Upete" is quite competent with the pilgrimage of Asoka. 'The pilgrimage of Asoka' is described thus:1 "The King said "I desire to visit all the places where the venerable Buddha stayed, to do honour unto them, and to mark each with an enduring memorial for the instruction of the most remote posterity.' The Saint (Upagupta) approved of the project, and undertook to act as a guide. Escorted by a mighty army, the monarch visited the holy places in Order. "The first place visited was the Lummini garden. Here Upagupta said: 'In this spot, great king, the Venerable one was born; and added: "Here is the first monument consecrated in honour of the Buddha, the sight of whom is excellent. Here, the moment after his birth, the reculse took seven steps upon the ground.' "The king bestowed a hundred thousand gold pieces on the people of the place, and built a Stupa. He, then passed on to Kapilvastu. "The royal pilgrim next visited the Bodhi-tree at Bodhi Gaya, and there also gave a largesse of hundred thousand 1. Translated from Asokavadana by Dr. Vincent A. Smith, in Asoka (The Rulers of India), pp. 227-228.

Page #149
Corroboration of the Conclusion : 129 gold-pieces, and built a Caitya. Rsipatana (Saranatha) near Benaras, where Gautama had turned the wheel of law and Kusinara, where the teacher had passed away, were also visited with similar observances. At Saravasti the pilgrims did reverence to the Jetavana monastery, where Goutama had so long dwelt and taught, and to the Stupas of his disciples, Sariputra, Maudgalayana, and Mahakasyapa. But when the king visited the Stupa of Vakkula, he gave only one copper coin, in as much as Vakkula had met with few obstacles in the path of holiness and had done little good to his fellow creatures. At the Stupa of Ananda the faithful attendant of Gautama, the royal gift amounted to six million gold pieces." Many a scholars are of the view that Asoka had also become a Buddhist monk in his life-time may it be only for a short time. It seems most probable that the above pilgrimage was undertaken by Asoka in the form of a Buddhist monk. But it does not mean that he ceased to be the king at that time. Thus the purport of the expression "Samghe-Upete" also becomes meaningful. Asoka has stated in the above edicts that he became a lay-disciple 21 years before his stage of "Joining the Order" (Sarghe-Upete). Now, if Asoka "Joined the Order" 20 years after his consecration, as stated by him in the Rummindei pillar Edict, he must have become a lay disciple 173 years after his consecration. This is exactly the time of the 'Third Buddhist Council'l. Though generally it is held that Asoka became a follower of Buddhism 9 years after his consecration, it seems that he considered himself initiated into "formal Upasaka-dharama (rules of the laydisciple)" from the time of the Third Buddhist Council. 1. Cf. Asoka, by V.A. Smith, p. 211.

Page #150
130 3. Mahavira and Buddha Thus, we can say that Asoka became a lay disciple 17} years after his consecration ; he joined the order" 20 years after his consecration; and he wrote the above inscriptions (Minor Rock Edict Nos. I & II), slightly more than 21 years after his consecration. "The second thing, to be paid attention to, in the aforequoted edicts, is the last time of the inscription viz. "Vyuthena savane kate 256 satavivasata." This line has also been interpreted differently by different scholars. Etymologically, vyuthena is the Apabhramsa of the Sanskrit word vyustena and vivasa that of vivasat. Vyusta is formed by adding the termination kta to the root vitvas (forming the part participle), and Vivasa is formed by adding the termination ghan to the root vit vas. According to the distinguished scholars like Dr. Buhler, Dr. Fleet etc. vyustena means 'one who has passed away' i.e. Buddha, and vivasat means 'the Nirvana (of Buddha').' Dr. Fleet also observes: "It is quite probable that king Asoka would have become a monk by abdicating the throne 255 years and 7 or 8 months after the Nirvana of Buddha and since then he would have "joined the Order." When 8 months and 16 days were thus completed, on the 256th night, Asoka would have written these inscriptions (Minor Rock Edict Nos. I&II). But a question arises that why Asoka specially mentioned 256th night in these inscriptions. The answer is 256th year from Buddha's Nirvana had just completed on the 256th day or night of Asoka's tour, and to mark the 256th 1. Journal of Royal Asiatic Society. 1904, pp. 1-26, Dr. Buhler, "Second notice, Indian Antiquary, 1893'. 2. Journal of Royal Asiatic Society, 1910, pp. 1301-8, 1911, pp. 1091-1112 (quoted from Janardan Bhatta, Asoka ke Dharma lekha).

Page #151
Corroboration of the Conclusion anniversary of Buddha's Nirvana, Asoka wrote these inscriptions. Thus it is proved that the number 256 mentioned in these inscriptions is indicative of the fact that Buddha's Nirvana took place 256 years before Asoka." The above view of Dr. Fleet and Dr. Buhler is based on a critical study of the inscriptions of Asoka. But the modern historians, however, accept it only partly. According to them', it can only be said that the inscription was written on the 256th departure from staging-places or on the '256th day of the tour,' but to say that it was written to observe 256th anniversary of Buddha's Nirvana, does not seem to be correct. The only reason behind this view of the modern historians seems to be that the period which is 256 years precedent to Buddha's Nirvana, does not synchronize with the whole period of Asoka (273-236 B.C.), on the basis of any prevalent date of Buddha's Nirvana2. 3 131 Hence, they say, "The number 256 in the earliest edict has no bearing upon chronology." But their argument is neither justifiable nor correct. Dr. Max Mullar, the profound Oriental Scholar, has criticized this trend of the historians, and supported the view of Dr. Buhler. He writes, "I fully admit the difficulties in the phraseology of 1. For the view of the modern history, see Vincent A. Smith, Asoka, p. 150; Dr. F.W. Thomas, Indian Antiquary, 1908, pp. 19-23, Dr. H.C. Raychaudhuri, op. cit., p. 341 n; Yadhunandana Kapur, Asoka, p. 128, etc. None of the dates of Buddha's Nirvana, which are in vogue, falls between (236+256=) 492 B.C. and (273+256-) 529 B.C. cf. Historians dates of Buddha's Nirvana in chapter VII of this book. 3. Dr. F.W. Thomas, Asoka in Cambridge Histary of India, Vol. I, p. 453. 2. 4. Dhamapadda, Sacred Books of the East, Vol. X, part I Introduction, p. XLI.

Page #152
132 Mahavira and Buddha these incriptions; but I ask, "Who could have written these inscriptions, if not Asoka ? and, how if written by Asoka, can the date which they contain mean anything but 256 years after Buddha's Nirvana ? These points, however, have been argued in so masterly a manner by Dr. Buhler in his "Second Notice that I should be afraid of weakening his case by adding anything of my own, and must refer my readers to his 'Second Notice', Now, the remarkable and important thing regarding this matter is that the "number 256 years" of the above inscriptions becomes quite consistence, with the date 502 B.C., which we have proved in this book to be the date of Buddha's Nirvana. It has already been made clear that the above inscriptions were written by Asoka a little more than a year since he joined the Order", and he "joined the Order" 20 years after his consecration. Here, we reach a definite point regarding the chronology which is unanimous and certain. It is the date of Asoka's consecration 269 B.C. Thus, Asoka's consecration 269 B.C. Asoka "joined the Order" in 248 B.C.1 1. Dr. Radha Kumud Mukherjee has observed that since Asoka's association with the order, he exerted himself with unflagging zeal for the propagation of Buddhism, and it was Asoka's zeal for his new faith that led him to preach it in a foreign colony by sending up a net-work of missions. The Age of Imperial Unity, pp. 76 ; also, Asoka by Radha Kumud Mukherjee, p. 257. Accordingly and also because the historians accept 246 B.C. as the date of introduction of Buddhism into Ceylon by Mahendra (the son of Asoka) (cf. Dr. L.D. Barnatt, "The Early History of Ceylon in Cambridge History of India, Vol. I, p. 547). 248 B.C. our date of Asoka's "joining the Order" is proved to be correct.

