Book Title: Jain Journal 2000 10
Author(s): Jain Bhawan Publication
Publisher: Jain Bhawan Publication
Catalog link: https://jainqq.org/explore/520140/1

JAIN EDUCATION INTERNATIONAL FOR PRIVATE AND PERSONAL USE ONLY
Page #1 -------------------------------------------------------------------------- ________________ VOL. XXXV No. 2, OCTOBER // jaina bhavana // JAIN BHAWAN ISSN 0021-4043 JAIN Journal A QUARTERLY JAINOLOGY ON 2000 PUBLICATION Page #2 -------------------------------------------------------------------------- ________________ a quarterly on Jainology JAIN JOURNAL || jaina bhavana || JAIN BHAWAN CALCUTTA Page #3 -------------------------------------------------------------------------- ________________ Vol. XXXV No. 2 October 2009 Rupees Fifteen Copyright of articles, stories, poems, etc. published in the Jain Journal is reserved. All contributions, which must be type-written, and correspondence regarding contributions, and book-reviews should be addressed to the Editor, Jain Journal, P-25 Kalakar Street, Calcutta-700 007 For advertisement and subscription please write to the Secretary, Jain Bhawan, P-25 Kalakar Street, Calcutta-700 007. Subscription : for one year : Rs. 60.00, US $ 20.00 : for three years : Rs. 180.00, US $ 60.00, Life membership : India : Rs 2000.00, Foreign : US $ 160.00, Cheques must be drawn in favour of only Jain Bhawan Phone No: 238 2655 Published by Satya Ranjan Banerjee on behalf of Jain Bhawan from P-25 Kalakar Street, Calcutta-700 007 and printed by him at Arunima Printing Works, 81 Simla Street, Calcutta-700 006 Editor : Satya Ranjan Banerjee ernational www.jaineli Page #4 -------------------------------------------------------------------------- ________________ Contents Some Special Aspects of Jaina Philosophy as a School of India Philosophy Arvind Sharma The Bibliography of the Svetambara Canon Royce Wiles Book Review : Nirgrantha (Vols. I and II) by Satya Ranjan Banerjee Anuyogadrara-sutra (Part I) by Satya Ranjan Banerjee Mahabandha (Vols. I and II) by Satya Ranjan Banerjee Studies in Jainism by Satya Ranjan Banerjee Jaina Theory of Multiple Facets of Reality and Truth of Nagin J. Shah. by Ramkrishna Bhattacharya News on Jainism around the World 91 rsonal Use Only Page #5 -------------------------------------------------------------------------- ________________ Page #6 -------------------------------------------------------------------------- ________________ JAIN JOURNAL Vol. XXXV No. 2 October 2000 SOME SPECIAL ASPECTS OF JAIN PHILOSOPHY AS A SCHOOL OF INDIAN PHILOSOPHY ARVIND SHARMA As a school of Indian philosophy, Jain philosophy exhibits several striking features which distinguish it out from other schools of Indian thought. Some of these, such as, its materialistic notion of Karma, its concept of time and space, its doctrine of epistemological relativity and its emphasis on Ahimsa5 and nudity are fairly well-known. The purpose of this note is to draw attention to what appear to be somewhat less known unique aspects of Jain thought, to which leading scholars have drawn attention. II (1) According to Prof. M. Hiriyanna it is in its conception of jiva that Jainism displays some distinct aspects. One of the curious features of Jainism is the belief in the variable size of the jiva in its empirical condition. It is capable of expansion and contraction according to the dimensions 2. See Kalidas Bhattacharyya, ed., The Cultural Heritage of India Vol. I (Calcutta : The Ramakrishna Mission Institute of Culture, 1958) p. 542 . P.T. Raju, The Philosophical Traditions of India (University of Pittsburgh Press, 1972) p. 102. Ibid. AL. Basham, The Wonder That was India (Fontana : Collins, 1975) p. 504: S.N. Dasgupta, A History of Indian Philosophy Vol. I (Cambridge University Press, 1957) p. 175 ff. R.C. Zaehner, ed., The Concise Encyclopedia of Living Faiths (Boston : Beacon Press, 1967) p. 264. R.C. Zachner, ed., op. cit., p. 262. 5. 6. Page #7 -------------------------------------------------------------------------- ________________ 50 7. (2) According to S. Gopalan it is the Jain doctrine of Kevalajnana which is unique to Jainism. "It is unique because in all other schools of Indian philosophy the sense organs and the mind are not considered as obstruction in the sense in which Jainism holds them to be obstacles for perfect perfection" so that "The Kevala-jnana concept, from the point of view of Indian epistemology stands unique in that it is referred to as the consummation of all knowledge through the progressive removal of the obstructions caused by the sense organs and the mind."9 8. JAIN JOURNAL: Vol-XXXV, No. 2 October 2000 of the physical body with which it is associated for the time being. In this respect it resembles a lamp, it is said, which though remaining the same illumines the whole of the space enclosed in a small or big room in which it happens to be placed. It means that like its other features, the jiva's nonspatial character also is affected by association with matter. The Jaina thus denies the unalterable nature of the jiva which is commonly recognised by Indian thinkers. (3) Prof. P.T. Raju, among other things, draws attention to a distinct feature of Jain metaphysics when he writes: 9. The jiva's relation to matter explains also the somewhat peculiar Jaina view of knowledge. Knowledge is not something that characterizes the jiva. It constitutes its very essence. The jiva can therefore know unaided everything directly and exactly as it is; only there should be no impediment in its way. External conditions, such as the organ of sight and the presence of light, are useful only indirectly and jnana results automatically when the obstacics are removed through their aid. That the knowledge which a jiva actually has is fragmentary is due to the obscuration caused by karma which interferes with its power of perception. As some schools assume a principle of avidya to explain empirical thought, the Jains invoke the help of karma to do so.7 The Jaina philosophy, it has already been said, is realistic and pluralistic. There is a plurality of objects and jivas (atmans) and all of them are real, and the objects of our knowledge also are real, but are not mere ideas. But the Jaina metaphysics is a metaphysics of substance. Everything, including action, is a substance. One may find the idea of action being a substance to be very strange, but it is found M. Hiriyanna, Outlines of Indian Philosophy (London: George Allen & Unwin Ltd., 1932) p. 158. S. Gopalan, Outlines of Jainism (New York: Halsted Press, 1973) p. 72. Ibid. Page #8 -------------------------------------------------------------------------- ________________ SHARMA: SOME SPECIAL ASPECTS OF JAIN PHILOSOPHY in the modern theory that the stuff of the universe is only process. The Jainas conceive any existence as a substance. Action exists and is, therefore, a substance. 10 (4) Satischandra Chatterjee and Dhirendramohan Datta draw attention to an aspect of the view of causation which seems to belong distinctly to the Jains. Regarding all the four substances-space, time, dharma and adharma-it should be noted that as causal conditions they all have a peculiar status. The causal conditions (karanas) may be distinguished into three chief kinds, agent (as potter is of the pot), instrument (as the potter's wheel is of the pot) and material (as clay is of the pot). Space, time, etc., come under the category of instrumental conditions, but they should be distinguished from ordinary conditions of that kind, being more indirect and passive than ordinary instrumental conditions. Gunaratna gives them, therefore, a special name, apeksakarana. The stone on which the potter's wheel rests may be cited as a condition of this kind in relation to the pot. Space, time, etc., are similar conditions. 11 (5) According to A.L. Basham, it is in the classification of onesensed beings, who possess only the sense of touch that the Jain classification shows its most original feature. This great class is in turn divided into five sub-classes : vegetable bodies, which may be simple, as a tree, containing only one soul, or complex, as a turnip, which contains countless souls; earth-bodies, which include earth itself and all things derived from the earth, such as stones, clay, minerals and jewels; water-bodies, found in all forms of water-in rivers, ponds, seas, and rain; fire-bodies, in all lights and flames, including lightning; and wind-bodies, in all sorts of gases and winds.12 (6) According to Hermann Jacobi, "That plants possess souls is an opinion shared by other Indian philosophers." But the Jains have developed this theory in a remarkable way. Plants in which only one soul is embodied are always gross; they exist in the habitable part of the world only. But those plants of which each is a colony of plant-lives may 10. P.T. Raju, Op.cit., p. 101. 11. Satischandra Chatterjee and Dhirendramohan Datta, An Introduction to Indian Philosophy (University of Calcutta, 1968) pp. 99-100. 12. Wm. Theodore de Bary, ed., Sources of Indian Tradition, Vol. I (New York: Columbia University Press, 1958) pp. 46-47. Page #9 -------------------------------------------------------------------------- ________________ JAIN JOURNAL : Vol-XXXV, No. 2 October 2000 also be subtle, i.e. invisible, and in that case, they are distributed all over the world. These subtle plants are called nigoda; they are composed of an infinite number of souls forming a very small cluster, have respiration and nutrition in common, and experience the most exquisite pains. Innumerable nigodas form a globule, and with them, the whole space of the world is closely packed, like a box filled with powder. The nigodas furnish the supply of souls in place of those who have reached nirvana. But an infinitesimally small fraction of one single nigoda has sufficed to replace the vacancy caused in the world by the nirvana of all the souls that have been liberated from the beginningless past down to the present. Thus it is evident that the samsara will never be empty of living beings.13 (7) Ninian Smart seems to detect in the Jain doctrine that the nigoda is not subject to Karma, a distinct feature of Jain thought. He writes: Even lower than these are infinite number of animalcules, which do not individually possess organs, but cluster together to share in processes of respiration and nutrition. The law of karma and circulation of life-monads through successive bodies, through process of rebirth, are features of existence of living beings above level of animalcules. Infrequently, lifemonads achieve liberation and are taken out of circulation; but from time to time some animalcules 'rise' and enter karmic circulation. This, then, is the back-cloth, teeming with life, against which quest for liberation is undertaken.14 III The above survey reveals that a different unique aspect of Jain thought is identified by different scholars once they get past its major distinguishing features as a school of Indian thought. This seems to suggest that the unique significance of Jain thought in the context of Indian Philosophy has not yet been sully realized. 13. James Hastings, ed., The Encyclopedia of Religion and Ethics VII (New York : Charles Scribner's Sons p. 469. 14. S.G.F. Brandon, ed.. A Dictionary of Comparative Religion (London : Weidenfeld & Nicolson, 1971) p. 367. This point, however, is by no means certain. Page #10 -------------------------------------------------------------------------- ________________ THE BIBLIOGRAPHY OF THE SVETAMBARA CANON* 2 0.1 COMPLETE EDITIONS 1 1. The edition sponsored by Raya Dhanapatisimha 1874-<1900>* *Acaranga sutra: Ganadhara Sudharma-svami-krta-mula sutra tadupari Sri-Hamsasuri-krta-Dipika-tika SriSilangacarya-krta-Acaranga-tika evam Sri-BhagavanPayacandaji-krta- [Gujarati bhasa/ Sri-BhagavanVijayasadhuna samsodhitam. Kalakatta: Nutana-Samskrta Press 1936 [1879]. [1], 437, 283 p.; 26 x 31 cm. (Sriyukta Raya Dhanapatisimha Bahadura ka Agama-Sangraha; 1) [CLIO 1, 21; Schubring 1935, SS 45.1; Univ. of Chicago Library catalogue] 3 * 1. 2. ROYEE WILES 0 THE "CANON" AS A WHOLE1 *Srisuyagadanga-sutra: dvitiyangam, tika tatha Balavabodha sahitam / Bhimasimha Manekakhya sravakem pritipurvaka prasiddha kodhum. Mumbapuri: Nirnayasagara Mudrayantra, samvat 1936. 1880. 28 1020 p.; 28 cm. (Raya Dhanapatisimha Bahadura ka Jainagamasangraha; 2. = Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha; 2). [Winternitz 1933: 2, 438 nl; Schubring 1935, SS 45.2; Univ. of Chicago Library catalogue] Sthananga sutra: trtiyanga: Ganadhara Sudharma Svami sankalita sutra tadupari Srimadabhayadeva Suri krta Samskrta tika aura Megharaja krta bhasa tika yuta/ Brhannagiru Launkagacchiya vacanacarya Srirama This bibliography is a draft version of the author. It is printed here for the benefit of the scholars. This section is largely to provide a bibliographic overview of the more comprehensive published editions of canonical texts. Full details for individual text editions are given in the appropriate sections of the bibliography. According to the publication details I have been able to trace so far the edition seems not to have been completed, i.e. I have yet to tracc publication details for volumes 17. 18. 34. 35. 32 40. 