SearchBrowseAboutContactDonate
Page Preview
Page 35
Loading...
Download File
Download File
Page Text
________________ reason for mokşa, but without right understanding, it is not possible to walk on a path of right conduct. We need to adhere the sequence for attaining liberation (samyak-darsana, samyakjñāna and samyak-căritra) as conduct is of no use without right faith and right knowledge. Samyak-darśana and samyak-jñāna makes the cãritra as samyak (true or balanced). It is well understood that Persons who lack right belief bog down with considerations of purity and impurity while the person of right belief is convinced about the purity of both the cause and the effect. The contemplation of the eternal nature of the soul is the cause and realization of the pure soul (samyak-darsana) is the effect. The sickness of mundane existence can be cured only if one takes the medicine of right faith prescribed by arihanta. This is the first step towards dharma and will certainly lead to last stage of mokṣa sooner or later. To conclude, we have observed that according to Jainism the main cause of bondage is perversity of attitude. The right faith, therefore, occupies the most important position. References Jain, Jayanti Lal. "Samyak Darshan: The First step towards Dharma". Jain eLibrary. Web. 19 July 2018. <http://www.jainlibrary.org/elib_master/article/250000_article_english/Samyak Darshan First Step Towa rds Dharma_269167_std.pdf>. "Samyagdarsanajanacáritrānimokşamārgah" Tattvärtha Sūtra 1/1. "Tattvārthasraddhānarsamyagdarsnam" Ibid 1/2. Jain, Jayanti Lal, op. cit. 2018. Jīvājīvāyabandhoyapunnampāvāsavotahā/ Sarvaronijjarāmokkhosantaetahivānava// Tahivānamtubhāvānarsabbhāveuvaesanam/ Bhāvenarsaddahartajsasammattamtamvivāhiyam// Uttarādhyayana Sūtra 28/14-15. Chahadavvanavapayatthāpañcatthisattataccanidditthā/ Saddahaitānantīvam so saddithīmuneyavvo/ Darsanapāhuda 19. Hinsārahiedhammeatthārahadosavajjiedeve Nigganthepavvayanesaddahaņam hoi sammattaṁ// Mokşapāhuda 90. Attāgamataccānarsaddahanādohaveisammattan/ Vavagaraasesadososayalagunappă have attol Niyamasāra 1/5. Sraddhānamparamürthānāmāptāgamatapobhrtām Trimüdhāpodhamastāngarsamyagdarśanamasmyam/ Ratnakaranda Srävakācāra 4. Ibid, 11-18. Ye paryāyesuniratāstehyanyasamayasthitäh/ Ātmasvabhāvanisthām, dhruvāsvasamayasthitih // Adhyātmopanişad 2/ 26. "Sraddhārllabhatejñānam" Bhagavad Gitā 4/39. Idaritunavapadārthavişayabhūtai vyavahārasamyaktvam/ kimvisistan/ śuddhajīvāstikāyarucirūpasyaniscayasamyaktvasyachadmasthāvasthāyāmātmavisayasvasamvedanajñānasy aparamparavābijam//Tātparyavrtti (commentary by Acārya Jayasena on Pancāstikāya) 107. Jaramrānikamman, khaveibahuvahir vasakodihin Tamnānītihimgutto, khave iusāsametena//Brhat Kalpasūtra 1/1170. Kofijanma tapa tapai, jānabina karma jhara im je Jñānikem china mem, triguptiteņsahajataraimtel Munivratadharianantabāragraivakaupajāyau/ Painijaātamajānabinā, sukhaleśanapāvau//Chaha Dhālā 4/5. Sakalajagatateemthavata, athavasvapnasamāna/ Tekahiyejñānidašābākivācājñāna // Ātmasiddhi Sastra 140. Māyāmaricigandharvanagarasvapnasannibhän/ Bāhyānpaśyatitativenbhāvānśrutavivekatah// Yogadrsti Samuccaya 154. Niśāmayatinissesamindrajalopamamjagat/ 28 ISJS-Transactions, Vol.2, No.3, Jul-Sep, 2018
SR No.034362
Book TitleISJS Transactions 2018 07 To 09 Vol 02 No 03
Original Sutra AuthorN/A
AuthorInternational School for Jain Studies
PublisherInternational School for Jain Studies
Publication Year2018
Total Pages60
LanguageEnglish
ClassificationBook_English
File Size28 MB
JainGPT.orgInstagram
Copyright © Jain Education International. All rights reserved. | Privacy Policy