Page #153
Corroboration of the Conclusion The date of the minor Rock Edicts I & II Hence, by going 255 years back from 247 B.C. we, reach the date of Buddha's Nirvana. 247+255-502 B.C. 4. Burmese Tradition The most sound evidence among the traditional evidences is that of Burmese tradition. There prevails an era called "Eetzana era" in Burma.1 Eetzana is the Burmese term for Anjana, who was the Sakya king of Devaha which is the Burmese for Devadaha Country and who was also the maternal grandfather of Buddha.2 The chief events of Buddha's life have been chronicled in the Eetzana era and the tithis, (the lunar days), the week-days as well as the constellations with which the moon was in combination on these days, have also been recorded with reference to the different years of that era, which would seem to have been current at that ancient time. (1) Birth of Buddha on Friday the full-moon day of the month Katson which is Burmese for the Indian lunar month Vaisakka, combined with the constellation Withaka, which is Burmese for the 16th lunar mansion Visakha in the 68th year of the Eetzana era. 133 247 B.C. (2) Renunciation (Departure from the household life and initiation into ascetic life); On Monday the fullmoon day in the month of July i.e. Asadha (the Indian lunar month), combined with the constellation Ostharathana, 1. Life of Gautama by Bigandet, Vok FF, p. 13. 2. Ibid., p. 13. 3. Ibid., vol. II pp. 71-72, 4. Ibid., vol. I, pp. 62-63; vol. II, p. 72.

Page #154
134 Mahavira and Buddha which is Burmese for the 21st lunar mansion Uttrasaoha in the 96th year of the Eetzana era. (3) Enlightenment of Buddha. On Wednesday the full-moon day of Katson=Vaisakha, combined with the constellation Withaka=Vaisakha in the 103rd year of the Eetzana era. (4) Parinirvana of Buddha? : On Tuesday the full-moon day of Kat son=Vaisakha combined with the constellation Withaka=Vaisakha, in the 148th year of Eetzana era. According to the Burmese tradition, the Eetzana era began on Sunday which was the 1st lunar day of the waxing moon of the month Tagoo i.e. Burmese for the Indian month Caitra. 3 .:. A research scholar Mr. M. Govind Pai has found out the corresponding English dates of the above Burmeset dates. According to his conversions the chronology date is as follows: 1. Birth of Buddha 30th March, 581 B. C. * 2. Renunciation of Buddha : 18th June, 553 B. C. 2.3. Enlightenment , , : 3rd April, 546 B, C. 4. Parinirvana , : 15th, 501 B. C. 5. Beginning of Eetzana era : 17th February 648 B. C. Thus, it can be seen that the Burmese tradition is in perfect congruence with the chronological date of Buddha's life-events, which we have deduced in the last chapter. : 1. Ibid., vol. I, p. 97; Vol. II, pp. 72-73. 2. Ibid., vol. II, pp. 69. 3. Ibid., vol. I, p. 13. 4. Prabuddha Karnataka, a Kannada Quarterly published by the Mysore University, vcl, XXVII (1945-46), No. 1, pp. 92-93 ; The date of the Nirvana of Lord Mahavira in Sri Mahaviru Commemoration Volume, vol. I, 1941-49, pp. 93-94.

Page #155
Corroboration of the Conclusion It is really a surprising coincidence that the Burmese tradition and our approach arrive exactly at the same fact, for the author of this book was not at all aware of the Burmese tradition till he reached the conclusion. The author came to know about the Burmese tradition only after the whole book had already been published in the form of articles in the journals like Jaina Bharati,1 Anekanta2 etc. Well, the four evidences cited above have corroborated our conclusion in the same way as the fourway farers from different directions would confirm the reality of the pole by arriving at the same polar point. 1. 2. Jaina Bharati, vol. XI, Nos, IV, VI to X. Anekanta (Bi-monthly), April-June, 1963. 135

Page #156

Page #157
APPENDICES

Page #158

Page #159
APPENDIX I The Chronological list of Rainy-seasons passed by * Mahavira after his Attainment of Omniscence,1 Number 1 123456TGEREE 7 8 9 10 11 16 17 BR2223 18 19 20 21 Date (B.C.) 557 556 555 554 553 552 551 550 549 548 547 546 545 544 543 542 541 540 539 538 537 536 535 Place Rajagrha Vaisali Vanijyagrama Rajagrha Vanijyagrama Rajagrha Rajagrha Vaisali Vaisali Rajagrha Vanijyagrama Rajagrha Rajagrha Mithila Mithila Vanijyagrama Rajagrha Vanijyagrama Vaisali Vaisali Rajagrha Nalanda Vaisali 1. The order of the rainy seasons is based on the research work of Sri Vijayendrasuri, see op. cit., Vol. II, pp. 3-326.

Page #160
140 Mahavira and Buddha 534 533 532 531 Vaisali Rajagsha Nalanda Mithila Mithila Rajagrha Pava 530 529 528

Page #161
APPENDIX II 546 544 539 The Chronological list of Rainy-seasons passed by Buddha after his Enlightenment.1 Number Date (B.C.) Place 547 Rsipatana Rajagtha 545 Rajaglha Rajagsha 543 Vajsali 542 Mankulaparvata 541 Tryastrimsa 540 Sumsummaragiri Kausambi 538 Parileyaka 11 537 Nala 536 Vairanja 535 Caliyaparvata 534 Sravasti Kapilvastu 532 Alavi Rajagpha 530 Caliyaparvata 529 Caliyaparvata 528 Rajagsha 21-45 527-503 Sravasti 502 Vaisali 533 531 20 46 1. The order of the rainy-seasons is based on Ariguttara Nikaya Athakatha, 23/5.

Page #162

Page #163
BIBLIOGRAPHY, Hindi, Sanskrit, Pali and Praklta Books. 1. Anguttara Nikaya (Attha Katha). Tr. by Pt. Rahula Samskstyayana, Pub. by Mahabodhi Sabha Benaras. 2. Antagadadasanga Sutra. Ed. by Amolaka Rsi, Pub. by Jaina Sastroddhara, Mudranalaya Sikandrabad (Deccan). 3. Anuttarovavai Sutra, Ibid. 4. Asoka by D.R. Bhandarkar, Pub. by S. Chand & Co., Delhi, 1923. 5. Ahimsa Vani, Pub. by Akhila Visva Jain Mission, Aliganja (Eta). 6. Annual Volume of Aja Kala, 'Baudha Dharma Ke 2500 Varsa', Pub. by Publication Division, Delhi, 1960. 7. Ajivikas, by A.L. Bhasham. 8. Arya Samskati Ke Mula Adhara by Acarya Baladeva Upadhyaya, Pub. by Sarada Mandira, Benaras. 9. Upasakadasanga Sutra, Ed. by Amolaka Rsi, Pub. by Jaina Sastroddhara, Mudranalaya Sikandrabad (Deccan). 10. Uvavai Sutra, Ibid. 11. Kalpa Sutra, Ibid. :12. Kathasaritsagara, Pub. by Bihara Rastrabhasa Parisad, Patana. 13. Gupta Samrajya Ka Itihasa by Vasudeva Upadhyaya, Pub. by Indian Press Limited, Allahabad. 14. Jaina Darsana Ke Maulika Tatva by Muni Sri Nathamal Ji, Pub. by Adaria Sahitya Samgha, Curu, 1961.