42. Page #11 -------------------------------------------------------------------------- ________________ 54 4 5 6 7 8 9 JAIN JOURNAL: Vol-XXXV, No. 2 October 2000 candragani sisya Rsi Nanakacanda se samsodhita hoke mudrita huva. Vanarasa: Jaina Prabhakara Jatau, samvat 1937. Isavi san 1880. 8, [4], 596 p. 11 x 30 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha; 3). *Atha tikavarttikasamvalitam Samavayanga: caturthangasutram prarambhyate. Banarasa: Jaina Prabhakara, 1880. 254 [ie 508] p.; 12x30 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha; 4). [Emeneau SS 3920; BORI Cat. 17:1, 71; Univ. of Chicago Library catalogue; Josi 1987, 61] *Atha Bhagavati-sutra-pancamamga-prarambha: Launkagacchiya-Sri-Rama-candra-Gani-krta-Samskrtanuvada-yuta / Ganadhara-Sudharma-Svami-sankalita sutra tadupari Srimad-Abhayadeva-Suri-krta Samskrta-tika aura Megharaja-Gani-krta [Gujarati]-bhasa-tika-yuta. Benares : s.n., samvat 1938 [1881]. 4 v.; 16 x 31 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha; 5). [CLIO 1, 379; Univ. of Chicago Library catalogue] *Jnatadharmmakathanga-sutra: sasthama anga / Ganadharasudharmasvamikrtamulasutra tad upari Srimadabhayadevacaryya Surikrta tika; Vijayasadhuna samsodhitam. Kalikata : Nutana Samskrta Yantra, samvatsare 1933 [1876]. [3], 1530p.; 11 x 25 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha; 6). [CLIO 2, 1190; Emeneau SS 3922. Roth 1983, 9-10; Univ. of Chicago Library catalogue] *Upasakadasasutra: saptama anga / Ganadharasudharmasvamikrtamula sutra tadupari Srimadabhayadevacarya Surikrtatika; Sri Bhagavan Vijayakrta [Gujarati] bhasa samsodhita. Calcutta: s.n., 1933 [1876]. [3], 4, 233 p.; 11 x 25 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha; 7). [Emeneau 3924; CLIO 4, 2818; Univ. of Chicago Library catalogue] *Sriantagadadasanam Tavva bhasya sahita prarambhithai. Calcutta Satya Press. [1], 82, [1], p.; 11 x 27 cm. [Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha; 8]. ["Volume contains no series statement." Univ. of Chicago Library catalogue.] [CLIO 1, 133] *Sri Anuttarovavaiyadasanam [Gujarati] Tavva sahita prarambhi thai. Calcutta: Satya Press, samvat 1931 [1874]. [1], 18, [1] p.; 11 x 27 cm. [Sriyuta Raya Dhanapatisimha Page #12 -------------------------------------------------------------------------- ________________ WILES: THE BIBLIOGRAPHY OF THE SVETAMBARA CANON 10 12 Bahadura ka Agamasangraha; 9). CLIO 1, 133. Schubring 1944, 13: "Volume contains no series statement." Univ. of Chicago Library catalogue] *Prasnavyakaranakasutra : dasama anga / Ganadharasudharmasvamikrtasutra tadupari Srimadabhayadevacaryya Surikrta tika; Sribhagavan Vijayakrta (Gujarati] bhasa samsodhita. Calcutta : Nutanasamskrtayantre, 1933 (1876). [4], 542 p.; 11 x 25 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha; 10). (CLIO 3, 1957; Schubring 1944, 14; JRK 274; JSBI 1, 247; Univ. of Chicago Library catalogue) *Vipakasutra / Ganadhara Sudharmasvamikrtamulasutra, tadupari Srimadabhaya-devacaryya Surikstatika; Vijayakrtabhasa samsodhita. Kalikata : Nutanasamskrtayantra, samvat 1933 (1876). 279 p.; 11 x 26 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha; 11). (Emeneau 3930; Univ. of Chicago Library catalogue] Sri Ubabaisutra : prathama upanga / Ganadhara Sri Sudharmma Svami krta mulasutra, tadupari Saratharagache Sri Abhayadeva Suri krta tika : tadupari Lupaka-gache Sri Amrtacandra Suri krta Bala(va]bodha; Sri Satyavrate ke dvara samsodhita hokara. Calcutta : Sri Satyavrata, samvat 1936 (1879). [2], 164 [ie. 4. 364) p.; 12 x 31 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha; 12). (Schubring 1935 $ 47; CLIO 1, 238; Univ. of Chicago Library catalogue] *Raya paseni ji sutra : dusara Upanga / Ganadhara Srisudharmmasvamikrta mulasutra, tadupari Malayagiri Acaryya krtatika, tadpari Megharajajikrta Valabodha. Kalakatta : Sri Yasodananda Sarkara ke Chapekhana, 1879. 296 p.; 26 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha; 13). [BORI Cat. 17:1, 174-75; Schubring 1944, 16; Univ. of Chicago Library catalogue] *Atha-Sthananga-namnas trtiyangayopangam Jivabhigamanama sutram / Sri Malayagiri-Suri-krta-vrtti-sahitam Gurjara-bhasa-yuktam ca prarabhyate. Ahmedabad: Times Press, 1883.2 v.; 13 x 32 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha; 14). (CLIO 2, 1168; Univ. of Chicago Library catalogue) *Pannavana-sutra: caturthopanga (Gujarati anuvada sameta] prarambha / Lonka-gacchiya Sri Ramacandra Gani krta 13 14 15 Page #13 -------------------------------------------------------------------------- ________________ 56 16 17-18 19-23 36 JAIN JOURNAL: Vol-XXXV, No. 2 October 2000 Samskrtanuvada yuta; Nanakacandaji se samsodhita hoke mudrita hua; Kalikacarya sarkalitasutra, tadupari Malayagiri Suri krta Samskrta tika aura Paramanandarsi krta bhasa tika yuta. Benares: s.n., 1884. 3 v.; 16 x 30 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha: 15) [CLIO 3, 1932; Univ. of Chicago Library catalogue] 41 *Sri Jambudvipa prajnapti sutra prarambhah / Ganadhara Sudharma Svami sankalita sutra, tadupari Sri Santicandragani krta Samskrta tika, Sri Ramacandra Gani krta Samskrtanuvada yuta. Rsi Amolakhacand se samsodhita. Banaras: Jaina Prabhakar Press, Amolakhcand Jati, 1890. 698 p.; 16 x 31 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha; 16). [Univ. of Chicago Library catalogue] [Sura P and Canda P. apparently never published (see Jain, Banarsi Das Ardha Magadhi Reader. Lahore, 1923, liv)] 24-33 *Atha Dasapayanna mula sutra prarambhah / Ganadhara Sudharma Svami sankalita mula sutra; Tandulavayali 24, Devinddastava 25, Ganivijja 26, Causarana 27, Santhara 28, Aurapaccarakana 29, Bhattaparijnana 30, Candravijja 31, Mahapaccarakana 32, Maranavibhatti 33; Pratapaji karake samsodhita [sic]. Banarasa : Jaina Prabhakara Presa. Samvat 1942. [Isavi] 1886. 73 [i.e. 146] p.; 13 x 32 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 24-33). [Univ. of Chicago Library catalogue] Nirayavaliya sutra prarambhah: bhaga 19 Kappiya. 20 Kappavidamsiyaa 21 Pupphiya, 22 Pupphacula, 23 Banhidasa / Sri Ganadhara Sudharma Svami sankalita sutra, tadupari Candra Suri krta Samskrta tika; Sadaranga krta bhasa tika yuta; Pandita Visvanatha ji se samsodhita. 1. daphe. Banarasa : Jaina Prabhakara Presa, samvat 1941. San 1885 Isavi. 85 [ie. 170] p.; 13 x 31 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha; 19-23). *Kalpasutrah: trtiya chedasutrantargata dasasrutaskandhasya astamadhyayanam / Srimad-bhadrabahusvami viracitam. Kalikata : Sriraya Dhanapatisimha Bahadura, 1894. 148 p.; 10 x 30 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 36). [Univ. of Chicago Library catalogue] *Uttaradhyayana: sampumatam agamat / Bhagavanavijayasadhuna samsodhitam. Calcutta: [Government Press ?], Page #14 -------------------------------------------------------------------------- ________________ WILES: THE BIBLIOGRAPHY OF THE SVETAMBARA CANON 57 43 44 saivat 1936 (1879). (1), 1109 p.; 13 x 31 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 41). (CLIO 2, 2827; Emeneau 8 3959; JRK 42; (Univ. of Chicago Library catalogue *Dasavaikalika-sutra / Sri Sayyambhavodgararupam; Gurjarabhasasahitam-avacurisamvalitam, Samayasundaropadhyayakrta Dipikasanatham, Sriharibhadrasuri krta Brhadvrtti virajitam. Mumbapuri : Nirnayasagara, samvat 1957 (1900). 722p. ; 27 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha 43). (Univ. of Chicago Library catalogue] *Anuyogadvarasutra / Ganadhara Sudharma Svami krta mulasutra tadupari Sri Hemacandra Suri krta tika: tadupari bhasatikasameta; Srimohanamunina samsodhitam. Kalikata: Nutana Samskrtayantra, 1935 (1878). (1), 660 p.; 13 x 31 cm. (Sriyuta Raya Dhanapatisimha Bahadura ka Agamasangraha; 44). (CLIO 1, 134; Univ. of Chicago Library catalogue] *Nandi-sutra / Ganadhara-Sudharmmasvami-krta-mulasutra tadupari Sri-Malayagiri-krta-tika, tadupari bhasa Valavodhasa mela; Sribhagavan Vijayasadhuna samsodhitam. Kalikata : Nutanasanskrta Yantra, samvat 1935 (1878). p. (1), 520 p.; 13 x 30 cm. (RayaDhanapatisimha-Bahadura-ka Agama-samgraha; v. 15). (CLIO 2, 1715]. 45 2 Agamodaya Samiti and Sresthidevacandra-Lalabhai Jainapustakoddharaka Phanda / Anandasagara. The Agama texts that issued from these two publishers (1911-49) make up one of the more accurate editions of the canon printed. The editor for almost all of them was Anandasagara (1874-1949) -- formerly Sagarananda, also called Agamoddharaka-although this is usually not stated explicitly in the publications. From the information given in the Alpaparicitasaiddhantikasabdakosah' (1954-79: 3, plate lacing 3. From 1911 to 1979 the Srcsthidevacandra-Lalabhai-Jainapustakoddharaka Phanda (named after Sheth Devchand Lalbhai Javeri (1853-13 January 1906) published 126 volunics (DLJP series list). The first Agamodaya Samiti publication I have recorded is 1916 and the last 1933. This dictionary (full details in the section on dictionaries below) was prepared by Muni Kancanavijaya on the basis of many of Anandasagara's Page #15 -------------------------------------------------------------------------- ________________ 58 JAIN JOURNAL: Vol-XXXV, No. 2 October 2000 p. 9, 5, 16-17, 22-26) Anandasagara was responsible for at least 87 titles published by the Agamodaya Samiti and the DLJP fund. The indexes listed here after the series (1923, 1928, 1937, 1948) cover publications by both publishers, however seven curnis edited by Anandasagara are also indexed in the Alpaparicita...but are not listed.5 1911 1914 1915 *Sriyasodevapranitavivaranasametam Sripaksikasutram. [/ edited by Anandasagara]. Bombay: Nirnayasagara Press, 1911. 5 [ie 10], 78 [ie. 156] p.; (Sresthi-Devacandra-LalabhaiJaina-Pustakoddhara; 4) [Emeneau 3967; CLIO 3: 1836; DLJP list] 5. *Upadhyayasrimadvinayavijayaganiviracita Kalpasutravrttih Subodhikabhidhana [/edited by Anandasagar]. Suryapura : Gopipura Jaina Printing Works, 1911. 2, [2], 600 p.; 1 plate; 13 x 28 cm. (Sresthi-Devacandra-Lalabhai-Jainapustakoddhara; no. 7). [Emeneau SS 3943. CLIO 2, 1232; DLJP series list] *Dasa-sruta-skandhe Paryusana-kalpakhyam BhadrabahuSvami-viracitam Kalpa-sutram, Yuga-pradhana-Kalikacaryakatha-samyuktam [/edited by Anandsagara]. Bombay : Nirnaya-sagara Press, 1914. 2, 1, 68, [1], p.; 1 plate; 12 x 26 cm. (Sresthi-Devacandra-Lalabhai-Jaina-pustakoddhara; no. 18). [CLIO 2, 1231; DLJP list] 2nd ed. 1933. *[Lalitavistara (cty on Caityavandanasutra) with Municandra's Panjika / edited by Anandasagara. (SresthiDevacandra-Lalabhai-Jaina-Pustakoddhara series; 29). [BORI Cat 17:3, 225; DLJP series listing] 1915-16 *[Hemacandracarya-viracita-vrtti-yuktam...Anuyogadvarasutram/ edited by Anandasagara] Bombay: Nirnaya-sagara Press, 1915-16. 2 v.; 12 x 26 cm. (Sresthi-DevacandraLalabhai-Jaina-pustakoddhara; no. s 31, 37). [CLIO 1, 134; DLJP series listing] publications. Forty-four source works are given in the list of abbreviations in volumes 3 (p. 6-8) and 5 (p. 16-17). Thirty-six were his editions (including the Upadesamala and the Tattvarthasutra) the remainder being indexed either from MSS (five) or other editions (three). More works are indexed in these volumes than are listed in the 'Samjnapatrakam'. Another work edited by him: 1946 *[Hemacandra. Abhidhanacintamani: with Sesas and Siloncha as well as Hemacandra's Linganusasana and Nighantusesa, Sudhakalasa's Ekaksaranamamala and Purusottama-deva's Dvirupakosa, here styled Sabdabhedaprakasa / edited by Sagarananda Suri]. Surat, 1946. (DLJP 92). [CLIO ?; Vogel 1979, 336 n. 135] Page #16 -------------------------------------------------------------------------- ________________ WILES: THE BIBLIOGRAPHY OF THE SVETAMBARA CANON 1916 1917 1918 Srimadganadharavarasudharmasvamipranitam Srutakevalibhadrabahusvamidrbdhaniryukti-yuktam, Srimacchilankacaryavihitavivrtiyutam [part 2 degvivaranayutam] Sriacarangasutram. Mahesana : Agamodayasamitih, Virasamvat 2442. Vikramasamvat 1972-73. Kraista 1916. 2 v.; 12 x 26 cm. [CLIO 1, 21] Reprint. 1978. 1916-17 Srimad-Bhadrabahu-Svami-sukta-niryuktikani ... Sri-Santisurivarya-vivrtani Srimanty-Uttaradhyayanan [/ edited by Anandasagara]. Bambai: Devacanda lalabhai Jaina Pustakoddhara Samstha, 1916-17.3 v.; 12 x 27 cm. (Sresthi Devacanda Lalabhai Jaina Pustakoddhara Fund series; no. 33, 36, 41). [CLIO 2, 2827; Alsdorf 1966. Foreword; DLJP series list] 1916-17 Srimadacaryabhadrabahutataniryuktiyutam: Purvadha 59 Sricaturdasapurvadharasrutasthavirapranitam Candrakulinasrimadabhayadevasurivihita-srimaddronacaryasodhitavrttiyutam Srimadaupapatikasutram. Mehesana : Agamodaya-samiti, Vira samvat 2442. Vikramasamvat 1972. Kraista 1916. 2, 119, [1] [ie 4, 238, 2] p.; 12 x 26 cm. *Sriman-Malayagiry-Acarya-vihita-vivarana-yutam SrimadDevavacaka-Gani-drbdham Sriman-Nandi-sutram... Bombay: Nirnaya-sagara Press, [Vikramasamvat 1973 [1916]]. 2, 254, [1] [ie. 4. 508, 2] p.; 12 x 27 cm. [CLIO 2, 1715; Nandi. 1968, 79 (fourth group)] The Agamodaya Samiti series; no. 16 (BORI Cat. 17:2, 294). Reprinted. 1924. racaryavihitabhasyabhusitam Srimadbhavavirahaharibhadrasurisutritavrttyalankrtam Srimadavasyakasutram. Mehesana Agamodaysamiti [sic], Virasamvat 2442-43. Vikramasamvat 1972-73. Kraistasya 1916-17. 4 v.; 12 x 27 cm.; [Agamodaya-samiti-siddhanta-sangraha; no. 1, 2, 3, 4]. Srimacchilankacaryavihitavivaranayutam Srimatsudharmasvamiganabhrddrbdham Srimatsutrakrtangam Mehesana : Agamodayasamiti, Virasamvat 2443. Vikramasamvat 1973. Kraistasya san 1917. 