Page #164
144 Mahavira and Buddha 15. Jaina Bharati, Pub. by Jaina Svetambara Terapanthi Mahasabha, Calcutta-1. 16. Jaina Satya-prakasa (magazine). 17. Jaina Sahitya aura Itihasa by Nathu Ram Premi, Pub. by Hindi Grantha Ratnakara Karyalaya, Bombay, 1942. 18. Thanaga Sutra, E. by Amolaka Rsi, Pub. by Jaina Sastroddhara, Mudranalaya Sikandrabad (Deccan). 19. Tatva Samuccaya by Dr. Hira Lal Jaina. 20. Tapagaccha Pattavali (Stika, Tr. by Panyasa Kalayana Vijaya Ji) and written by Dharmasagara Upadhyaya. 21. Titthogali Painnaya. 22. Tiloyayannatti, Parts I and II by Yativisabacarya, Ed. by Dr. A.N. Upadhye and Dr. Hira Lal Jaina, Pub. by Jaina Samskrti Samraksaka Samgha, Solapur, 1943. 23. Trilokasara, by Nemicandra Siddhanta Cakravarti, Tr. by Todaramalaji, Pub. by Hindi Jaina Sahitya Prasaraka Karyalaya, Bombay, 1911. 24. Tirathankara Mahabira by Vijendra Suri, Pub. by Kasinatha Sarapha Yasodharma Mandira, Bombay, 1962. 25. Darsana aura Cintana, by Pt. Sukha Lal Ji. 26. Divyavadana. 27. Darsana Digadarsana by Pt. Rahula Samkrtyayana, Pub. by Mahabodhi Sabha, Benaras, 1936. 28. Digha Nikaya (Hindi Translation), Ibid. 29. Dhavala Tika by Virasenacarya, Pub. by Jaina Sid dhanta Bhavan, Ara. 30. Nandi Sutra, Ed. by Amolaka Rsi, Pub. by Jaina Sastroddhara Mudranalaya, Sikandrabad (Deccan). 31. Niryavaliya Sutra, Ibid.

Page #165
145 Bibliography 32. Pancavastuka, Pub. by Setha Deva Chand Lal Bhai Pustakoddhara Fund, Surat. 33. Parisista-parvan (Sthaviravali Caritra) by Hemacandra carya, Ed. by Dr. Hermann Jacobi, Pub. by Asiatic Society, Calcutta, 1932. 34. Parisista-parvan (Sthaviravali Caritra) by Hemacandra. . carya, Ed. by Haragovind Das Seth, Pub. by Jaina Dharma Prasaraka Sabha, Bhavanagar, 1912. 35. Paninikalina Bharatavarsa by Dr. Vasudeva Saran Aggrawal. 36. Parsvanatha Ka Caturyama Dharma by Dharmananda Kausambi, Pub. by Hindi Grantha Ratnakara Karyalaya, Bombay. 37. Pracina Bharata by Ganga Prasad Mehta. 38. Pracina Bharata by C. M. Srinivasacari Ramasyami Iyangar, Allahabad, 1950. 39. Pracina Bharat Ka Itihasa by Dr. Rama Sankara Tripathi, Pub. by Nanda Kishor & Bros., Banaras, 1956. 40. Pracina Bharata Varsa by Dr. Tribhuvandas Laher chand Shah, Baroda. 41. Bankaculia Painna. 42. Bimbisara by Susila, Pub. by Ananda Mudranalaya, Bhavanagar, 1932. 43. Buddha Aura Mahavira by Prof. Leumann, Tr. by Tilakavijaya, Pub. by Brahmanand Sharma, Ludhiana, 1937. 44. Buddhacary, by Pt. Rahula Samkstyayana, Pub. by Siva Prasada Gupta, Seva Upavan, Kasi, 1924. 45. Buddha Purva Bharata Ka Itihasa by Dr. Syama Bihari Misra, Sukaraja Bhihari Misra, Hindi Sahitya Sammelana, Prayaga.

Page #166
Mahavira and Buddha 46. Brhatkathamanjari by Ksemendra. 47. Baudha Kalina Bharata by Janardan Bhatta, Sahitya Ratnamala Karyalaya, Kasi, 1926. 48. Brahmanda Purana, Pub. by Nanda Lal Mora, 5 Clive Row, Calcutta. 49. Bhagavati Sutra Ed. by Jaina Sastroddhara Mudranalaya, Sikandrabad (Deccan). 146 50. Bhagavana Buddha by Dharmananda Kausambi, Pub. by Raja Kamala Publication, Bombay, 1956. 51. Bhagavana Parsvanatha Ki Parampara Ka Itihasa (Two Parts) by Muni Sri Jnana Sundaraji, Pub. by Ratnaprabhakara Jnana Puspamala, 1943. 52. Bhagavana Mahavira Aura Mahatma Buddha by Dr. Kamata Prasada Jaina, Pub. by Mulacanda Kisanadasa Kavadiya, Surat, 1926. 53. Bhagavana Mahavira No Samyama Dharma by Gopaladas Patel, Pub. by Navajivana Karyalaya, Allahabad. 54. Bhagavata Purana, Pub. by Gita Press, Gorakhapura. 55. Bharata Ka Brhata Itihasa (4th Ed.) by Prof. Srinctra Pandeya. 56. Bharata ke Pracina Rajavamsa by Mahamahopadhyaya Pt. Visvesvara Nath Reu, Pub. by Nathu Rama Premi, Hindi Grantha Ratnakara Karyalaya, Bombay, 1927. 57. Bharatiya Itihasa ki Bhumika by Dr. Raja Bali Pandey, Pub. by Malhotra Bros, 60, Daryaganj, Delhi, 1949. 58. Bharatiya Pracina Lipimala by Raya Bahadura Gouri Sankara Ojha.

Page #167
Bibliography 147 59. Biksu-grantha Ratnakara, Ed. by Acarya Sri Tulsi, Pub. by Jaina Svetambara Terapanthi Mahasabha, Calcutta, 1960. 60. Bhrama-Vidhvamsanam by Srimajjayacarya, Pub. by Osavala Press, Calcutta, 1924. 61. Majjhima Nikaya (Hindi), Tr. by Pt. Rahula Sarkstya. yana, Pub. by Mahabodhi Sabha, Benaras, 1933. 62. Matsya Purana, Pub. by Nanda Lal Mora, 5 Clive Row, Calcutta. 63. Mahabharata by Vyasa, Tr. by Arun Kumar Pub. by Astro-Medical Research Publications, Raichur, Mysore State. 64. Mahavamsa (Hindi) Tr. by Bhadanta Ananda Kausalyayana, Pub. by Hindi Sahitya Sammelan, Prayag. 65. Mahaviracariyam by Nemicandra, Pub. by Atmananda Sabha, Bhavanagar, 1926. 66. Mrcchakatika by Sudraka Ed. by Godbole, B. A., Bombay Sanskrit Series, No. LII, 1896. 67. Vayu Purana, Pub. by Nanda Lal Mora, 5 Clive Row, Calcutta. 68. Vicarasreni by Merutungacarya, Pub. by Jaina Sahitya Samsodhana, Poona, Vol. II, Nos. III & IV, May, 1925. 69. Vinaya Pitaka (Hindi), Tr. by Rahula Samkstyayana, Pub. by Mahabodhi Sabha, Benaras, 1954. 70. Vira Nirvana Samyat Aura Jaina Kalaganana by Muni Kalyana Vijaya Ji, Pub. by K.V. Sastra Samiti, Jalora (Maravada), 1930. 71. Vividha Tirthakalpa (Apapabihatakalpa), Pub. by Singhi Jaina Series.

Page #168
148 Mahavira and Buddha 72. Vaisali by Vijayendra Suri, Pub. by Yasodharma Mandir, Bombay. 73. Samyukta Nikaya (Hindi), Tr. by Jagadisa Kasyapa, Biksu Dharmaraksita, Pub. by Mahabodhi Sabha, Banaras, 1954. 74. Sutta-nipata (Hindi) Tr. by Pt. Rahula Samkstyayana, Pub. by Mahabodhi Sabha, Benaras. 75. Sutrakstanga Sutra, Ed. by Amolaka Rsi, Pub. by Jaina Sastroddhara Mudranalaya, Sikandrabad (Deccan). 76. Sutrakstanga Sutra, Tr. by Pt. Rahula Samkstyayana, Mulagama Prakasana Samiti, Gudgava (Cantt.) Panjab, 1957. 77. Saubhagya Pancamyadi Parva Katha Samgraha. 78. Svapnavasavadatta by Bhasa, Ed. Ganpati Shastri, Trivendrum, 1913. 79. Harivamsa Purana by Jinasenacarya, Pub. by Manakya chandra Granihmala, Bombay, 1929. 80. Hindu Sabhyata by Dr. Radha Kumud Mukerji, Tr. by Dr. Vasudeva Sarana Aggrawal, Pub. by Raja Kamala Prakasana, Bombay, 1955. 81. Asoka by Yadu Nandan Kapoor, Agra, 1962. 82. Asoka ke Dharmalekha by Janardan Bhatta, Allaha bad. 83. Asoka ke Dharmalekha by Janardana Bhatta, Publi cation Division, Old Secretariat, Delhi, 1956. 84. Asokavadana. 85. Avasyaka Kathapaka. 86. Avasyaka Curni (2 volumes), Ratlam, 1928. 87. Avasyaka Niryukti Dipika (3 Parts), Surat.

Page #169
Bibliography 88. Uttara Pradesa Mem Bauddha Dharma ka Vikasa by Dr. Nalinaksha Datta, Uttara Pradesa Prakasana Vibhaga, Lucknow, 1956. 89. Upadesamala. 90. Kathasaritsagara by Somadeva, Ed. by H. Brokhaus, Leipzig. 91. Trisastisala kapurusacaritra by Hemacandracarya. 92. Dipavamsa (Ceylonese Chronicle). 93. Dhammapada Atthakatha. 94. Dharma Aura Darsana by Dr. Baladeva Upadhyaya. 149 English and German Books 95. An Advanced History of India by R. C. Majumdar, H. C. Raychaudhuri, K. K. Datta, Pub. by Macmillan Co., London. 96. The Age of Imperial Unity (The History and Culture of Indian People, Vol. II), Pub. by Bharatiya Vidya Bhavan, Bombay, 1960. 97. Ancient Coins and Measures of Ceylon by Rhys Davids. 98. Ancient India by E. J. Rapson, 1962. 99. Ancient Indian Historical Tradition, by Pargiter, Pub. by Motilal Banarsidas, Delhi, 1962. 100. Age of Nandas and Mauryas, Ed. by K. A. Nilkantha Shastri, Pub. by Motilal Banarasidass, Banaras, 1952. 101. Archaeological Survey of Western India by Buhler. 102. Asoka by Vincent A. Smith, Ed. by Sir William Wilson Hunter, Second Edition, (Indian reprint), S. Chand & Co., Delhi, 1959. 103. The Book of Discipline, Vol. I to V, (Vinaya Pitaka) Tr. by I. B. Horner, Luzac & Co., London.

Page #170
150 Mahavira and Buddha 104. The Book of Gradual Sayings Vols. I to V (Anguttara Nikaya) Tr. by F. L. Woodward and E. M. Hare Luzac & Co. London, 1932-36. 105. The Book of Kindred sayings, Vols. I to V (Samyukta Nikaya) Tr. by C.A. F. Rhys Davids and F.L., Woodward, Pab. by Pali Text Society, Luzac & Co., London, 1917-30. 106. Buddha : His Life, His Teachings, His Order (Second Edition) by Manmath Nath Shastri, Pub. by the Society for the Resuscitation of Indian Literature, Calcutta, 1910. 107. Buddhism by T.W. Rhys Davids, London, 1877. 108. Buddhism in Translation by Henry Clarke Warren (Harward Oriental Series, Ed. by Charles Rockwel Lenman, Vol. III), Pub. by Cambridge Mass. Harwad University, 1933. 109. Buddhist India, by Rhys Davids, Pub. by T. Fisher Unwin, London, 1903. 110. Buddhist Suttas, Tr. by T. W. Rhys Davids, Sacred Books of the East, Vol. XI, Oxford. 111. The Cambridge History of India Ed.by E.J. Rapson, Indian Reprint Pub. by S. Chand & Co., Delhi, 1955. (Original, Cambridge University Press, 1921). 112. Chandragupta Maurya and His Times by Dr. Radha Kumud Mukherjee, Pub. by Rajkamal Publications, Bombay, 1952. 113. Chronological Problems by Dr. Shanti Lal Shah, Pub. by the author, Bonn, Germany, 1934. Chronology of Ancient India by Dr. Sita Nath Pradhan. 115. Corpus Inscriptionum Indicarum, Vol. iii, by J. F. Fleet, Calcutta, 1888. 114.

Page #171
Bibliography 116. Der Buddhismus, by Prof. Kern, Pub. by O. Schulge,. Leipzig, 1883. 117. Dhammapada, Ed. by Max Muller, (Sacred Books of the East Series, Vol. X) Oxford, 1881. 151 118. The Dialogues of Buddha (Vols. I to III) (Digha Nikaya) Tr. by T.W. and C.A.F. Rhys Davids, Pali Text Society, Luzac & Co., London, 1899-1921. 119. The Dynasties of the Kali Age by Pargiter, Oxford Univeristy Press, 1913. 120. Dipavamsa Ed. & Tr. by H. Oldenberg, London, 1879 121. Early History of India, by Dr. Vincent A Smith, Oxford, 1924. 122. Epitome of Jainism, by Puran Chandra Nahar and Krishana Chandra Ghosh, Pub. by Gulab Kumari Library, Calcutta, 1919. 123. Encyclopaedia of Religion & Ethics Ed. by Hastings, Edinburgh, 1908-26. 124. Gaina Sutras, Part I, (Acaranga Sutra & Kalpa Sutra) Tr. by Dr. Hermann Jacobi, (Sacred Books of the East Series, Vol. XXII) Oxford, 1884. 125. Gaina Sutras, Part II, (Sutrakritanga Sutra and Uttradhyayana Sutra) Tr. by Dr. Hermann Jacobi (Sacred Books of the East Series, Vol. LV), Oxford, 1894. 126. Hindu Polity by Dr. K.P. Jayaswal, Pub. by the Bangalore Printing and Publishing Co., Bangalore, 1955. 127. Hindus by Ward. 128. History and Doctrines of the Ajivikas by Dr. A. L. Basham, Luzac & Co., London, 1951.

Page #172
152 Mahavira and Buddha 129. History of Ancient India by Dr. Rama Shankar Tripathi. 130. History of Buddhism. 131. Indische Palaeogrophie by Buhler. 132. Jainism in North India (Gujrati Translation) by Chiman Lal Jechand Shah, Longmans Green & Co., London, 1937. 133. The Life of Buddha by E.J. Thomas, London, 1931. 134. The Life of Buddha by W.W. Rockhill, London, 1907. 135. Life of Gaudama by Bigandet. 136. Miscellaneous Essays by C.T. Colebrook, London, 1873. 137. Mahavamsa, Tr. by Geiger, Pub. by the Pali Text Society, London, 1912. 138. Outline of Jainism, by G.L. Jaini, Pub. by Cambridge University Press, 1916. 139. The Political History of Ancient India by Dr. Hemchandra Raychaudhuri, Pub. by University of Calcutta, 1953. 140. The Practical Sanskrit English Dictionary (3 vols.) by Prin. V.S. Apte, Ed. by P. K. Gode & C. G. Curve Pub, by Prasad Prakashan, Poona, 1957. 141. The Religions of India by E. W. Hopkins, Pub. by Grinn & Co., Boston, U.S.A., 1895 (Handbooks on the History of Religions, Vol. I, Ed. by Morris Jestrow). 142. Studies on Manjusrimulakalpa by Dr. K.P. Jayaswal. 143. Sutta Nipata Tr. by V. Fausboll in Sacred Books of the East, Vol. X, part II, Oxford, 1881.