427 [ie. 854] p.; 12 x 27 cm. (Agamodaya Samiti series; no. 18). [CLIO 4, 2666; Tripathi 1975, 91] Reprint 1950-53; 1978. Srimatsudharmasvamiganabhrdviracitam Candrakulina navangivrttikarakasrimadabhayadevasurivira-citatikopetam Page #17 -------------------------------------------------------------------------- ________________ 30 JAIN JOURNAL: Vol-XXXV, No. 2 October 2000 Srisamavayangasutram. Mehesana : Sriagamodayasamitih, Virasaivat 2444. Vikramasamvat 1974. Kraista san 1918. 2. 160 fic 4, 320] p.; 12 x 26 cm. [CLIO 4, 2267] Reprint with list of corrections 1985. Srimacchayyambhavasurisvarasutritam Srimaddharibhadrasurivarasisyabodhinisamjnakam Vivaranayutam Sridasavaikalikasutram. [/ edited by Anandasagara]. Bombay: Sheth Devchand Lalbhai Jain Pustakoddhar Fund, Virasamvat 2444. Vikramasamvat 1974. Kraista 1918. [ii] [ie. 4], 286 [ie. 572] p; 12 x 22 cm. (Sresthi Devacandra Jainapustakoddhara; no. 47). [CLIO 1, 702; DLJP series list] Srimadbhadrabahusvamipranita sabhasya srimanmalayagiryacaryavivrta Sripindaniryuktih / [edited by Anandasagara] Suratasiti Devacandra Lalabhai Jainapustakoddharaphanda, Bhagavadvirasya 2444. Vikramanrpasya 1974. Isukhriste 1918. 2, 179, [1] p.; 1 leaf of plates; 12 x 27 cm. (Sresthi Devacandra Lalabhai-Jainapustakoddhara; no. 44). [CLIO 3: 1916; DLJP series list] 1918-19 Srimacchyamacaryadrbdham Srimanmalayagiryacaryavihitavivaranayutam Sriprajnapanopangam. Mehesana Agamodayasamiti, Virasamvat 2444-45. Vikramasamvat 1974-75. Kraista 1918-19. 2 v., 12 x 26 cm. [CLIO 3, 1932] 1919 1918-20 Srima spidiarmasvamiganabhrtprarupitam Srimuccandragacchalankarasrimadabhayadevasurisutritavivaranayutam Srimatsthanangasutram. Mehesana : Sriagamodayasamitih, Virasamvat 2445-. Vikramasamvat 1975-. Kraista 19181920. 2 v; 12 x 27 cm. (Agamodaya series; no. 21, 22). [CLIO 4, 2604; BORI Cat. 17:1, 55] Reprint with list of corrections 1985. 1918-21 Srimadbhagavatisutram / Srimatsudharmasvamiganibhrtprarupitam Srimadgautamaganadharivacananugatam; Srimaceandrakulalamkarasrimadabhayadevasurisutritavivaranayutam. Mehesana : Agamodayasamiti, Virasamvat 2444-47. Vikramasamvat 1974-77. Kraista 1918-21. 2 v. in 3: 12 x 27 cm. [CLIO 1, 380] Srimat Jnatadharmakathangam: Candrakulalamkarasrimadabhayadevasurisutritavivaranayutam. Mchesana : Agamodayasamiti, Virasamvat 2449. Vikrama sam. 1975. Kraista 1919. 253 (ie. 506] p.; 12 x 27 cm. [CLIO 2, 1190] Page #18 -------------------------------------------------------------------------- ________________ TILES: THE BIBLIOGRAPHY OF THE SVETAMBARA CANON 920 *Sriprasnavyakaranamgam : Srimatsudharmasvamiganabhrtprarupitam Srimaccandrakulalamkarasrimada Bombay : bhayadevasurisutritavivaranayutam. Agamodayasamiti, Virasamvat 2445. Vikramasamvat 1975. Kraista 1919. 165p.; 12 x 27 cm. [CLIO 3, 1957] Sristhanangakhyatrtiyangasambaddham Caturdasa 61 purvadharaviracitam Srimanmalayagiryacaryasutritavivaranayutam Srimajjivajivabhigamopangam [ / edited by Anandasagara]. Prathamasamskare. Bombay : Sheth Devachand Lalabhai Jain Pustakoddhara Fund, Virasamvat 2445. Vikramanrpasya 1975. Kraista 1919. f. [2], 466, [1]; 12 x 27 cm. (Sresthi-Devacandra-Lalabhai-Jainapustakoddhara; granthankah 50). [CLIO 2, 1168; DLJP list] Bombay Agamodaya Samiti, 1919 (Schubring 1935 SS 47). Srimanmalayagiryacaryavihitavivaranayutam Srisuryaprajnaptyupangam 4, [1], 297 [ie. 8, [2], 594] p.; 12 x 26 cm. Mehesana Agamodayasamiti, Virasamvat 2445. Vikramasamvat 1975. Kraista 1919. [Agamodaya Samiti series, no. 24]. Srutakevalisrimadbhadrabahusvamiviracitaniryukti srimatpurvacaryaviracitabhasyayuta: Navangivrttisodha kanirvrttikulabhusanasrimaddronacaryasutritavrttibhusita Srimati-Ogha-niryuktih. Mehesana Agamodayasamiti, Virasamvat 2445. Vikramasamvat 1975. Kraista 1919. 227 [ie. 454] p.; 12 x 27 cm. Edited by Sah Venicandra Surcandra. Srimaccandrakalina [sic] Srimadab[h]ayadevacarya vihitavivaranayutam Srimadupasaka dasangam. Mahesana: Agamodayasamiti, Virasamvat 2446. Vikramasamvat 1976. Kraistasan 1920. 54 [ic. 108] p.; 12 x 27 cm. [CLIO 4, 2818] *Srimad-Antakrd-dasanuttaropapatika-dasa-Vipaka-srutani: ......Abhayadevacarya-vihita-vivarana-yutani. Mahesana : The Agamodaya Samiti, 1920. foll. [1], 96 [ie. 2, 192] p.; 12 x 27 cm. oblong. (Agamodaya Samiti granthamala; 23). [CLIO 1, 129; Tripathi 1975, 72]. Prameyaratnamanjusanamnya vrttya yutam Srimajjambu dvipaprajnaptinamakopangam / Srisanticandraganiviracitaya [ / edited by Anandasagara]. Bombay : Nirnayasagara Press, Srivirasamvat 2446. Vikramasamvat Page #19 -------------------------------------------------------------------------- ________________ 62 1922 1923 1924 JAIN JOURNAL: Vol-XXXV, No. 2 October 2000 1976. Kraistasan 1920. 2 v.; 12 x 27 cm. (Sresthi Devacandra Lalabhai Jainapustakoddhara; granthankah 52, 54). [CLIO 2, 1138; Emeneau SS 3933; Roth 1983, 222; DLJP list]. Srinir[a]yavalikasutram / Sricandrasuriviracitavrttiyutam; Danavijayaganibhih samsodhitam. Amadavada(rajanagara)madhye [Ahmedabad]: "Prakasayitri Sriagamodayasamitih., Virasamvat 2448. Vikramasamvat 1979. San 1922. 42 [ie. 84] p.; 12 x 26 cm. (Srivirasamajagrantharatnam; 2). Pratnapurvadharanirmitam Sritandulavaicarikam Srimadvijayavimalaganidrbdhavrttiyutam, savacarikam ca Catuhsaranam. Bombay Sheth Devachand Lalbhai Jain Pustakoddhara Fund, Virasamvat 2448. Vikramasamvat 1978. Kraista 1922. 78 [ie. 156] p.; 12 x 27 cm. (SresthiDevacandra-Lalabhai-Jaina pustakoddhare granthanka; 59). Srimadanandavimalacaryantisachrimadvanararsivihitavrttiyutam Srimad Gacchacaraprakimakam. Mehesana : Agamodaya Samiti, Virasamvat 2450. Vikrama samvat 1980. Kraista san 1923. 42 p.; 12 x 27 cm. [Agamodaya-Samiti series; no. 36, 46]. Srianuyogadvarani : Srimanmaladharagacchiyahemacandrasurinirmitavrttiyutani. Bombay Agamodayasamiti, Vikramasamvat 1980. Kraistasan [1923]. f. [1], 271, [2]; 12 x 27 cm. *Visesavasyakasatkah pathyagathah Sripradyumnasuriviracitam Vicarasaraprakaranam ca Manikyasagaraviracitacchayayuktam. Ahmedabad: Agamodaya Samiti, 1923. 8, 180 p. [Emeneau 3971] Srimanmalayagiryacaryapranitavrttiyutam Srimaddusya ganisisyacaryavaryasrimaddeva-vacakaksamasramana nirmitam Srimannandisutram. Bombay: Agamoday-Samiti, Vira-samvat 2450. Vikramasamvat 1980. San 1924. 254 [ie. 508] p.; 12 x 27 cm. Reprint of 1916 edition. 1924-27 Sriman purvadhara Acaryavarya Jinabhadraganiksamasramanakrta Srimalladhari Acaryasri Hemacandracaryakrta vrtti sahita Srivisesavasyaka bhasantara. Bombay : Agamodaya Samiti, San 1924-27. Vira samvat 2450-53. Vikrama samvat 1980-83. 2 v.; 27 cm. Page #20 -------------------------------------------------------------------------- ________________ VILES: THE BIBLIOGRAPHY OF THE SVETAMBARA CANON 1925 1927 1933 1935 Contents: CauSar. 1a-5a. - AuraPacc. 5a-10a. MahaPacc. 10b-19a. BhattaP. 19b-31a. Tand. 31b-53a. - Samth. 53b-61a. Gaccha. 61b-70b. GaniVi. 70b-75b. DevTha. 76a-96a. MaranaVi. 96a-142b. 1928-36 Srimanmalayagiryacaryakrtavivaranayutam, Srutakevalisrimadbhadrabahusvamisutrita-niryuktiyuta-Sriavasya kasutram. Bombay: Sriagamodayasamiteh, Virasamvat 2454-62. Vikramasamvat 1984-92. [1928-36]. 3 v.; 12 x 28 cm: (Sriagamodayasamitigranthoddhare, granthanka 56, 60. Sresthi Devacandra Lalabhai Jainapustakoddhare; granthankah 85). 1936 Srimatrajaprasniyasutram: Srimanmalayagiripranitavrttiyuktam. Bombay: Agamoday Samiti, Vira samvat 2451. Vikrama samvat 1981. Kraista 1925. 149 [ie. 298] p. 13 x 27 cm. [Agamodaya Samiti series; no. 42]. [CLIO 3, 2056; JRK 330]. Srutasthavirasutritam Catuhsaranadimaranasamadhyantam Prakimakadasakam chayayutam. Bombay [sic] Shree Agamoday Samiti, Vira sam. 2453. Vikrama sam. 1983. San 1927. [Agamodaya Samiti; 46]. 63 - Sridasasrutaskandhantargatam Sriparyusanakalpakhyam Sribhadrabahusvamiviracitam Srikalpasutram anekasundarataravividhavarnakacitrakalitam yugapradanakalika" caryakathadvayasamyuktam samsodhakah Srivijayameghasurivipadah. Rajanagare : Sriagamodayasamiti, Virasamvat 2459. Vikramasamvat 1989. Kraistasya san 1933. 91 [ie 182] p.; 15 x 29 cm. (Sresthi-Devacandra-Lalabhai-Jainapustakoddhare; granthankah 82). *Sadhusadhvidaivasikaratrikapaksikacaturmasika samvatsarika pratikramanani prakirnakavidhisamyutani Sadavasyakasutrani. Ratlam Sresthi Rsabhadevaji Kesarimalaji Samstha, samvat 1992 [1935]. [BORI Cat. 17:3, 134n] *[Laghu vrtti on Bhagavati without mula]. Ratalama : Rsabhadevaji Kesarimalaji Jaina Svetambara Samstha, 1935. 298p.; 12 x 27 cm. Yugapradhanasrutakevalibhagavacchribhadrabahu svamisutritam Srisantisagarakalpitakalpakaumudyakhyavivaranasamvalitam Srikalpasutram. Prathamasamskarane. Page #21 -------------------------------------------------------------------------- ________________ JAIN JOURNAL : Vol-XXXV, No. 2 October 2000 Ratnapuriya (Ratlam] : Srirsabhadevaji Kesarimalaji namni Svetambarasamstha, Vira samvat 2462; Vikrama samvat 1992; Kraista san 1936. 4, 240 p.; 12 x 27 cm. 1936-37 Sri-Jinabhadraganiksamasramanadrbdham Srikotyacarya krtapracinatamavivaranavstam Srivisesavasyakasutram 1 | Anandasagara Suri). Ratalama : Srirsabhadevajikesarimalajinamakasvetambarasamstha, Virasamvat 2463. Vikramasamvat 1993. Kraista san 1936-37. 2 v.; 13 x 27 cm. 1947-49 Sriprajnapanopangam : Suvihitadhurandharasahitya saudhananyastambhopama-sriharibhadrasurisutritaPradesavyakhyasankalitam (Ratlam] : Malavadesantargatasriratnapuriyasrirsabhadevakesarimalaji ityabhidhana Svetambara Samstha, Virasamvat 2473-76 (1947-49). 2 v.; 13 x 27 cm. 1950-53 Srimatsutrakrtangam : Srisudharmasvamisandrbdham; Sribhadrabahusvaminirmita-niryuktiyutam, tadurttikarasrimacchilankacaryavihitavivaranasusobhitam, vividhapratyantaratippanadyalankrtam ca / samsodhakah sampadakasca Srimadacaryacandrasagarasurivarah. Mumbai : Srigodiparsvanathajainaderasarapedhi, Virasamvat (2476?]- 2479 (1950-53). 2 v.; 13 x 28 cm. (Srigodiparsvajainagranthamala; saptmamapuspam). Reprint of 1917 edition. 1958 Sripindaniryuktih : Srimadbhadrabahusvamipranita sabhasya Srijayakirtisurisisyasriksamaratnasutrita'vacuryupeta : Sriviraganiracitayah sisyahitayah Srimanekasekharasurikrtaya Dipikaya adyantabhagau ca/ sampadakah Muni Kancanavijayah. 1. samskaranam. Surata : Sresthidevacandralalabhaijainapustakoddharakosasya, Virasam. 2454. Vikramah 2014. Sake 1880. Khristabdah 1958. 19, 177 [ie. 38, 354] p.1 plate; 13 x 28 cm. (Sresthidevacandra-Lalabhai-Jainapustakoddharake granthankah 105). 1978 * Acarangasutram Sutrakstangasutram ca/Srimatsudharma svamiviracitam ; Bhadrabahu-svamiviracitaniryuktiSrisilankacaryaviracitatikasamanvitam; sampadakah samsodhakasca Acaryamaharajasrisagaranandasurisvarah, Munirajasripunyavijayajimaharajasanglhitapracinasamagryanusarena suddhi-vrddhipatrakadivividhaparisistadibhih nnriclarta Munih lomhiviiavah cahavale Munih Page #22 -------------------------------------------------------------------------- ________________ VILES: THE BIBLIOGRAPHY OF THE SVETAMBARA CANON Dharmacandravijayah. Dilli : Motilala Banarasidasa Indolajika Trasta, 1978, 288, 400 (72] p.: [1] leaf of plates; port.; 29 cm. (Lala Sundaralala Jaina Agamagranthamala ; bhaga 1). Re-edition of Ayar. 1916, Suy. 1917. 1985 Sthanangasutram Samavayangasutram ca: dvadasangyam trtiyam caturtham ca / Pancamaganadhara-Bhagavatsudharmasvamiviracitam; Acaryapravarasriabhayadevasuriviracitavrttisamalankrtam ; sampadakah samsodhakasca Acaryamaharajasrisagaranandasurisvarah; Munirajasripunyavijayajimaharajasangrhitapracinasamagryadyanusaram vihitena suddhipatrakena tatha aparair api nanavidhaih parisistadibhih pariskarta; Munih Jambuvijayah. 1. samskarana. Dilli : Motilala Banarasidasa Indolajikala Trasta, 1985. 38, 411, 5, 150 p.; 29 cm. (Lala Sundaralala Jaina Agamagranthamala ; bhaga 2). Reprintings of editions of 1918 and 1918-20, with lists of corrections. According to Muni Kancanavijaya (Alpaparicita...) Anandasagara also edited the following Curnis : 1928 * Jinadasa-Gani-viracita Srianuyogadvara-curni tatha Haribhadra-Acarya-viracita Anuyogadvara-sutra-vrtti. Ratalama : Srirsabhadevaji Kesarimalaji Svetambarasamstha, Vira samvat 2454. Vikrama samvat 1984. Kraista 1928. 90, 128 p. ; 12 x 27 cm. 1928 *(Nandi Curni with Haribhadra's Vrtti / edited by Sagarananda Suri] Ratalama : Rsabhadevaji Kesarimalaji Svetambara Samstha, Vikrama samvat 1984 (1928). 1928-29 *Srimad Ganadhara-Gautama-Svami-sandrbdham... Srimad Bhadrahaluu-Svami-sutrita-Niryukti-yutam Srimaj-JiradasaGani-Mahattara-krtaya Curnya sametam Srimad-Avasyakasutram Indore : Jaina-bandhu Press, 1928-29. 2 v. ; 12 x 27 cm. 1928-36 Srimanmalayagiryacaryakrtavivaranayutam Srutakevali srimadbhadrabahusvamisutritaniryuktiyuta-Sriavasyakasutram. Bombay : Sriagamodayasamiteh, Virasamvat 2454-62. Vikramasamvat 1984-92. [1928-36). 3 v. ; 12 x 28 cm. (Sriagamodayasamitigranthoddhare, granthanka 56, 60. Sresthi Devacandra Lalabhai Jainapustakoddhare; granthankah 85). [Emeneau 3961; CLIO 1, 243] v 3 edited by Anandasadara (DLJP list) Page #23 -------------------------------------------------------------------------- ________________ 66 JAIN JOURNAL : Vol-XXXV, No. 2 October 2000 1933 Prasiddhya Srijinadasaganimahattararacita sridasavai kalikacurnih : Srutakevalibhagavac-chayyambhavasurisutritasutrya Srutakevalisrimadbhadrabahusvamisandrbdhaniryuktika. Ratalama : Sri Rsabhadevaji Kesarimalaji Svetambarasamstha, Vira samvat 2459. Vikrama sam. 1989. Kraista 1933, 1, [ie. 2), 380 p.; 12 x 27 cm. 1933 Srimanti Uttaradhyayanani: Jinadasaganimahattara krtaya Cumnya sametani. Ratnapura (Ratlam] : Srirsabhadevaji Kesarimalajityabhidha Srisvetambarasamstha, Vira samvat 2459. Vikrama samvat 1989. Kraista san 1933. 284 p. ; 12 x 26 cm. 1941 Sriacarangacumn/ bahusrutakimvadantya Srijinadasagani varyavihita. Malavadesantargataratnapuriya (Ratalamagata): Srirsabhadevajikesarimalaji Svetambarasamstha, Vikramasya samvat 1998. Srivirasya 2468. Kraistasya 1941. 382 p.; 12 x 26 cm. *[Sri-Sutrakstangacurni with Nijjutti and Jinadasa's Cunni / edited by Mohanlal M. Badami. Ratlam : Sri Rsabhadevaji Kesarimalaji Svetambara Samstha, 1941. 466 p.; 12 x 27 cm. [Attributed to Anandasagara in Alpaparicitasaiddhanti kasabdakosah, v. 3 plate facing page 91 Indexes to this series : 1923 Agamodayasamitau parisiste prathame vibhago dvitiyah Visesavasyakagathanamakaradih kramah : tatha dvitiye parisiste dvitiyo vibhagah Visesavasyakavisayana. manukramah. Amadavada : Agamodayasamitih, Virasamvat 2479. Vikramasamvat 1979; Kraistasan 1923. [2], (63) (ie. 126) p.; 12 x 27 cm. 1928 Nandyadigathadyakaradiyuto visayanukramah : Srinandi Anuyogadvara-Avasyaka-Oghaniryukti-DasavaikalikaPindaniryukti-Uttaradhyayananam sutrasutragathaniryuktimulabhasyabhasyanam akaradikramah ankasuddhih laghubrhams ca visayanukramah = An Alphabetical index of the aphorisms etc. occuring in Nandisutra, Anuyogadvara, Avasyaka, Oghanir[y]ukti, Dasavaikalika, Pindaniryukti and Uttaradhyayanasutra : along with detailed lists of subjects treated in these seven Agamas. Mumbayyam: Sri Agamodayasamiteh karyavahakah Jivanacandra Sakaracandra Jhaveri, Virasamvat 2454 (1928). f. 183 (ie. Page #24 -------------------------------------------------------------------------- ________________ WILES: THE BIBLIOGRAPHY OF THE SVETAMBARA CANON 1937 1948 1948 6. 366 p.l; 12 x 26 cm. (Sri-Agamodayasamiti Granthoddhara; granthakah 55). 67 Sriacarangadyekadasangyah Argakaradi: 1 Sutradyakaradi 2 Sutradyankasuca 3 Laghubrhadvisayanukramau. Ratnapuriya (Ratalama): Srirsabhadevajikesarimalaji Svetambarasamstha, Virasamvat 2463. Vikramasamvat 1993. Kraistasan 1937. [141], 48, 161 p.; 12 x 27 cm. ANU MENZIES BL1312.29.A6 1937 Sriagamiyasuktavalyadi: Agamiyasuktavali 1, subhasita 2, sangrahasloka 3, lokoktayah 4. Suryapuriya [Surat]: Srijainapustakapracarakasamstha, Vikramasamvat 2005 [1948]. 74 p. 12 x 27 cm. (Sriagamoddharasangrahe bhagah 8). ANU LARGE BOOK BL1310.6.S75 1941 Upangaprakimakasutravisayakramah: Sriaupapatika Rajaprasniya-Jivajivabhigama-Prajnapana-Candrasuryaprajnaptiyugma-Jambudvipaprajnapti-Upangapancakamaya nirayavalika-Catuhsaranadiprakirnakadasakanam sutrasutragathanam akaradikramah laghur brhamsca visayanukramah. Suryapure [Surat] Srijainapustakapracarakasamstha, Vikramasamvat 2005. Virasamvat 2475. I. sa. 1948. 72, 108 p. ; 25 x 12 cm. (Sriagamoddharasangraha; 2). ANU BL1312.59.U8 1948 3 Amolaka Rsi, text of 32 Agamas with Hindi translation, 1915-196 *Acaranga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1915. 638 p.; 13 x 23 cm. 1915 *Suyagadanga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1915. 587 p.; 13 x 23 cm. Reprint Suy. 1963. Because I have yet to examine these publications in detail the information here is provisional. The quality of the texts and translations has been characterized as poor by Schubring (Schubring Ayar. 1966, 5). They seem also to have been rereleased in Haidarabada, Vira samvat 2446 [1920] under the general title Jain sutra battisi, by Raja Bahadur Lala Sukhdevsahay Jvalaprasad Jaumhri (Schubring 1935, p. 4-5, n. 4; JSBI 2, 325n la). Page #25 -------------------------------------------------------------------------- ________________ 38 1916 1917 1918 JAIN JOURNAL: Vol-XXXV, No. 2 October 2000 *Thananga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1916. 900 p.; 13 x 23 cm. *Samavayanga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1916. 332 p.; 13 x 23 cm. *Vivahaprajnapti (Bhagavati) sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1917. 3090 p.; 13 x 23 cm. *Upasakadasanga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina) Jaina Sastroddhara Mudralaya, 1917. 156 p.; 13 x 23 cm. *Vipaka sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1917. 204 p.; 13 x 23 cm. * Uvavai sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1917. 216 p.; 13 x 23 cm. *Jnata dharmakathanga sutra/Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918. 792 p. ; 13 x 23 cm. *Prasnavyakarana sutra/Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918. 228 p.; 13 x 23 cm. *Rajaprasniya sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918. 304 p.; 13 x 23 cm. *Jivabhigama sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918. 768 p.; 13 x 23 cm. *Suryaprajnapti sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina) Jaina Sastroddhara Mudralaya, 1918. 400 p.; 13 x 23 cm. Niriyavalikadi panca sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918. 180 p.; 13 x 23 cm. *Brhadkalpa sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918. 96 p.; 13 x 23 cm. Page #26 -------------------------------------------------------------------------- ________________ WILES: THE BIBLIOGRAPHY OF THE SVETAMBARA CANON 1919 69 *Vyavahara sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1918. 180 p.; 13 x 23 cm. *Antagadadasanga sutra/Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919. 139 p.; 13 x 23 cm. *Anuttarovavai dasanga sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919. 40 p.; 13 x 23 cm. *Pannavanna sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919. 1358 p.; 13 x 23 cm. *Jambudvipa prajnapti sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919. 624 p.; 13 x 23 cm. *Nandi sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina) Jaina Sastroddhara Mudralaya, 1919. 211 p.; 13 x 23 cm. *Anuyogadvara sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina) : Jaina Sastroddhara Mudralaya, 1919. 379 p.: 13 x 23 cm. *Uttaradhyayana sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919. 651 p.: 13 x 23 cm. *Dasavaikalika sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina) Jaina Sastroddhara Mudralaya, 1919. 144 p.; 13 x 23 cm. *Avasyaka sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919. 47 p.; 13 x 23 cm. (JSBI 2, 173 item u] *Dasasrutaskandha sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, 1919. 148 p.: 13 x 23 cm. [LC] *Nisitha sutra / Amolaka Rsiji Maharaja krta Hindi bhasanuvada sahita. Sikandarabada (Daksina): Jaina Sastroddhara Mudralaya, Vira samvat 2446 [1919]. 246 p.: 13 x 23 cm. Page #27 -------------------------------------------------------------------------- ________________ JAIN JOURNAL : Vol-XXXV, No. 2 October 2000 Reprints :7 1960 Sri Acaranga sutra / Sri Amolaka Rshiji dvara anuvadita; sampadakah Sobhacandra Bharilla. 2nd corrected edition. Dhuliya (Pascima Khanadesa) : Sri Amola Jnanakata, Vira samvat 2486 (1960). 4, 4, 300 p.; 23 cm. (Amolakarshiji Smaraka granthamala ; puspa sankhya 66). Reprint of Ayar. 1915. 1963 *[Sutrakrtanga Sutra / edited by Muni Sri Kalyanarsiji and Sobhacandra Bharilla.] Dhuliya, 1963. (Amolakarbiji Maharaja Smaraka granthamala; puspa sankhya 68). [Bollee 1977-88:1, 3] Reprint of Suy. 1915. 4 "Agamaratnamanjusa", 1941 or 1942 Anandasagara (see Agamodaya Samiti edition above) prepared the 45 texts of the canon to be inscribed on copperplates, now preserved in the Agama-Mandira in Surat, and on marble slabs in the Agama-mandira, Palitana. The texts were also printed on large format paper in about 500 copies which were distributed to various Bhandaras and learned monks. The copy originally presented to Punyavijaya is now housed in the L.D. Institute (C. Tripathi, MahaNis. 1994, p. 13). This edition is termed Agamaratnamanjusa in Pannav. 1969 (v. 2, 442-43) where the year of publication is given as 1998 V.S. (1941] (2468 Vira N.S. (1942]). A characteristic feature of this edition is that at various places the text of the sutra has been abridged by placing the sign of zero (O). In doing so the editor, has not followed any old manuscript, method or tradition, it is in fact an abridged version. Some silent corrections' have also been introduced (Pannav. 1969: 2, 461). 5 Suttagame edition 1953-54 Suttagame / carimatitthayara-pancamaganahara Suhammayariyaviraie ; (sutthuruvena] Pupphabhikkhuna sampadio. Padham avstti. Gudagamva-chavani, Purvapanjaba : Sirisuttagamapagasasamii, Virasamvaccharam 2479-80. Vikkamavarisam 2009-11. Kaitthaddam 1953-54. 2 v.; 19 cm. Given the series numbering cited in these entries it is clear that other volumes have also been reprinted however I have not yet been able to trace the details. Page #28 -------------------------------------------------------------------------- ________________ WILES: THE BIBLIOGRAPHY OF THE SVETAMBARA CANON 8. - Contents v. 1: Prakasakiya [1]. Suttagame para lokamata [2]-10. Suyana 11-12. - Prastavana / Jinacandabhikkhu [13]-26. Sanksipta-Ardhamagadhi-vyakarana 27-46. Suttanukkamaniya 47. - Ayare [1]-99. Suyagadam 101182. Thane 183-315. Samavae 316-383. - BhagavaiVivahapannatti 384-939. - Nayadhammakahao 941-1125. Uvasagadasao 1127-1160. - Antagadadasao 1161-1190. Anuttarovavaiyadasao 1191-1198. Panhavagaranam 1199-1239. - Vivagasuyam 1241-1287. 27-29. - - Pattavali Contents v. 2: [Details about publishing committee] [4]-9. - Prakasakiya 10-16. - Jaina dharme ke dasa niyama 1718. Suyana 19-20. Sadbhasamayam Virastotram 21. Gurustutih [and other short pieces] 22-26. Pasangiyam kinci 30-31. Sirisuttagamaganthassa sararuvabhumiya 32-33. Nidamsanam 34-36. Tulanatmaka adhyayana 37-50. Sampadakiya [51]-66. Vyakarana-sesa 67-71. Suttanukkamaniya [72]. Ovavaiyasuttam [1]-40. Rayapasenaiyam [41]-103. - Jivajivabhigame [105]-264. [Donor details] [2]. - Pannavanasuttam [265]-533. Jambuddivapannatti (535)-672. - Candapannatti [673]-754. Nirayavaliyao [755]-772. Pupphiyao [773)-788. Pupphaculiyao [789]-791. Vanhidasao [792]-796. Vavaharo [797]-829. Bihakkappasuttam [831]-848. Nisihasuttam [849]-917. - Dasasuyakkhandho [918]-946. Dasaveyaliyasuttam [947]-976. - Uttarajjhayanasuttam Nandisuttam [1061]-1083. Anuogadarasuttam [1085]-1163. Avassayasutta [1164]1172. 1. parisittham Kappasuttam [1]-42. parisittham Savayavassae Samaiyasuttam [43]-45. 3. parisittham Savayavassaya (padikkamana) suttam 45-52. Review A.N. Upadhye ABORI 41 (1960) 160-161. [977]-1060. 2. ANU BL1310.S8 1954 v. 1, v. 2 - - 6 Ghasilala, 32 Agamas 1936-738 1936 - -- -- 71 - - Sri Upasakadasangasutram: Samskrta Hindi Gujarati-tikasametam / vrttiracayita Ghasilalaji Maharaja. 1. avrtti. Karaci: Sri Svetambara Sthanakavasi Jaina Sangha, Vira samvat 2463. Vikrama samvat 1992. I. sa. 1936. 20, 565 p.; 25 cm. A lifetime's work, his editions of the Pannav.. and Jambuddi. not yet traced. Page #29 -------------------------------------------------------------------------- ________________ 1942 JAIN JOURNAL : Vol-XXXV, No. 2 October 2000 Sridasavaikalikasutram : Samskrta-Hindi-Gurjarabhasasamalankrtam / vrttiracayita Ghasilalaji ; niyojaka Samiramallaji tatha Kanhaiyalalaji. Avrtti 1. Limadi, Pancamahala : Sthanakavasi Jaina Srisangha, Vira samvat <2469->; Vi. samvat <1998->; 1. san <1942->. V. <1->; 25 cm. 1948 1950 Reprint 1957-60. Sri Anuttaropapatikasutram: Arthabodhinivsttisamalankstam: Hindi Gurjara bhasa sahitam / vrttiracayita Ghasilalaji; niyojaka Samaramallaji tatha Kanhaiyalalaji. Avrtti l. Rajakota, Kathiyavada : Sri Svestambara). Sthalnakavasi). Jaina Sastroddhara ka Samitih, Vira samvat 2474 (1948). 12, 160 p. ; 24 cm. Reprint 1959. Sri Nirayavalikasutram: Hindigurjarabhasanuvadasahitam / Ghasilalaji Maharaja-viracita-Sundarabodhinitikasamalankrtam ; niyojakau Munisri Samiramallaji Maharajah; Munisri Kanhaiyalalaji Maharajasca. Rajakota, Saurastra : Sri Sve[tambara). Stha[nakavasi). Jainasastroddharakasamiti, Vira samvat 2494 (1948). 1 plate os portraits. 20, 455 p.; 25 cm. Sri Antakrtadasangasutram : Munikumuda Candrika tika samalankrtam, Hindigurjara-bhasa-sahitam / tikaracayita Ghasilalaji, niyojaka Samiramallaji tatha Kanhaiyalalaji. Rajakota, Kathiyavala : Sri Svestambara). Stha[nakavasi). Jaina-Sastroddharaka-Samitih, Vira samvat 2477 (1950). [1] leaf of plates; 25, 267 p.; 21 cm. Reprint 1958. Sri Avasyakasutram: Ghasilalaji-viracitamunitosinyakhyaya vyakhya samalankrtam Hindi Gurjara-bhasasahitam / niyojako Muniratna Gabbulalaji : Munisri Samiramallaji ; Mun[iari Kanhaiyalalaji. Rajakota, Saurastra : Sri Sve. Stha. Jainsastroddhara Samitih, Vira samvat 2478. Vikrama samvat 2007. Isvisana 1951. 4, 341 p.; 3 leaves of plates (portraits); 24 cm. Reprinted 1958. Sri Vipakasutram : Ghasilalajimaharaja-viracitaya Vipakacandrika-tikaya samalankstam HindiGurjarabhasanuvadasahitam / Gavvulalajimaharajah ; 1951 1952 Page #30 -------------------------------------------------------------------------- ________________ WILES: THE BIBLIOGRAPHY OF THE SVETAMBARA CANON 1952-71 Sri Acarangasutram / Ghasilalajimaharajaviracitaya" caracintamanivyakhyaya samalankrtam Hindigurjarabhasa'nuvadasahitam. Rajakota, Saurastra: Sri [Akhila Bharatiya] Sve[tambara]. Stha[nakavasi] Jainasastroddharasamitih, Vira samvat 2478-83 [1952-57]. 