Page #173
Bibliography 153 144. Synchronismes Chinois by Tchang. 145. Vinaya Texts Tr. by Oldenberg and Rhys Davids in the Sacred Books of the East, Vols. XIII, XVIII, XX, Oxford, 1881-85. Journals, Commemoration Volumes, etc. 146. Anekanta (Bi-monthy), Pub. by Vira Seya Mandira, Delhi. 147. Acarya Sri Tulasi Abinandana Grantha, Pub. by Acarya Sri Tulasi Dhavala Samaroha Samiti, Delhi, 1962. 148. Jaina Sahitya Prakasa. 149. Nava Bharat Times (Daily), Delhi. 150. Prabuddha Karnataka (Quarterly). 151. Bhiksu Smrti Grantha, Pub. by Jain Svetambara Terapanthi Mahasabha, Calcutta, 1962. 152. Sramana (Monthly), Banaras. 153. Hindustan (Daily), Delhi. 154. B.C. Law Commemoration Volume. 155. Bharatiya Vidya, Pub. by Bharatiya Vidya Bhavan, Bombay. 156. Indian Antiquary, Bombay. 157. Indian Ephemenis. 158. Journal of Asiatic Society, Baptist Mission Press, Calcutta. 159. Journal of Bihar and Orissa Research Society, Patna, Bihar. . 160. Journal of Royal Asiatic Society, Bengal.

Page #174
154 Mahavira and Buddha 161. Journal of Royal Asiatic Society, Great Britain, Tribner and Co., London. 162. Mahavira Commemoration Volume, Vol. I, 1948-49, Pub. by Mahavira Jaina Society, Agra. 163. 2500 Years of Buddhism, Ed. by P. V. Bapat, The Publications Division, Ministry of Information and Broadcasting, Government of India, May, 1956.

Page #175
INDEX Ancient India 831 Abhaya Kumara 47, 53, 114n Anekanta 135, 135n Abhaya Kundra Sutta 47n Argas 82n, 103n Abhimanyu 109n Anguttara Nikaya Atthakatxa xvi, Acaranga Sintra 3. 3n, 4 xvin, 117, 117n, 141n Acarya Sri Tulsi Abhinandana Anjana 133 Grantha xvii Aniruddha 97n, 98, 99n, 100n, 106, Adhisimakrishna 109n 107n Aganas, Jain xvii, xix, 2, 3n, 1,5,9, Anuvrat Movement xvii 13, 18, 26, 58, 59, 62, 71, 7?, 80, Apabhrainia 130 82, 82n, 9, 115 Apte, Vaman Shivram, Prof. 77n Age of Imperial Unity, The Archaeological Survey of In:lia V, 126n, 132n 103n Age of Nandas and Maryas 97n Arhata 28n Aggrawal, V.S., Dr., 34, 33n, 105n Aryaka 100n Ahimsa Vani 34 Arya Sariskrti Ke Muladhara 9in Ahinsa Viveku xviii Asoka 18, 60, 91, 112, 113n, 120, Ajaka 100n 123ff Ajatasatru (Konika) xxi, 98, 17, 23n, Asoka 131n, 132n 24, 26, 28, 40, 41, 42, 43, 45ff 54, Asokavadana 120, 120n 55, 59, 60, 77, 78, 79, 93, 96, 971, Asoka Ke Dharma Lekha 125n, 127n, 98n, 99, 107ff, 112, 115, 117, 118, 130n 119 Astrology 89 Ajita Kesa Kambali 56, 73, 75, 76. Asvasena 97n 79, 116n Avanti 84, 84n, 96, 97n, 100, 100n, Ajivaka 38, 115, 116n 101, 106n, 107, 110n, 111n, 112n, Alavi 141 121, 122 Alberuni 104n Avantivardhana 100n, 101n, 110n Ambalatthika 27n Avasyaka Curni 13n An Advanced History of India 21n. Avasyaka Katha 18, 29n 33n. 58 84n, 86 377 Avasyaka-Niryukti Dipika 122, 122n Ananda 27n, 52, 55, 56, 64. 65. 68. Aupapatika Sutra 11n, 12n 77, 129 Ayutayusa 111n 155

Page #176
156 Mahavira and Buddha Banerjee, Dr. 101n, 102n Bangaculia 89n Banthia, Shri Kastur Chand 7, 29 Barhadrathas 109n, 110n, 1lln Barnett, L.D., Dr., 132n Basadh 16 Basham, A.L. Dr., 44, 57n Benaras 129 B.C. Law Commemoration Volume 92n Bhadresvara 19 Bhagavana Buddha 35, 93n, 116n Bhagavali Sutra 23, 23n, 38, 38n, 71, 71n, 115 Bhagwan Lal Inderji, Pt., 1,93 Bhagavana Mahavira Aura Mahatna Buddha 35 Bhanakas 28n Bharata Ka Brhat Itihasa 22n, 83n Bharat Ke Pracina Raja Vanisa 83n Bharatiya Itihasa Ki Bhimika 17n Bharatiya Pracina Lipimalu 90n Bharatiya Vidya 7 Bhasma-graha 89 Bhatt, Janardan, 910, 94n, 123n, 127n, 130n Bhiksu Smrti Grantha xvii, 81n Bigandet 133n Bihar xvi, 16, 30 Bimbisara (Srenika) xvi, 23, 24, 43, 47, 48, 93, 98, 98n, 99n, 106, 107n, 112n, 115 Book of Discipline 13n Book of Kindred Sayings 13n, 72n Brahmagiri 125 Brahmavidhvamsanam 89n BIhadratha-dynasty 100n, 109n, 110n Brhadvala 109n Bshaspatimitra 103n Behatkarma 1lln Brliat Kathamanjari 105n Buddha : His Life, His Order, His Teachings in, 117n Buddha-carya xvi, svin, 6n, 28n, 57n, 93n, 116n Budoha Kalina Bharata 91n, 94n Buddha Purva Ka Bharatiya Itihasa 112n Buddhist xvi, xix, In 10, 16, 18, 21. 32, 33, 35, 38, 41, 60, 62, 69, 70, 71, 82n, 92n, 94ff, 112n, 121, 128, 129, 132n Buddhist India 6n, 13n, 95n Buddhisin in Translation 92n Buddhist Suttas 28n Buddhist Tripitakos xvii, xix, 2, 8, 9, Puudalsi 10, 14, 15, 18, 26, 28, 29, 30, 32n, 34, 35, 39, 41, 42, 44, 45, 47, 61, 62, 63, 70, 72, 80, 81, 82, 1041, 113, 115, 116, 118 Buhler, Dr. 92, 103n, 130, 130n, 131, 132 Burma 133 Caitya 129 Calcutta xvii Caliyaparvata 141 Cambridge History of India 99n, 101n, 104n, 108n. 131, 132n Cantonese date 59, 60, 61, 91 Cellana 41 Cetaka 9, 13, 14 Ceylon 95, 114, 132n Ceylonese Chronicle, See Mahavania Champa 12, 60, 71, 93n, 118

Page #177
Chandragupta Maurya 18, 19, 21, 22, 45, 46, 53, 60, 83, 84, 84n, 94n, 96, 103ff, 120 Index Chandragupta Maurya and His Times 83n, 96n. 119n Charpantier, Jarl, Dr. 29, 30, 34, 60, 61, 92 Chronology, Puranic 94ff, 108, 121 Chronology of Ancient India 99n, 112n Council of Buddhists, First 10, 114n Second 6, 114n Third 114n, 129 Council of Jains 5 Colebrooke In Colebrooke's Essays In Corpus Inscriptionum Indicarum 92n Cullavagga 6, 13, 40, 47n Cunda Samanuddesa 64, 65, 66, 68 Cunnigham, Gen. 17n, 92 D Caulukya dynasty 20 Chinese 90, 91, 105n Chinese Turkestan 122, 123 Chronological Problems xvin, 45, 45n, 100n, 101n, 103n, 114n Chronology, Ceyionese 221, 38, 39, Dhavala 86n 55, 59, 60, 93, 91ff, 108 Dialogues of Buddha 77n Chronology, Jaina 32, 33, 84, 91ff, Digha Nikaaya xvin, 2n, 10n, 14n, 39n, 40, 40, 41, 55n 65n, 66n, 77n, 117 108 Digambara xvi, 34, 69, 70n, 86 Dipavamsa 94, 95, 108, 113, 114 Divyavadana 98n Dotted record, see Cantonese date Drdhasena 11ln Dahar Sutta 39n, 72n Darsaka 99n, 100n, 106, 107n, 108 Darsana Digdarsana 17n Darsana Aura Cintana 25n Das, Sarat Chandra 91n Datta, K.K. 21n, 33, 58, 84n Delamaine, Major In Delhi xvii Der Buddhismus 93n Devadatta 13, 47, 48, 49, 50, 51, 52, 133 Devarddhi 5 Devaria 17n Dhammapada 92n, 131n Dhammapada Atthakatha 57n Dharma Aura Darsana 83n Dharmananda Kausambi 35, 70, 93 116n Dharmanetra 11ln 157 Dutt, Dr. Nalinaksa 17 Dynasties of the Kali Age 100n, 112n E Early History of India 91n, 93n, 95n, 104n, 107n, 114n Edicts, Asoka's 123ff Eetzana cra133, 134 Eight sons of Mahapadma 107 Ekarata 105 Encyclopaedia of Religion Ethics 35n Epitome of Jainism 20n Fa-hien 90 Ferguson 92 F and

Page #178
158 Mahavira and Buddha Fleet, Dr., 92, 130, 131 Fausboll, V. 40n, 77n G Hemacandracarya 131, 14n, 19, 20, 27, 58 Hinayana Buddhism 114 Hindi 7, 39 Hindu Civilizction, See. Hindu Sabhyata Hinduis in Hindu Sabliyata 31, 34n, 59n Hindustan Standard xvii Hira Lal Jain, Dr. 83n History of Birdchisi 105n Hiuen Tsang so Hoernle, Dr. 35, 36 Hopkins, E.W.92n Horner, I.B. xix, 13n Gaina Sutras 1, 3n, 5 Gamali, Sce Jamali Gahadhara 69, 81 Gandhian xviii Ganges 16, 17 Gamipitakas xvii Gautama Svami 1, 69 Gaya 53, 1lon, 120 Geiger 92, 92n, 99n, 114n German 7 Girivraja 98n Gode, P.K. 77 Gopalaka 100n, 1010 Gorkhpur 17, 17n Gosala Mankbaliputra xvi, 4, 38, 40, 42, 44, 45, 56, 57, 571, 70, 73, 75, 76, 78, 93, 96, 115, 116, llon Gosh, Krishna Chandra 20 Gujrati 7 Gulabpura High School xix Gunabhadra 87 Gupta era 84, 87ff Guptas 87ff Gupia Samrajya Ka Itihiasa &en, 87n Iksavaku-dynasty 10n Triu an Antiquary Son, 87n, 92n, 93n, 100n, 130n, 13 in Indian Ephemenis 92n Indislie Palacographie 10?n Indrabnuti In, 69, 71 Jacobi Hermann, Dr. xix, 47, 57n, 60. 61, 70, 93 Jains xvi, 3, 4, 6, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 23, 29, 37, 41, 58, 59, 60, 62, 63, 65, 67, 69, 71, 81, 83, 84, 31n, 86, 87, 88, 89, 941f, 100, 121, 122 Jain Agamas Sec Agamas, Jain Jaina bharati 170, 46, 135, 135n juin Philosophy and Modern Science H Hamilton, Dr. In Hare, E.M. xix Hariramsa Purana Sen, 87n Hastin (King) 88 Hastinapura 109n Hastings 36n Hathigumpha inscription 101, 103n xviii Juinu Sahitya Aura luhiasa, 17n Jaina Satya Prakasa 83n Jain Sutras Sce, Agamas, Jain

Page #179
Index 159 Jaina Svetambara Tarapantha Sect Kaniska 45, 46 xviii, xviiin Kapilavastu 4, 128, 141 Jainisin xix Kapur, Yadunandan 131n Ja nisn in North India 103n Karlayle 17n Jaipur xvii Karve, C.G. 77n Jamali 5 71 Kasi 97n Jainbu Kumara (Svami) 24, 24n Katlasaritsugara 12 Japanese 92 Katson 133, 134 Jarasandha 109n Kausambi 109n, 141 Jatinga Rameshwar 125 Kausika Gotra 6 Jayacarya, Shrimat 89 Kautilya 94 Jayaswal K.F., Dr. 32/8, 31, 57n, Kein, Dr. 93 101n 102n, 104n, 105n Kevalin 24, 69 Jetaya1a 129 Khaluya Rohgutta 6 Jina 33, 59 Kharavela 10111 Jinasenacarya 86, 87, 87n Khanda 50 Jina Vijay Ji, Muni 35, 36 Kotan 91, 123 Jivaka Kumar Bhrtya 77, 79 Konika Ss. Ajatasatru Journal of Asiatic Society, 91n Kosala 109n, 110n Journal of Bihar and Orissa Research Krsna 103n, Society 32, 32n, 101n, 102n, 103n, Ksatriyakunda 16 104n, 106 Ksemajit 97n, 98n, 106, 112n Journal of Royal Asiatic Society 91n, K emaka 109.7. 111n 921, 103n Ksemavardhana 97n, 98n, 106 Ksemendra 105n Kulavalaya, monk 18 Kahdali 19, 20 Kumarapala 20, 21 Kakavarna 977, 98n, 1051, 106, 108, Kusinagara (Kusinara) 15, 171, 55, 103n, 112n 129 Kalkiraja 87, 88 Kusthalanagara 93n Kalasoka 107n Kalasoka's sons 107n Kaliaga 101n, 103n, 10+n Kaipa Sutra In, 2n, 3, 30, 5, 17n, 89n Kalugana, Acharya Sri 4n Lassen, Prof. 108n Kalyana Vijay Ji, Muni 37ff, 43, 44, Law, B. C. 92n 47, 571, 70, 71, 85n, 9in, 95n, Liccharis 16, 26 96n, 97n, 99n, 108n Licchuad 16 Kannada 134n Life of Buddha, The 54n, 121 Kamta Prasad Jain, Dr. 34, 35 Life of Gaudama 133n k'