4 v.; 25 cm. 1958 Munisrisamiramalaji Maharajah Kanhailalaji Maharajasca. Prathamavrttih. Rajakota, Saurashtra Sri Sve[tambara]. Stha[nakavasi]. Jainasastroddharasamitih, Vira samvat 2479 [1952]. [3] pages of plates, 702, 84 p.; 24 cm. Reprint 1959. 1957-60 *[Dasave. text with Hindi and Gujarati translation / by Ghasilalaji] Rajakota: Jaina Sastroddhara Samiti, 1957-60. [2 v ?] 1959 73 *Antakrtadasangasutram Antakrita Dashanga sutra / Ghasilalaji-Maharaja-viracitaya Munikumudacandrikakhyaya vyakhyaya samalankrtam Hindigurjarabhasanuvadasahitam. Dvitiyavrttih. Rajakota, Saurasta: Sri Akhila Bharatiya Svetambara Sthanakavasi Jainasastroddhara Samiti, Vira samvat 2484 [1958]. 5, 16, 37, 217, 22 p. ; 21 cm. = Reprint of 1950 edition. *[Nandi sutra with Muni Ghasilalaji's Sanskrit Vyakhya (Jnanacandrika) and his Hindi and Gujarati translations.] Rajkota Jaina Sastroddhara Samiti, V.S. 2014 [1958]. *[Reprint of 1951 Avasyaka edition by Ghasilala]. Rajakota : Jainasastroddhara Samiti, 1958. Anuttaropapatikasutram Anuttaropapatika sutram / Ghasilalaji-Maharaja-viracitaya Arthabodhinyakhyaya vyakhyaya samalankrtam Hindigurjarabhasanuvadasahitam. Dvitiyavrttih. Rajakota, Saurastra: Sri Alkhila]. Bharatiya Svetambara Sthanakavasi Jainasastroddhara Samiti, Vira samvat 2485 [1959]. 2, 4, 4, 13, 16, 4, 17-35, 148 p. 25 cm. Reprint of 1948 edition. Sri-Vipakasutram Shri Vipaka sutram / GhasilalajiMaharaja-viracitaya Vipakacandrikatika samalankrtam Hindigurjarabhasanuvadasahitam. Dvitiyavrttih. Rajakota, Saurastra: Sri Akhila Bharatiya Svetambara Sthanakavasi = Page #31 -------------------------------------------------------------------------- ________________ 74 JAIN JOURNAL: Vol-XXXV, No. 2 October 2000 Jainasastroddhara Samiti, Vira samvat 2485 [1959]. 10, 33, 706, 84 p.; 25 cm. Reprint of 1952 edition. 1959-61 Uttaradhyayana-sutram 1961 Aupapatika-sutram Aupapaatika sutra / GhasilalajiMaharaja-viracitaya Piyushavarpinyakhyaya vyakhyaya samalankrtam; Hindigujarabhasanuvadasahitam. Rajakota, (Saurastra): Sri Akhila Bharatiya Svetambara Sthanakavasi Jainasastroddhara Samiti, 2485 [1959]. 5, 3, 39, 737, 24 p.; 24 cm. [BORI] 1962 Uttaradhyayana sutram / [Ghasilala; Kanhaiyalalaji]. Rajakota: Sri A[khila]. Bha[rata]. Sthanakvasi Jaina Sastroddhara Samiti, 1959-61. 1960 Dasasruta skandha sutram = Dashashrutskandhsutram / Ghasilalaji-viracitaya 'Muniharsini'tikaya samalankrtam Hindigurjarabhasanuvadasahitam ; niyojakah Srikanhaiyalala. 2. avrtti. Rajkota, Saurasta : A[khila]. Bha[rat]. Sve[tambara]. Sthanakavasi Jaina Sastroddhara Samiti, Vira samvat 2486. Vikramasamvat 2016. Isvisan 1960. 44, 451 p.; 25 cm. *[Brhatkappa with Sanskrit vyakhya and Hindi-Gujarati translation] / Ghasilala. Rajkota: Jaina Sastroddhara Samiti, 1960. = Upasakadasangasutram Upasakdasangsutram Ghasilalaji-Maharaja viracitaya Acaramanimanjusakhyaya vyakhyaya samalankrtam Hindigurjarabhasanuvadasahitam. Trtiyavrttih. Rajakota, Saurasta: Sri Akhila Bharatiya Svetambara Sthanakavasi Jainasastroddhara Samiti, Vira samvat 2487 [1961]. 6, 2, 40, 532 p.; 25 cm. Third reprint of 1936 edition. 1961-72 Bhagavati sutram = Bhagavati sutram / GhasilalajiMaharaja-viracitaya Prameyacandrikakhyaya vyakhyaya samalankrtam Hindi-Gurjara-bhasa'nuvadasahitam. Prathama-avrttih. Rajakota, Saurastra Sri [Akhila Bharatiya] Sve[tambara]. Stha[nakavasi]. Jainasastroddharasamitih, Vira samvat 2489-2498 [1961-72]. 17 v. ; 25 cm. *[Prasna-vyakarana-sutram] / Ghasilaji. Rajkota, 1962. 8, 3, 40, 952 p. geneal. table.; 25 cm. Samavayangasutram / <1962-> Sri-Samavayangasutram = Page #32 -------------------------------------------------------------------------- ________________ VILES: THE BIBLIOGRAPHY OF THE SVETAMBARA CANON 75 Ghasilalaji-Maharaja-viracitaya Bhavabodhinyakhyaya vyakhyaya samalankatam Hindi-Gurjarabhasa'nuvadasahitam. Prathama-avrttih. Rajakota (Saurasta) : Sri Akhila). Bha[ratiya). Sve[tambara). Stha[nakavasi). Jainasastroddharasamiti, Vira samvat <2488->. <1962->, v.; 25 cm. 1963 Sri Jnatadharmakathangasutram = Shree Jnatadharama kathanga sutram / Ghasilalji-Maharaja viracitaya Anagaradharmamrtavarsinyakhyaya vyakhyaya samalankrtam Hindi-Gurjara-bhasa'nuvadasahitam. Prathama-avsttih. Rajakota, Saurastra : Sri A[khila). Bha[rata). Sve(tambara). Stha[nakavasi). Jainasastro ddharasamiti, Vira samvat 2489 (1963). 3 v.; 25 cm. 1964-65 Sri-Sthanangasutram - Sthanang sutram / Ghasilalaji Maharaja-viracitaya Sudhakhyaya vyakhyaya samalankrtam Hindi-Gurjara-bhasa'nuvadasahitam. Prathama-avrttih. Rajakota (Saurastra) : Sri Askhila). Bhasrata). Svestambara). Sthanakavasi Jaina Sastroddhara Samiti, Vira samvat 2490 92 [1964-66). 5 v.; 25 cm. 1965-66 Sri Rajaprasniyasutram= Raajprashniya sutram: Ghasilalaji Maharaja-viracitaya Prameyacandrikakhyaya vyakhyaya samalankrtam Hindi Gurjara-bhasa'nuvadasahitam / niyojakah ... Panditamuni-Srikanhaiyalalaji-Maharajah. "Prathamo-avsttih." Rajakota, Saurastra : A[khila). Bha[ratiya] Svestambara] Stha(nakavasi] Jainasastroddharasamitipramukhah Sresthi-Sri-Santilala-MangaladasabhaiMahodayah. Vira-samvat 2491-92 (1965-66]. 2 v. ports. ; 25 cm. 1967-68 Sri Anuyogadvarasutram / Ghasilalaji-Maharaja viracitaya Anagaradharmamrta-varsinyakhyaya vyakhyaya samalankrtam Hindi-Gurjara-bhasa'nuvadasahitam. Rajakota, (Saurastra) : Sri Askhila). Bha[ratiya). Sve(tambara). Sthalnakavasi). Jainasastroddhara Samiti, Vira samvat 2493-2494?] (1967-68). 2 v. ; 25 cm. 1969 J[aisnacarya-Jainadharmadivakara-pujya-Sri-Ghasilalavrati viracita-bhasyasamalankrtam (1) Srivyavaharasutram = Shree Vyavhar sutram : evam Curnibhasyavacurisamalankstam (2) Sribihatkalpasutram = Shree Bruhatkalpa sutram / niyojakah Srikanhaiyalaji-Maharajah. 1. avrtti. Rajakota, Saurastra : Sri Alkhila) Bha[rata). Svestambara] Sthanakavasi Jaina Sastroddhara Samiti, Vira samvat 2495; Page #33 -------------------------------------------------------------------------- ________________ 76 Shree Nishith sutram: JainacaryaJainadharmadivakara-Sri-pujya-Ghasilala-vrati-viracitaya Curnibhasyavacurirupaya vyakhyaya samalankrtam / niyojakah Kanhaiyalala. Rajakota, Saurastra: A[khila]. Bharata]. Sveltambara]. Stha[nakavasi]. Jainasastroddharasamiti, Vira samvat 2495. Vikrama samvat 2025. Isvi san. 1969. 20, 458, [1], 60 p. ; 3 leaves of plates; 26 cm. 1969-71 Sri-Sutrakrtangasutram / Ghasilala-vrativiracitaya Samayarthabodhinyakhyaya vyakhyaya samalarkrtam HindiGurjara-bhasa'nuvadasahitam. Prathama-avrttih. Rajakota, Saurastra: Sri A[khila]. Bharatiya]. Sve[tambara]. Sthanakavasi Jaina Sastroddhara Samiti, Vira samvat 2495-< >. Vikrama 2025-<>. [1969-71]. 4 v. ; 25 cm. [Josi 1987, 48] 1971-73 Sri-Jivabhigamasutram / Ghasilalalaji [sic]-Maharaja viracitaya Prameyadyotikakhyaya vyakhyaya samalankrtam; niyojakah Srikanhaiyalalaji. 1. avrtti. Rajakota A[khila]. Bharat] Sve[tambara]. Stha[nakavasi]. Jainasastroddharasamiti. Vira-samvat 2497-99. Vikrama-samvat 202729. Isavisan 1971-73. 2 v.; illus; 26 cm. 1973 JAIN JOURNAL: Vol-XXXV, No. 2 October 2000 Vikrama-samvat 2025. Isvisan 1969. 7, 15, 272, 40, 10, 156, 23 p. 3 leaves of plates; 25 cm. Sri-Nisithasutram *Sricandraprajnapti-sutram/Ghasilalaji Maharaja-viracitaya candajnaptiprakasikakhyaya vyakhyaya sammalankrntam [sic] niyojakah Kanhaiyalalaji. 1. avrtti. Rajkot : Sri A. Bha. Sve. Stha. Jainasastorddhara Samiti, 1973. 8, 715 p. ; 25 cm. [CRL catalogue 74-902919] 7 Mahavira Jain Vidyalaya, 1968-<1989>9 1 9. Nandisuttam: Siridevavayagaviraiyam Anuogaddaraim ca: Siriajjarakkhiyathera-viraiyaim / sampadakah Punyavijayo Munih Dalasukha Malavaniya, Amrtalala Mohanalala Bhojaka ity etau ca. Bambai: Sri Mahavira Jaina Vidyalaya, Vira sam. 2494 [1968]. 11, 54, 70, 127, 467 p. ; 25 cm. (Jaina-Agama-granthamala: granthanka 1).10 Review of the series by Colette Caillat. 1983. The recent critical editions of the Jain Agama, ZDMG Supplement 5, XXI Deutscher Orientalistentag vom 24. bis 29 Marz 1980 in Berlin (Wiesbaden: Franz Steiner, 1983). p. 234-40. 10. Muni Jambuvijaya. 1993. The Jaina Agama series. In Jain studies in honour of Jozef Deleu/edited by Rudy Smet and Kenji Watanabe. Tokyo: Hon-no-Tomosha, 1993. xvi. 504 p. 22 cm. p. 1-12. "This article has been compiled on the basis of the introduction of volume 1 (1968) of the Jaina Agama series." Page #34 -------------------------------------------------------------------------- ________________ ca 2 (2)). , WILES: THE BIBLIOGRAPHY OF THE SVETAMBARA CANON 77 2(1) Ayarangasuttam - Acarangasutram / sampadaka Muni Jambuvijayah; sahayako Muni Dharmacandravijayah. Bambai : Sri Mahavira Jaina Vidyalaya, Vira samvat 2503 (1977). 89, 422 p. 25 cm. (Jaina-agama-granthamala ; granthanka 2, (1)). 2(2) Suyagadangasuttam = Sutrakrtangasutram : Pancama ganaharabhayavamsiri-suhammasamiviraiyam biiyam Angam/ sampadakah Muni Jambuvijayah; sahayaka Muni Dharmacandravijayah. Bambai : Sri Mahavira Jaina Vidyalaya, Vira samvat 2504 (1978). 11, 82, 376 p. ; 25 cm. (Jaina-Agama-granthamala : granthanka 2 (2)). Thanangasuttam Samavayamgasuttam ca = Sthanangasutram Samavayangasutram ca : Pancamaganaharabhayavamsirisuhammasamiviraiyam taiyam cautthamca Angam / sampadakah Muni Jambuvijayah ; sahayakah Muni Dharmacandravijayah. Bambai : Sri Mahavira Jaina Vidyalaya, Vira samsvat] 2511. Vikrama sam 2041. 1. sa. 1985. 86, 713 p.; 25 cm. (Jaina-Agama-granthamala ; granthanka 3). Viyahapannatlisuttam: Pancamaganaharaajjasuhammatherabhagavamparampara-samkaliavayananugayam 'Bhagavatisuttam' ti pasiddhanamagam pancamam Angam / sampadakah Becaradasa Jivaraja Dosi (sahayakah (v. 2) parisistadinirmata (v. 3) Amrtalala Mohanalala Bhojaka). Bambai : Sri Mahavira Jaina Vidyalaya, Vira samvat 250008. Vikrama sam. 2030-38. I. sa. 1974-82.3 v.; 25 cm. (JainaAgama-granthamala; granthanka 4). Nayadhammakahao = Jnatadharmakathangasutram : pancamaganaharabhaya-vamsirisuhammasamiviraiyam chattham Angam / sampadakah, Muni Jambuvijayan ; sahayakah Muni Dharmacandravijayah. Bambai : Sri Mahavira Jaina Vidyalaya, Vira sam. 2516 (1989). 33, 129, 570 p.; 25 cm. (Jaina-agama-granthamala; granthanka 5). Sirisamajjavayagaviraiyam Pannavanasuttam/ sampadakah Punyavijayo Munih ; Dalasukha Malavaniya : Amrtalala Mohanalala Dhojaka ityetau ca. Bambai: Sri Mahavira Jaina Vidyalaya, Vira sam. 2495-97 (1969-71). 2 v.: 25 cm. (Jaina Agama series; granthanka 9, bhaga 1-2). Dasaveyaliyasuttam / Sirisejjambhavatherabhadantaviraiyam: Uttarajjhayanaim, Avassayasuttam ca / anegatherabhadantaviraiyaim : sampadakau Punyavijay 15 Page #35 -------------------------------------------------------------------------- ________________ 78 17 JAIN JOURNAL: Vol-XXXV, No. 2 October 2000 Munih; Pandita Amrtalala Mohanalala Bhojaka iti ca. 1. samskarana. Bambai: Sri Mahavira Jaina Vidyalaya, Vira sam. 2503 [1977]. 91, 664 p.; 25 cm. (Jaina-Agamagranthamala; 15) Vivihatherabhadantaviraiyaim / Painnayasuttaim: sampadakau Punyavijayo Munih, Mohanalalatmajah samskarana. Bambai: Sri Pandita-Amrtalala-Bhojakast Mahavira Jaina Vidyalaya Ve sam. 2510-<2513> [1984<1989>]. <3> v. ; 25 cm. (Jaina-Agama-granthamala; no. 17). [v. 3 1989 not yet seen] 8 Jaina Visva Bharati or Ladanun edition 1974-89 This edition has been produced from the Terapanth centi e in Ladanun, Rajasthan, under the direction of Acarya Tulsi and his designated successor Yuvacarya Mahaprajna (see also Dundas 1992, 223). Acarya Tulsi first suggested the project in 1955, however only in 1957 did the editing begin, it was completed in 1980 (Uvangasuttani 1989, 13-14). 11 The aim of the project being to edit the thirty-two Agamas and make them easy for individuals to get hold of (p. 27). As part of the larger project a number of dictionaries have also been prepared Agama sabdakosa (1980, detailed below); Ekarthaka kosa (1984), Nirukta kosa (1984); and Desi sabdakosa (1988) details of the last three dictionaries are given in the separate section on dictionaries below). 1974 or 1975 Angasuttani: Niggantham pavayanam / sampadaka Muni Nathamala [Yuvacarya Mahaprajna]. Ladanun, Rajasthana Jaina Visva Bharati [Samsthana], Vikrama samvat 2031 [1974 or 1975]. 3 v.; 25 cm. 11. The small booklet detailed below gives an overview of the process of creating this edition Agama-sampadana ki samasyaem / Yuvacarya Mahaprajna: sampadaka Muni Vimalakumara. Ladanum: Jaina Visva Bharati, 1993. chaha', 116 p.; 18 cm. Contents: 1. Agama sampadana ka itihasa 1-35.2. Agama sampadana ki samasyaem [36]-37. 3. Patha-sampadana ki paddhati [38]-45. 4. Eka prati ko adhara manakara svikrta patha ki samasyaem [46]-53. - 5. Pathantara ki parampara [54]-66. 6. Uccarana hetuka patha parivartana [67]-69. - 7. Patha-samsodhana aura anubhava [70]-71. - 8. Sanksipta aura vistrta patha [72]-81. 9. Varnaka aura java pada ki samasya [82]-87. - 10. Samalocana aura hamara drstikona [90]-99. 11. Agama ki bhasa [100]-104. - 12. Chandasastra [105]. - 13. Sahayoganubhuti [106]-107. Parisista; Sthana aura vyakti [1081-116 last page torn]. [RW] Page #36 -------------------------------------------------------------------------- ________________ . Bhagavai : Viahapainama samvat 2049. 1994. desao. NILES: THE BIBLIOGRAPHY OF THE SVETAMBARA CANON 79 (1) Ayaro. Suyagado. Thanam. Samavao. 97, 954, 51 p. 2. samskarana. Vikrama samvat 2049. 1992. (2) Bhagavai : Viahapannatti. 56, 1048, (45) p. 2. samskarana. Vikrama samvat 2049. 1992. (3) Nayadhammakahao, Uvasagadasao, Antagada dasao, Anuttarovavaiyadasao, Panhavagaranaim Vivagasuyam. 