Page #180
160 Malavira and Buddha M N Lumini 128 Makkula Parvata: 117r. ! Lunar dynasty icon Maurya Era 102n, 1030 Mauryas 19, 58, 102n; "H Max Muller 3, 6, 92, 131 Magadha 9, 13, 17, 47, 48, 77, 78, 79, Mehta, Ganga Prasad 1941 83, 96, 97, 98, 99, 100n, 101, Merutunga 33, 59, 83, 85n, 86n, 94 106n, 107, 109n, 110n, 111n Misia & Misra 112n Magadhas 109n Mithila 139, 140 Mahabahu 111n Moggallana 48, 53, 129 Mahabharata War 109, 112n . M recha-Katika 122, 122 , Mahakasyapa 129 Mujjaffarpur 16 Mahanama 95 Mukherjee, Dr, Radha Kumud 11, Mahanandi 98n, 104ff 34, 83n, 96n, 99n, iden, 119n, Mahapadma Nanda 106, 107, 107n 126, 127, 132n Mahaparinirvana Sutta 2n, 14n 26, Munda 97n, 98n, 99, 99n, 100n 27, 28n, 29n, 55n, 70, 113n Mysore 134n Mahasena 121 Maha Sila Kantaka War 9, 18, 23, 28, 115 Nahar, Puran Chandra 20 Mahavagga 116n Nagadasaka 99n, 106, 107n Mahavana 117n Naganika 103n Mahavamsa (Ceylonese Chronicle) Nagrajaji, Muni Shri xvi, xvii 18, 21, 22, 22n, 55, 55n, 59, 91, Nala 141 92n, 93, 9tff, 99n, 107ff, 113ff Nalagiri (The elephar 30 Mahavira Cariyam 86n Nanaghata Inscription 103n Mahavira Commemoration Volume Nala nda 27n, 139, 140 17n, 134n Namotthunam 12 Mahavira Jayanti Smarika xvii Nanda dynasty (Nandas) 96ff, 107n, Mahendra (Son of Asoka) 132n 108n Mahendra Kumara 'Dviteeya' Muni Nandivardhana 98ff xixn Nasika inscription 103n Mahendra Kumaraji 'Prathama' Nathmalji, Muni Shri, iv i Muni Shri xix Nathadvara xviiin Mahinetra Illn, 112n Nava Bharaia Times xvii, xviii Majjhima Nikaya 47n, 63 Nemicandra, Siddhanta Cakravarti Majumdar, R. C., Dr. 2!n, 336, 58, 86, 87 61, 84n Nicaksus 109n Mallas 15, 16, 17, 55, 66, 67 Niggantha Nataputta 39, 39n, 40, 56 Mallinath 29 63, 64, 65, 67, 70, 71, 73, 75, 76, Malva 84n 79, 81, 116n Manusri-Mulakalpa 105n Niramitra 11 in Nasik

Page #181
Index 161 130ff ! O kate of Buddha's 6, 7, 19, Pataliputra 99n, 100n, 106, 107 21. 25, 30, 31, 32, 34, 36, Patna 15, 17, 113n 37, 38, 39n. 43, 45, 46, 59, 60, Pattavali of Sarasvati Gaccha 32 W, 90ff, 107, 119ff, 123, 126, Pava xvi, 5, 15ff, 30n, 63ff, 110 Pavarika 27n Nirvana, Date of Mahavira's 5ff, 7, Pilley, Diwan Bahadur Swami Kannu 19fi, 23n, 25, 30, 32, 33, 34, 36, 92 37, 37n, 43, 45, 46, 58, 60, 61, Political History of Ancient India 83ff, 93, 99, 119, 120, 122n on, 22n, 89n, 93n, 97n, 93n, 114n, Nisitha xvii 101n Prabuddha Karnataka 134n Pracina Bharatavarsa 96n, 104n Oldenberg 47n, 82 Pradhan, Dr. Sita Nath 99n, 112n Pradyota (Canda) 110n, 112n Oza, Gaurisankara 83n, 10n Pradyotas (Pradyota dynasty) 100, 100n, 110n, 111n Prasenjit, (King of Kosala) 72, 75 Padarauna 17n Prasenajit 97n, 98n, 106, 109n, 110n, Pai, Govind 134 112n Pakudha Kaccayana 56, 73, 75, 76, Pravrtivaduka 11 79, 116n Premi, Nathuram 17 Palaka 19, 20, 84n, 96, 100, 1010 Pulaka (Or Sunaka) 100n, 110n Palaka dync: x 100 Punika 110n Pali 40n, 95,, ". Purana. Vayu 94. 97. 98n. 99n. Pandava dynasty 109n 105n, 110, 112n, 121, 121n, 122n Pandey, Dr. Rajbali 17, 17n Matsya 94, 99n, 100n, 105n, Pandey, Prof. Shrinetra 22n, 83n, 84n 110n, 112n, 121 Pandu Vasudeva 114n Bhagvat 94, 121 Panini 104, 104n. 105n Visnu 94, 99n Panini Kalina Bharatavarsa 105n Puranas 94ff, 104n, 105, 108, 109n, Papahura 17n 111n, 112n Pargiter, E.J. 100n, 112n Purana Kassapa 56, 57, 73, 75, 76, Paribbajaka 75, 76 78, 116n Parileyaka 141 Purvas 82n Parisista Parvan 13n, 19, 19n, 20, Puspapura (Patliputra) 105n 24n Pusvamitra 103n Parsva Natha, Lord 3, 97n Paryvanath Ka Caturyama Dharma 70n Rahul Sankrityayan xvi, 6n, 17, 170, Pasadika Sutta 65n 28n, 39n, 40n, 57n, 93, 116n R

Page #182
162 Mahavira and Buddha Rajagrha xvi, 10, 15, 17, 24, 50, 51, 40, 41, 77n, 117, 118 60, 75, 77, 99n, 100, 100n, 106, 117, Samgha Bhedaka Khandhaka 40n 118, 139, 140, 141 Samghe upete 126, 127 Rajanagar xix Samgiti-pariyaya Sutta 66n Ramakola Rly. Station 17n Samyukta Nikaya 13n, 39n, 72n Rampuria Shrichand 13n, 17, 46, 47, Samghabhadra 91 54, 55, 57 Samjaya Belatthiputta 40, 56, 73, 75,Ranjan Suri Deo 17 76, 79, 116n Rapson EJ. 83n, 99n, 101n, 102n, Samskrit 130 101n, 106, 110n Saptaparni Caves 10 Rathamusala war 9, 18, 28, 115 Saranatha 129 Raychaudhuri, H.C. Dr. 6n, 21n, Sariputta 27, 28n, 48, 53, 67, 69, 71, 22n, 33n, 58, 84n, 93, 97n, 98n, 129 99n, 114, 131n Sarvastivadins 90 Religions of India 92n Satakarni 103n Reu, Pt. Visvesvara Nath 98n Sathiyamya Fajilnagara 17n Rhys Davids, Mrs. xix, 13n, 72n Satyajit Illn, 112n Rhys Davids, T.W. xix, 10, 13, 28n, Saubhagya-pancamyadi-parva-katha29n, 55n, 77n, 92, 95, 117n sa:igrha 85n Ripunjaya 100n, 109n, 110n, Ilin, S.B.E. Vol. XXII 3n, 4n, 5n, 14n, 112n 17n Rockhill 121n Vol. X 4n, on, 77n 92n, 131n Rsabhadatta 24 Vol. XI 28n, 29n, 55n, 113n Rsipattana 99n, 129 Vol. XVII 40n Rummindei 127, 129 Vol. XVIII 47n Rupanatha 124, 129 Vol. XIII 92n Vol. XL V 3n, 5n, on S Schism in Jain Church 5, 6, 70n, 71 Scriptures, Buddhist, See Buddhist Sabhiya 75, 76 Tripitakas Sabhiya Sutta 40n, 77n Jain, See Agamas, Jain Senait Sahadeva 109n 111n Sahasarama 124 Shah, T.L., Dr. 96n, 97n. 98n Saisunaga Nandivardhana 111n Shah, Shanti Lal Dr. 45, 46, 100n, Sakaraja 33, 59, 87, 88 101n, 102n 106ff, 114 Saka era 80ff, 84 Sharma, Shambhu Lal xviii Sakyas 63, 65, 128, 133 Shastri, Majumdar 101n Samagama 33, 63, 64, 68, Shastri, Manmath Nath In, 117n Samagama Sutta 32, 33, 37, 63n Shastri, Nilkantha 97n Samannyafala Sutta xvi, 10n, 11, 39n, Shih Huang Ti (Chin) 91, 123