55, 813, 47 p. 2. samskarana. Vikrama samvat 2048. 1992. "Original text critically edited." Parts 1-3 of a complete edition of the canon. Contents v. 1: Granthanukrama (8). - Prakasakaya (9)-12. - Sampadakiya / Muni Nathamala (13)-29. - [Dvitiya samskarana / Yuvacarya Mahaprajna (29)]. - Bhumika / Acarya Tulasi (30)-44. - Editorial (= English version of Sampadakiya) (45)-52. - (Foreword - English version of Bhumika] [53]-70. - Visayanukkama (71)-97. - Sanketanirdesika (98) - Ayaro (1)-250. - Suyagado (251)-486. - Thanam (487)-823. - Samavao (8251-954. - Parisista 1. Sanksipta-patha, purta-sthala aura purti adhara-sthala (1)40. - Parisista 2. Alocya-patha tatha vacanantara [41]-51. Contents v. 2: Granthanukrama (8]. - Prakasakiya / Acarya Tulasi (9)-12. - Sampadakiya / Muni Nathamala (13)-21. - Bhumika / Acarya Tulasi (23)-27. - Preface - English version of Prakasakiya] 29]-34. - Editorial [ = English version of Bhumika) (35)-44. - Bhagavai Visayanukkama [45]-55. - Sanketa nirdesika 56. - Bhagavai Viahapannatti 1-1048. - Parisista 1. Sanksipta-patha, purta-sthala aura purti adhara-sthala [1]-44. - Parisista 2. Purakapatha (45). Contents v.3: Granthanukrama (8]. - Prakasakiya (91-12. - [Dvitiya samskarana (12]). - Sampadakiya / Muni Nathamala (13)-20. - Bhumika / Acarya Tulasi (21)-30. - Preface (=English version of Bhumika] (31)-40. - Visayanukkama (41)-54. - Sanketa nirdesika (55). -- Nayadhammakahao (1)-391. - Uvasagadasao (393)-537. - Antagadadasao (539)-610. - Anuttarovavaiyadasao (611)633. - Panhavagaranaim (635)-713. - Vivagasuyam (715)813. - Parisista 1. Sanksipta-patha, purta-sthala aura purti adhara-sthala (1)-47. ANU BL1312.2 1975 and PK5003.A52 1974 v. 1, 2, 3 Agama sabdakosa: angasuttani sabdasuci = Word-indexes of Angasuttani / sampadaka Yuvacarya Mahaprajna. Ladanun, Page #37 -------------------------------------------------------------------------- ________________ JAIN JOURNAL : Vol-XXXV, No. 2 October 2000 Rajasthana : Jaina Visva Bharati, Vikrama samvat <2037>. <1980->, <1 v. >; 25 cm. ANU BL1310.6.A33 1980 v. 1 1987-89 Uvangasuttani / sampadaka Yuvacarya Mahaprajna. Ladanun, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2044-45. I[svi san). 1987-89. 2 v.; 25 cm. v. 1. Ovaiyam. Rayapaseniyam. Jivajivabhigame. 74, 515, 774 p. v. 2. Pannavana. Jambuddivapannatti. Candapannatti, Surapannatti. Upanga Nirayavaliyao. Kappavadimsiyao. Pupphiyao. Pupphaculiyao. Vanhidasao. 75, 1100. Contents v. 1: Granthanukrama [8]. - Prakasakiya (9)-11. - Sampadakiya / Yuvacarya Mahaprajna (13)-30. - Bhumika / Acarya Tulasi [31]-40. - Editorial /[ = English translation of Sampadakiya] [41]-59. - Introduction (= English translation of Bhumika] [61]-70. - Visayanukrama [711-74. - Sanketa-nirdesika (75). - Ovaiyam (1)-77. - Rayapasenaiyam [78]-212. -- Jivajivabhigame (213)-515. - Parisista 1. Sanksipta-patha, purta-sthala aura adharasthala nirdesa (519)-534. - Parisista 2. Tulanatmaka (parallels in other texts) (535)-544. - Parisista 3. Saddasuci. 545-774. - Suddhi-patra 1775]. Contents v. 2 : Granthanukrama (8]. - Prakasakiya [9]11.- Sampadakiya / Yuvacarya Mahaprajna (13)-28. - Bhumika / Acarya Tulasi [29]-37. - Editorial (= English translation of Sampadakiya) (39)-57. -- Introduction (59)67. - Visayanukrama [69]-75. - Pannavanasuttam [1]-356. -- Jambuddivapannatti (357]-588. - Candapannatti. Surapannatti (589)-712. - Nirayavaliyao. Kappavadimsiyao. Pupphiyao. Pupphaculiyao. Vanhidasao. (713)-785. -- Parisista 1. Sanksipta-patha, purta-sthala aura purti adharasthala (789)-805. - Parisista 3. (sic) (Saddasuci) (807)-1093. -- Suddhi patra (1094)-1096. - [Corrections to] Sabdakosa [1097]-1100. "Original text critically edited." Forms v. 4 (parts 1 and 2) of a complete edition of the Jaina Agama. ANU BL1312.5 1987 v. 1, 2 Navasuttani: Avassayam, Dasavealiyam, Uttarajjhayanani, Nandi, Anuogadaraim, Dasao, Kappo, Vavaharo, 1987 Page #38 -------------------------------------------------------------------------- ________________ WILES : THE BIBLIOGRAPHY OF THE SVETAMBARA CANON Nisihajjhayanam / vacana pramukha Acarya Tulasi ; sampadaka Yuvacarya Mahaprajna. Ladanun, Rajasthana : Jaina Visva Bharati, Vikrama samvat 2044. I[svi san). 1987. 140, 812, 29, 320 p.: four pages of plates; 25 cm. Contents : Granthanukrama (8). - Prakasakiya (9)-11. - Sampadakiya / Yuvacarya Mahaprajna (13)-45. - Bhumika/ Acarya Tulasi (47)-66. - Editorial (681-102. - Introduction (103)-121. - Visayanukrama [122]-137. - Sanketa nirdesika [139]-140. - Avassayam (1)-23. - Dasavealiyam (25)-88. - Uttarajjhayanani (89)-244. - Nandi (245)-288. - Anuogadaraim (289)-421. - Dasao (423)-560. - Kappo (561)595. - Vavaharo (597)-661. - Nisihajjhayanam (663)-712. - Parisista 1. Sanksiptapatha, purta-sthala aura adharasthala nirdesa (1)-12. - Parisista 2. Tulanatmaka [Nandi and Samavao) (13)-29. - Suddhi patra (30]. - Parisista 3 Navasuttani saddasuci (15 505 words). [1]-319. - Atirikta suddhi-patra 319-320. Forms v. 5 of a complete edition of the Jaina Agama. ANU NBC + 1 484 435 nal Use Only Page #39 -------------------------------------------------------------------------- ________________ BOOK REVIEW Nirgrantha (Vols. I and II): edited by M.A. Dhaky and Jitendra B. Shah, Sharadaben Chimanbhai Educational Research Centre, Darshan, Opp. to Ranakpur Society, Shahibag, Ahmedabad-380 004. Vol. I (1995), Price Rs. 150.00 and Vol. II (1996), Price Rs. 200.00. One of the greatest contributions to the domain of Jainistic studies, almost at the end of the twentieth century, is the publication of the Journal, Nirgrantha, an annual Journal of the Sharadaben Chimanbhai Educational Research Centre, Ahmedabad. It is a trilingual Journal: English, Gujarati and Hindi. It is a Journal of nearly 300 pages of quarto size with good quality of paper and printing. The contents of the Journal are primarily Jainistic or any study relating to Jainism. The Journal contains lots of plates of different kinds concerning Jainism. In one word, it is a Journal of quality for all sorts of studies on Jainism. The Journal is unique in three respects: First, most of the articles, if not all, elicit admiration from the scholars, because of their quality in finding the truth of the research. The scholars who have contributed are authorities on their subjects, and the articles written by them are new in their outlook. Secondly, the Journal is free from mistakes or errors. The proof-reading is careful and meticulous. Finally, all the articles are edited by two able editors-M.A. Dhaky and Jitendra B. Shah. It goes without saying that these two editors will not let anything go unless they are satisfied and the articles are upto the mark. The volume one of the Nirgrantha contains a style sheet for the papers in English. In it, the method of transliteration, diacritical marks and other relevant things necessary for writing an article of an international standard are given. If anybody wants to contribute any article in this Journal, he will have to follow them. Most of the things of the style sheet are standard and are followed by most of the scholars. But there are some cases where the Nirgrantha deviates from the standard; e.g; m (m and dot over) for anusvara in many standard Sanskrit, Prakrit and Pali books is written as m (m and dot below). It will be difficult for a scholar to remember different style sheets for different Journals. Howsoever minute it might be, the Nirgrantha style sheet is different from the MLA Style Sheet (1970) in some respects; e.g.; infra, supra and op. cit. are accepted in MLA, whereas they are to avoided in the Nirgrantha. For dha, tha is not written, be Page #40 -------------------------------------------------------------------------- ________________ BOOK REVIEW but !ha is a different sound used in Vedic and Pali. Moreover, some of the transliterations are different for some exotic languages. But I believe that in order to avoid some chaos and catastrophies, and in order to maintain a standard, some sorts of direction for transliteration are necessary. In conclusion, I can say that this Journal is a prestigious one and will earn name and fame on its own merits. It will be a good harbinger of the coming 21st century. 83 Satya Ranjan Banerjee Anuyogadvara sutram (Part I): the text originally edited by His Holiness Muniraja Punyavijayaji Maharaja with three commentaries Jinadasa Gani Mahattara's Curni, Haribhadra Suri's Vivrti and Maladhari Hemacandra Suri's Vrtti is critically edited by Muni Jambuvijaya, disciple of His Holiness Muniraja Shri Bhuvanavijayaji Maharaja, Jaina-Agama-Series No. 18(1), Shri Mahavira Jaina Vidyalaya, Bombay, 400 036, pp. 517, 1999; Price Rs. 450.00. Though there are many editions of the Anuyogadvara-sutra, this above mentioned edition edited by Muni Jambuvijayaji Maharaja has surpassed all the earlier editions in the principles of editing and printing. The quality of the yellowish paper is very good and the type used for the text is very soothing and pleasing to the eyes. The original text is given in a bold type followed by three other varieties of big type used in the commentaries. This edition contains three commentaries, namely, Jinadasa Gani Mahattara's Cumi, Haribhadra Suri's Vivrtti and Maladhari Hemacandra's Vrtti. Though all these commentaries were already published, the editor has consulted some new manuscripts for this edition. It has a long introduction in Gujarati. It has also five appendixes. The text is divided into sections. The readings of the text are done conscientiously and hence can be more dependable than the other editions. But some readings, such as, tamjaha, could have been avoided. tamjaha in Prakrit is to be printed separately as tam jaha, because it is not a compound word, even though its Sanskrit equivalent tadyatha is printed jointly. About the selection of the cerebral n, the uniformity could not be maintained; e.g; in SS 15(5) the reading tinham saddanayanam, the dental n in saddanayais to be changed into cerebral n as saddanayanam as the reading with cerebral n is also found in the commentaries of Jinadasa Gani's Cumi and Haribhadra's Vivrtti,even though in Maladhari Hemacandra's vrtti, Page #41 -------------------------------------------------------------------------- ________________ JAIN JOURNAL: Vol-XXXV, No 2 October 2000 the dental n. is printed. Similarly negama-vavaharanam in SS108(i) and negama-vavaharanam in SS108(2). Except for a few readings like these, the author is uniform in the selection of cerebral n. Even in conjunct the editor has chosen double cerebral nn which is quite in conformity with the system of the Prakrit language, even though Jacobi prefers dental conjunct nn to cerebral ones. 84 I have already said earlier that this edition is more reliable than the others. The editor, Muni Jambuvijayaji Maharaja, is to be congratulated for this unique text which reflects his scholarship and his editorial discipline. I believe that the text will be liked by the scholarly world. Satya Ranjan Banerjee Mahabandha (Vols I and II): the volume one of the Mahabandha of Bhutabali is edited and translated into Hindi by Pt. Sumeruchandra Diwakar, and the volume two is edited by Pt. Phoolchandra Siddhantashastri from Bharatiya Jnanapitha, 18 Institutional Area, Lodi Road, New Delhi-110 003, 1998, Price Rs. 140.00 (each). The Bharatiya Jnanapitha, New Delhi, is to be thanked for reprinting the famous Digambara canon Mahabandha for the benefit of the scholarly world. It has several parts of which two volumes have come out. I hope the other volumes will also come out soon. The quality of paper and the binding of the book are excellent and praiseworthy. This reprint is better than even the original edition. The first edition of the Mahabandha was originally published in 1947 under the Moortidevi Jain Ganthamala series which was established in February 1944 under the General Editorship of Dr. Hiralal Jain and Dr. A.N. Upadhyc. The volume one (Prakrti Bandha dhikara) had a second reprint in 1966 and a third one in 1998 under the editorship of Dr Devendra Kumar Shastri who has written a preface to this reprint The second volume (Sthiti-bandhadhikara), first published in 1953, and containing an elaborate discussion on Karma-mimamsa, was reprinted second time in 1998. According to Shastriji, both the volumes are furnished with the summary of the contents of the two volumes of the Mahabandha. The two volumes have two elaborate introductions on the Mahabandha. I can only hope that the rest of the volume will be published soon maintaing the standard of the first two books. Satya Ranjan Banerjee Page #42 -------------------------------------------------------------------------- ________________ BOOK REVIEW Studies in Jainism--published by the Ramakrishna Mission Institute of Culture, Gol Park, Calcutta, 1997, pp. 171, Price Rs. 75.00. 85 The present study is a collection of twelve articles of varied interest concerning Jainism. All the articles are written by persons who are authorities on Jainism. It contains the history and philosophy of Jainism including its ethics. Literature of Jainism is written by Hiralal Jain. A comparative study between Brahmanic and Sramanic Cultures is written by Sagar Mal Jain. All the articles printed in this book are worth reading and contain all that is needed for Jainism. The Ramakrishna Mission Institute of Culture is to be congratulated for printing such a nice collection of articles on Jainism. This book can be recommended for the reading public. Satya Ranjan Banerjee Nagin J. Shah (ed.). Jaina Theory of Multiple Facets of Reality and Truth. Motilal Banarsidass Publisher Private Limited & Bhogilal Leherchand Institute of Indology, Delhi, 2000. Pages xvi + 134 + index. Rs. 200. The title under review is a collection of articles originally presented at a seminar on Jain Logic and Epistemology held in 1990. To these have been added two more by K.C. Bhattacharya and Atsushi Uno which were published earlier. Altogether eleven articles along with an introduction contributed by the editor explore several aspects of anekantavada or syadvada. Dr. Shah in his introduction gives a brief overview of the central philosophy of Jainism. He believes that even non-Jain thinkers like Sayanacarya accepted the possibility of the co-existence of being and non-being. He cites a sentence from Sayana's commentary on the Rgveda (10.129.1) in support of his contention. He also detects the idea of such a co-existence inhering in some passages in the Upanisads (e.g., Isa, 5; Katha, 2.20; Prasna, 2.5). Shah finds fault with the interpretation of the term, syat as 'may Page #43 -------------------------------------------------------------------------- ________________ 86 JAIN JOURNAL : Vol-XXXV, No. 2 October 2000 be', for it might 'impart a sceptical form to syadvada.' In his view syadvada has got nothing to do with scepticism. It is not the uncertainty of judgement, but its conditional or relative character that is expressed by the qualifying particle 'syat'. Subject to the conditions under which any judgement is made, the judgement is valid beyond doubt. So there is no room for scepticism. All that it implies is that every assertion which is true, is true only under certain conditions. He also makes an interesting observation : Jaina philosophy considers itself as a synthesis of different systems of philosophy-materialism not excluded.' Shah is also of the opinion that the roots of anekantavada lie in the doctrine of non-violence, ahimsa. In order to drive his point home he quotes a number of passages from the Mahabharata, Vyasa-Bhasya and Yogavartika. This, however, does not effectively answer the point raised by Dayanand Bhargava, who writes : 'This view (scil. anekantavada has its origin in ahimsa) has been expressed by so many other modern scholars (besides Nathmal Tatia, Mahendra Kumar, H.D. Kapadia and B.K. Matilal] but I have not found any such hint in the ancient or medieval work. It is admirable if it could be shown that the doctrine of anekanta demonstrates a spirit of toleration, understanding and respect for the views of others. But unless we get such sentiments expressed in the old writings, we can only accept this as a modern extension of an old doctrine' (p. 115). Indeed, it is one thing to say that ahimsa is a cornerstone not only of Jainism but of post-Vedic Brahminism and Buddhism as well, and quite another thing to say that ahimsa forms the backdrop of anekantavada. If it were really so, the same doctrine would have flourished in the Brahminical and Buddhist traditions too. However, the fact is that all non-Jain philosophical systems remained uncornpromisingly ekantavadin, and anekantavada turned out to be an exclusive doctrine of the Jains. Bhargava has rightly pointed out that the acceptance of modern interpretation requires an overhauling of the whole logical and epistemological literature of the Jains.' He further says: 'I am afraid that this literature does not show any more catholicity of the Jaina out-look (sic) towards the non-Jaina systems than any other school of Indian philosophy shows' (p. 115). He, therefore, proposes the following course : The scholars of Jaina logic and Jaina epistemology should review the ancient philosophical literature of the Jainas to decide as to whether (i) thus literature is really more catholic Page #44 -------------------------------------------------------------------------- ________________ BOOK REVIEW than the literature of the non-Jains or (ii) the claim that anekanta is characterised by toleration is not valid or (iii) the portion dealing with the debate between the Jains and nonJains have (sic) to be rewritten (p. 116). This is indeed a welcome suggestion and one might venture to remark that the Jain philosophers right from the author of the Sutrakrtanga-sutra down to, say, Vadidevasuri and Prabhacandra do not show any particular tolerence to other doctrines. When it comes to philosophical debates, we find the same kind of sharpness in rejecting the opponent's point of view, having recourse to irony and satire and all other paraphernelia of polemics practised by non-Jain philosophers. Bhagchandra Jain seeks to find rudiments of anekantavada in early Pali literature. His examples are impressive but they raise a pertinent question : why did the Buddhists not develop the doctrine of anekanta even though thinkers both before and after the Buddha had formulated general schemes quite akin to it? Bhagchandra Jain himself shows the difference between the Jain and Buddhist schemes in the following manner : 'According to the Jaina scheme all the seven propositions would be true from relative standpoints, while in the Buddhist scheme only one proposition would be true. The propositions are not considered logical alternatives in Jainism as considered in Buddhism' (p. 125). It seems that in the philosophical serment which India witnessed in the fifth century BCE quite a number of logical and epistemological doctrines were thrown up and anekantavada was one among many. Sanjaya Belatthiputta might have been the originator of the approach, although it was developed and given final shape by the Jain philosophers. (Incidentally, there is no evidence to prove that Sanjaya adhered to the doctrine of non-violence). It is not possible to deal with all the articles included in this volume. Nor is it necessary because most of the contributors have elected to follow the beaten track. They have presented the views of their predecessors without attempting to synthesize them or offer any alternative views of their own. One, for example, would like to know whether the word, syat should be applied even when the well attested conclusions in the field of physical and biological sciences are presented. Does a statement like "The earth moves round the sun' warrant such multiple responses as 'Somehow it is true', 'Somehow it is not true,' etc.? Similarly such propositions as 'Rabindranath Tagore is the author of Gitanjali', 'Columbus discovered America in 1492,' 'Water quenches thirst', etc. do not seem to be amenable to the Jain Page #45 -------------------------------------------------------------------------- ________________ JAIN JOURNAL Vol-XXXV, No. 2 October 2000 Seven-fold approach (saptabhanginaya). What about the truth-value of the axioms and postulates of Euclidean geometry? The claim that anekantavada can be applied to everything under the sun seems to be sheer exaggeration. 88 B.K. Matilal and Pradeep P. Gokhale have raised the question: How far can syadvada be reconciled to the three laws of thought which form the basis of classical European logic, more particularly whether or not it goes against the law of the excluded middle (principium exclusi tertii). Now, dialectical logic too denies the absolute validity of the law of the excluded middle. As G. Plekhanov puts it: 'If you are asked whether a body that is in motion is located at a particular place at a particular moment, you will be unable, however hard you try, to give an answer using Ueberweg's rule, i.e., the formula "Yes is yes, and No is no." A moving body is at a particular place, and at the same time it is not there.' (Selected Philosophical Works. Vol. 3, Moscow, 1976, p. 74). Does syadvada consider matter in motion or in a state of rest? No definite answer to this is found in the articles included in this volume. As regards the conditional nature of every assertion emphasized by several contributors we would like to mention that while stating the principle of non-contradiction Aristotle too wrote as follows: The same attribute cannot at the same time belong and not belong to the same subject in the same respect' (Metaphysics, 4.3). And he further said, 'We must presuppose, in face of dialectical objections, any further qualifications which might be added.' It has been pointed out that the medieval scholastics followed by the modern formal logicians have presented Aristotle's words in a truncated form, omitting the original qualifications made by Aristotle who was himself a dialectician. A comparative study of syadvada and the original. Aristotelian position regarding the law of non-contradiction may prove fruitful. P.P. Gokhale alone has attempted to study syadvada in relation to the new systems of logic that have emerged in the twentieth century (such as multi-valued, intuitionistic and constructive ones). Matilal, however, barely refers to the para-consistent logic and multi-valued logic without alluding to any particular school. In fact, he seems to regress immediately after advancing the suggestion that 'Inexpressible' has been acknowledged 'as a viable semantic concept in the discussion of logical and semantial (sic) paradoxes in modern times' (p. 14). He Page #46 -------------------------------------------------------------------------- ________________ BOOK REVIEW then hastens to add : "[M]y reference to the non-bivalence logic or para-consistent logic, in connection with Jainism, should not be overemphasized' (p. 15). The problem of relativism inherent in syadvada has been discussed by several contributors. However, no concrete solution has been offered as to the relation between the indeterminate and the relative. L.V. Joshi's article on the Nyaya criticism of anekanta based on Bhasarvajna's Nyayabhusana raises, inter alia, a crucial problem related to the editing of ancient texts from MSS. Svami Yogindrananda, editor of the editio princeps of Nyayabhusana, has put a passage within quotes 'assuming it to be a verbatim quotation from Akalanka's Tattvarthavartika.' Such an assumption proved to be ill founded, for Bhasarvajna merely 'paraphrased the TAV text in his own way' (p. 97). Ramjee Singh's article on the relevance of anekanta in modern times may appear to some readers as an exercise in wish-fulfilment. One also wonders whether the conception of sarvadharmasamanvaya (syncretism) sound in the Vallabha philosophy can truly be called 'one of the forms of this very saptabhangi' (asserted by no less a scholar than Pandit Sukhlalji Sanghvi). D.S. Kothari's article first appeared in Niels Bohr. A Centenary Volume, edited by A.P. French and P.J. Kennedy (Cambridge, Mass.: Harvard University Press, 1985, pp. 325-31) - a fact not mentioned anywhere in this book. Matilal once refers to Haribhadra's Sarvadarsana-samgraha and Gunaratna's commentary on it (p. 4). Should the title not be Saddarsana-samuccaya ? (See the work in the Bibliotheca Indica edited by Luigi Suali, Calcutta : The Asiatic Society, 1905-14, reprinted 1986). Speaking of syadvada and its scientific potential, J.B.S. Haldane once pointed out that, instead of devoting our lives to composing commentaries on the works of ancient philosophers, we can do mere honour to their memories by thinking for ourselves, as they did ('The Syadvada System of Predication', Sankhya, Vol. 18 Parts I and II, 1957, p. 199). Unfortunately we in India are still content with interpreting rather than trying to apply ancient wisdom to modern areas of research. Logic, like mathematics, should be viewed primarily as a tool for application in different fields of study. However, to most of the writers who have contributed to this volume, logic is nothing more than an end in itself, something per se. It is high time that we learn to think in terms of nravis as well Page #47 -------------------------------------------------------------------------- ________________ JAIN JOURNAL: Vol-XXXV, No. 2 October 2000 However, the trend of the times, both in India and abroad, seems to have reverted to a form of neo-scholasticism, extolling pure logic (both of the Navya-Nyaya variety and other alternative systems) for its own sake. Gone are the days when A.C. Burnell could say, referring to a famous late-medieval logic-chopper: '[his] match at saying "an infinite deal of nothing" it would be difficult to find'. One also recalls rather wistfully some of the comments on the cultivation of Nyaya contained in Rammohun Roy's letter to Lord Amherst (11 December 1823) and Ishwarchandra Vidyasagar's Report on the Sanskrit College, Calcutta (16 December 1850). 