Page #183
Index 163 Siddhanta 5 Siddhapur 125 Sisunaga 97, 97n, 9EURn, 99, 100n, 107ff, 1120 Sisunaga-dynasty Saisunagas) 96ff, 110 Smith, Dr. Vincent A. 91n, 93, 95n, 103n, 10in, 105n, 107n, 103n, 113, 127n, 129, 131n Sohan Lal Gandhi xix Somadeva 105n Somadhi 109n, 110n, 111n Sons of Mahapadma Nanda 107n Sramana 66, 75, 76, 77, 78 Sramana (magazine) 7, 9n, 15n, 17n, 210 Sravaka 12 Sravasti (Savatthi) xvi 71, 72, 109n, 129, 141 Srenika, See Bimbisara Srutanjaya Illn Srutasrva llin Studies ori Manjusrimulakalpa 105n Stupa 10, 29 Subhadda 55, 56, 57 Sucala liin, 112n Suci 111n Sudharma In, 13, 24, 69 Sukh Lal Ji, Pandit 25ff Suksetra Illn Sumitra 109n Sumsummara Giri 141 Sunaka 100n, 110n Sunetra 111n, 11an Sutrakrtarga Sutra 3, 3n, 82n Sutta Nipata 40n, 77n Suvrata liin Svapnavasavadatta 99n, 122n Svetambaras xvi, 69, 70n, 86 Synchronismes Chinois 910 Tagoo 134 Tamsuliya 1010 Tapagaccha Pattavali 85n Taranatha 104n Tchang 91n Tejolesya 38, 70 Terapantha, 4n, 89 Thomas, E.J. 54n, 92 Thomas, F.W. 131n Tibet 121 Tibetan Tradition 104, 112n, 121n Tiloyapannati 86n Tiratharkara in, 3, 4, 12n, 33, 57, 59, 60, 97n, 1160 Tirtharikara Mahavira 43n 139n Titthodhara Prakarana 83 Tithogali Painnaya 19n, 20, 83, 86n, 94, 122n Tosala 101n Trairasika Matam 6 Trilokasara 86n, 87n Tripathi, Rama Shankar, Dr. 1019 Tripitakas, Buddhist, See Buddhist Tripitakas Trisastisalakapurusacaritra 14n, 20, 20n Tryastrimsa 141 Tsang, Hieun 105n Tukaram Krishna Laddu 93 Turkestan 91 Udayi 97n, 98n, 99, 99n, 100, 106, 107n Udayana 108n, 109n, 110n Ujjain 19 Upadesamala 14n Upadhyaya, Baladeva 83n, 94n, 95n

Page #184
164 Mahavira and Buddha Upadhaya, Dharmasagara 85n Upadhyaya, Vasudeva, Dr. 86, 87ff Upagupta 128 Upaka 116n Uitaradhyayana Sutra 3, 3n Uttarn Pradesa Mem Bauddha Dharina Ka Vikasa 17n Uttara Purana 14n, 87 Uttarasarga 12 Vicara Sreni 33n, 83, 86n, 94 Vidyunmali 24 Vijaya 119n Vijayendra Suri, Acharya 17, 170, 43, 44, 139n Vikrmaditya 32, 33 Vikrama era 32, 33, 59, 81ff, 89, 140n Vinaya Fitaka xvii, 13n, 47n, 92n Vira Nirvana Sainvat Aura Jaina Kalaganana 36n, 37ff, 89, 90, 93n, 9in, 95n, 96n, 97n, 99n Visakhayupa 101n Visvajit Illn, 112 Vitihotras 100n, 110n Vividha Tirtha Kalpa 85n Vivsti 111n Vulture's Peak 99 V Vaidehi 78 Vairanja 141 Vairata 124 Vaisali 4, 6, 9, 13, 14, 18, 28, 29, 52, 117n, 139, 140, 141 Vaisali 17n Vajjis 9, 14, 26, 29, 52, 115 Vakkula 129 Vallabhi, Council of 5 Vanijyagrama 139 Vartivardhana 1010 Vassakara 9, 26, 28, 28n, 29 Vasudeva Sharan Aggraval Dr. See Aggrawal V.S. Vatsa 110n Venuvana 75 W Ward In Wheeler 92 Woodward F.L. xix Z Zodiac 89

Page #185
Scholars' Views 165 Scholars' Views On The Present Work It is well-known that there is plenty of disparate evidence and conflicting traditional information as well as a plethora of controversy amongst scholars about the dates of the Nirvana of Buddha and Mahavira. Shri Nagarajji has surveyed, in this respect, all the accessible material and different traditions specifying duly the sources etc., and his conclusion that Mahavira attained Nirvana in 527 B.C., and Buddha in 502 B.C. seems to be quite consistent in itself. Dr. A.N. UPADHYE, M.A., D.LITT. Dean of the Faculty of Arts University of Kolhapur The work is full of deep scholarship, penetrating criticism and originality. It essays tackling problems which have not received due attention so far, and in my opinion, constitutes a most welcome contribution to the world of scholarship. Prof. Dr. G.C. PANDE, M.A., D.PHIL. Head of the Deptt. of History and Indian Culture University of Rajasthan

Page #186
166 Makavira and Buddha Muni Shri Nagrajji has made an extremely reflective study of the subject in this work. On the basis of his research-work, he has found out that (1) Mahavira was senior to Buddha ; (2) Mahavira predeceased Buddha ; (3) Mahavira had earned much fame and veneration on account of his religious leadership and erudition long before the enlightenment of Buddha. The learned author has established that Buddha attained the Nirvana in 502 B.C., while Mahavira in 527 B.C. It should be noted that due to the lack of purely Indian sources, it is very difficult to decide the exact date of Buddha's death. On the one hand, the Ceylonese Chronicle Mahavamsa puts the event in 544 B.C., while on the other hand, by putting the event 218 years before the consecration of Asoka, 487 B.C. is also accepted as the date of Buddha's Nirvana. 527 B. C. is generally accepted to be the date of Mahavira's Nirvana. Nevertheless, some scholars have put forward some arguments against this date. But all of them are adroitly refuted by the author. The author has critically discussed the views of Indian as well as foreign scholars such as Dr. Jacobi, Dr. Charpentier, Dr. Jayaswal, Dr. Shanti Lal Shah, Pt. Sukh Lalji, Muni Kalyna Vijayaji, Shri Vijayendra Suti and several other prominent historians. Such a contemplative and unbiased discussion of the problem of the contemporaneity and chronology of Mahavira and Buddha is not found anywhere else. Dr. DASHRATH SHARMA, M.A., Ph. D. Reader, Department of History University of Delhi

Page #187
Scholars' Views 167 I am very much impressed by the discussion of the subject which has been made so profoundly by Muni Shri Nagrajji in his work. In my view, its English translation is necessary, for it will provide the non-Hindi speaking people with the opportunity of knowing the controversy which is existing regarding this problem and also the correct solution thereof. Dr. B. CH. CHHABRA, M.A., M.O.L., Ph.D. (England) F.A.S.I. Jt. Director-General of Archaeology in India Many a scholar of India as well as abroad have tackled the controversial problem of the contemporaneity and chronology of Mahavira and Buddha. Muni Shri Nagrajji has unbiasedly and critically examined all these views and also he has presented a new solution, which, in my view, is quite unimpeachable. The historical evidences, supplied by the author from the two-and-a-half millenium old remnants of the dark age, are so solid that their validity would not be easily challenged by scholars in the future. Author's researchful efforts, talent governed by austerities, and constant hard work are clearly manifested in this valuable discovery. The effort to discover the missing links of the Jain History constitutes, in fact, sadhana, a way of achieving the ultimate aim, for it requires the whole life-each and every moment of life. I consider it as good as the sadhana of achieving the blissful state. DR. PREM SAGAR JAIN, M.A., Ph. D. Professor of Digamber Jain College, Baraut (U.P.) & Editor, Anekanta (A Bimonthly Research Journal)

Page #188