90 Only a few misprints (mostly minor) mar this excellently produced work. The publishers are to be congratulated on bringing out this volume. The index, too, is very exhaustive and altogether commendable. Ramkrishna Bhattacharya Page #48 -------------------------------------------------------------------------- ________________ NEWS ON JAINISM AROUND THE WORLD Idol discovered A 16th century metal image of Ananta Thirthankara in Khadgasana (standing posture) has been discovered from a Jain temple at Shiralgi in Siddapur taluk of Uttara Kannada district in Karnataka. The Hindu, Tuesday, April 15, 1997 Mahavira sculpture found A rare sculpture of Mahaveera, seated on a lion peetha, meditating and flanked by two chauri bearers, and bearing a Kannada inscription was discovered at Lakshemeshwar of Shirahatti taluk in Gadag district of Karnataka. Department of Archaeology and Museums epigraphist Sulochana Potnis in a press release here said the sculpture had historical significance as the inscription on the pedestal speaks of the 'Shree Moola Sangha Devaru'. The script dates back to the 12th century and throws light on 'sangha' in the Jain religion, instituted by Mahaveera. Potnis said the sculpture was discovered from behind a basti considered as the place of 24 Thirthankaras. The Indian Express, Tuesday, February 17, 1998 First Jain fair commences in Chennai The first-ever Jain fair in the country, an exposition of Jain tenets, culture, tradition and values of Jainism, was inaugurated in Chennai, amidst great fanfare today. Organised by the Sri Madras Jain Sangh on the seven-acre sprawling campus of the Sri Jain Dadawadi, under the aegis of Acharya Rajyashsurishwarji Maharaj Saheb, the ten-day sair comprises mechanised and still displays of historical events, separate theatre for video shows, meditation hall, besides seven pavilions (named 'nonviolence', 'reverence for life', 'golden age of history', 'Jain philosophy', 'model life', 'temple of knowledge' and 'children's paradise'). The highlight, however, is the 'Samvasaran', the 30ft high multi-storeyed structure replete with light and sound effects. Page #49 -------------------------------------------------------------------------- ________________ JAIN JOURNAL: Vol-XXXV, No. 2 October 2000 Elder statesman and former Governor of Maharashtra C Subramaniam received the first day special cover released on the occasion by Chennai Chief Post Master General S Jayaraman. In his presidential address, he said that the problems of the future were scarcity of food and water and how best science and religion could be synthesised. Pointing out that 20 per cent of agricultural production was wasted, he exhorted people to guard against waste. Society required cleansing periodically, he said, Material wealth does not constitute happiness. But human values sustained society and contributed to human health and happiness. Jainism offered solutions to the ills facing the world and advised people to follow the basic human values of truth, value and beauty Gujarat Minister for Health and Family Welfare Ashok Bhatt said that the fair represented a renaissance of Jainism. In 2000 A.D., two crore children will be rendered orphans owing to AIDS, he said and added that the solution lay in everyone leading a disciplined life. The Gujarat government had proposed to begin a centre for non-violence in Palitana. Former Chief Minister of Madhya Pradesh Sundarlal Patwa and chiel administrative head of Brahma Kumari's Ishwariya Vishwa Vidyalaya, Mt. Abu, Prakashmaniji spoke. Former DGP Sripal detailed the objectives of the fair. Sugal Chand Jain welcomed the gathering, Vasant Kamciar introduced the chief guests and Ratanlal Maganlal Desai inaugurated the fair. The sair sponsored by Sri Punamchand Vithaldas Doshi, Vallabhipur, Mumbai, and organised by Labdhi-Raj-Padmaa Jain Centre, Chennai also includes seminars on non-violence, vegetarianism and such topics in which Union ministers, state ministers, journalists and retired police officials are expected to participate. The Indian Express, December 26. 1998 Finery and fast mark Jain festival For the nearly 80.000 strong Jain community living in the narrow alleys off the business district of Sowcarpet, last week has been an eventsul one. Because they, like their counterparts in Jain strongholds in some areas of Vyasarapadi, Vepery, T Nagar, Red Hills, Ayanavaram and Page #50 -------------------------------------------------------------------------- ________________ NEWS ON JAINISM AROUND THE WORLD 93 Triplicane, have been celebrating 'Parvaparyusanparv, Lord Mahavir's birth-day. And with such fanfare and religious fervour that it will take quite a while for the din of celebration in the seedy, festooned streets to die down. In the over 32 Jain temples (unosficial sources say there are 50 Jain temples) across the city, there has been much festivity over the last eight days. J Fatheraj Jain, member of the Sri Rajendrasuriswarji Jain Trust, says Sowcarpet's Mint street alone (that has about eight Jain temples), has witnessed a daily crowd turnout of about 10,000 people. The festival was preceded by floats and chariot-processions to welcome the high priests. The Chadraprabhuswamy temple, a marvel in marble, is the biggest in the area. All Jain temples are elaborately done up in lights, flowers and streamers. And the entire Jain community has been in it together, observing week-long--sometimes month-long-prayers and fasting, consuming nothing but boiled water. Shops have downed their shutters, and men, women and children flock to the temples night and day, dressed in their best sinery. In the footsteps of tradition, some have even abstained from wearing footwear, lest they step on ants and insects. Or the many dictates of the celebrations is an absolute reverence to all creatures big and small. Which is why, you discover, that the Jain community doesn't mind the fly and mongrel infested streets of downtown Sowcarpet. To them, it is an opportunity to express solidarity with every one of God's creations. As 40-plus Mohinidevi, who has been living in the Ravaniyar street for 20 years now, having come from her hometown in Rajasthan after her marriage to a Jain trader here, would say, in impeccable Tamil, "Today, nothing can convince us to go back to our home-town in Rajasthan." The celebrations will be rounded off tomorrow with a four-hour prayer session. After that it will back to business of life. The New Indian Express, September 14, 1999 Page #51 -------------------------------------------------------------------------- ________________ JAN JOURNAL : Vol-XXXV, No. 2 October 2000 JAIN BHAWAN : ITS AIMS AND OBJECTS The establishment of the Jain Bhawan in 1945 in the Burra Bazar area of Calcutta by eminent members of the Jain Community, the Jain Bhawan has kept the stream of Jain philosophy and religion flowing steadily in eastern India for the last over fifty years. The objectives of this institution are the following: 1. To establish the greatness of Jainism in the world rationally and to spread its glory in the light a new knowledge. 2. To develope intellectual, mora l iterary pursuits in the society. 3. To impart lessons on Jainism among the people of the country. 4. To encourage research on Jain Religion and Philosophy. To achieve these goals, the Jain Bhawan runs the following programmes in various fields. 1. School: To spread the light of education the Bhawan runs a school, the Jain Shikshalaya, which imparts education in accordance with the syllabi prescribed by the West Bengal Boarr ducation forms a necessary part of the curricula followed by the school. It has on its roll about 550 students and 25 teachers. 2. Vocational and Physical Classes : Accepting the demands of the modern times and the need to equip the students to face the world suitably it conducts vocational and physical activity classes. Classes on traditional crafts like tailoring, stitching and embroidery and other fine arts along with Judo, Karate and Yoga are run throughout the year, not just for its own students, but for outsiders as well. They are very popular amongst the ladies of Burra Bazar of Calcutta. 3. Library : "Education and knowledge are at the core of all round development of an individual. Hence the pursuit of these should be the sole aim of life". Keeping this philosophy in mind a library was established on the premises of the Bhawan. With more than 10,000 books on Jainism, its literature and philosophy and about 3,000 rare manuscripts, the library is truly a treasure trove. A list of such books and manuscripts can be obtained from the library. 4. Periodicals and Journals : To keep the members abreast of contemporary thinking in the field of religion the library subscribes to about 100 (hundred) quarterly, monthly and weekly periodicals from different parts of the world. These can be issued to members interested in the study of Jainism. 5. Journals: Realising that there is a need for research on Jainism and that scholarly knowledge needs to be made public, the Bhawan in its role as a research institution brings out three periodicals: Jain Journal in English, 'Titthayara' in Hindi and Sramana' in Bengali. In 35 years of its publication, the Jain Journal has carved out a niche for itself in the field and has received universal acclaim. Sramana, the Bengali journal, which is celebrating its twentyseventh anniversary this year, has become a prominent channel for the spread of Page #52 -------------------------------------------------------------------------- ________________ ITS AIMS AND OBJECTS Jain philosophy in Bengal. Both the Journals are edited by a renowned scholar Professor Dr Satya Ranjan Banerjee of Calcutta University. The Jain Journal and Sramana for over twentyseven years have proved that these journals are in great demand for its quality and contents. The Jain Journal is highly acclaimed by foreign scholars. The same can be said about the Hindi journal "Titthayara" which is edited by Mrs Lata Bothra. In April this year it entered its 25th year of publication. Needless to say that these journals have played a key-role in propagating Jain literature and philosophy. Progressive in nature, these have crossed many milestones and are poised to cross many more. 6. Seminars and Symposia : 95 The Bhawan organises seminars and symposia on Jain philosophy, literature and the Jain way of life, from time to time. Eminent scholars, laureates, professors etc. are invited to enlighten the audience with their discourse. Exchange of ideas, news and views are the integral parts of such programmes. 7. Scholarships to researchers: The Bhawan also grants scholarships to the researchers of Jain philosophy apart from the above mentioned academic and scholastic activities. 8. Publications: The Bhawan also publishes books and papers on Jainism and Jain philosophy. Some of its prestigious publications are: The Bhagavati Sutra [in English] Parts 1 to 4 Barsat ki Rat (A Rainy Night) [in Hindi], Panchadarshi [in Hindi] Bangal ka Adi Dharma (Pre-historic religion of Bengal) Prasnottare Jaina dharma (in Bengali) (Jain religion in questions and answers). Weber's Sacred Literature of the Jains. 9. A Computer Centre: To achieve a self reliance in the field of education, a Computer training centre was opened at the Jain Bhawan in February 1998. This important and welcome step will enable us to establish links with the best educational and cultural organisations of the world. With the help of E-mail, internet and website, we can help propagate Jainism throughout the world. Communications with other similar organisations will enrich our own knowledge. Besides the knowledge of programming and graphics, this computer training will equip our students to shape their tomorrows. 10. Research: It is, in fact, a premiere institution for research in Prakrit and Jainism, and it satisfies the thirst of many researchers. To promote the study of Jainism in this country, the Jain Bhawan runs a research centre and encourages students to do research on any aspects of Jainism. In a society infested with contradictions and violence, the Jain Bhawan acts as a philosopher and guide and shows the right path. Friends, you are now aware of the functions of this prestigious institution and its noble intentions. We, therefore, request you to encourage us heartily in our creative and scholastic endeavours. We hope that you will continue to lend us your generous support as you have done in the past. Page #53 -------------------------------------------------------------------------- ________________ JAIN JOURNAL : Vol-XXXV, No. 2 October 2000 JAIN BHAWAN PUBLICATIONS P-25 Kalakar Street, Calcutta - 700 007 Price :Rs. 150.00 150.00 150.00 150.00 English: 1. Bhagavati-sutra-Text edited with English translation by K.C. Lalwani in 4 volumes; Vol-1 (satakas 1-2) Vol-II (satakas 3-6) Vol-III (satakas 7-8) Vol-IV (satakas 9-11) 2. James Burges - The Temples of Satrunjaya, Jain Bhawan, Calcutta, 1977, pp. x+82 with 45 plates [It is the glorification of the sacred mountain Satrunaya.) 3. P.C. Samsukha-Essence of Jainism translated by Ganesh Lalwani, 4. Ganesh Lawani - Thus Sayeth Our Lord, Price :Rs. 100.00 Price :Rs. Price :Rs. 10.00 10.00 lindi 5. Ganesh Lalwani - Alimukta (2nd edn) translated by Shrimati Rajkumari Begani Price :Rs. 40.00 6. Ganesh Lalwani-Sraman Samskriti ki Kavita, translated by Shrimati Rajkumari Begani Price:Rs. 20.00 7. Ganesh Lalwani - Nilanjana translated by Shrimati Rajkumari Begani Price:Rs. 30.00 8. Ganesh Lalwani-Condana-Murti, translated by Shrimati Rajkumari Begani, Price:Rs. 50.00 9. Ganesh Lalwani - Vardhaman Mahavir Price:Rs. 60.00 10. Ganesh Lalwani-Barsat ki Ek Rat, Price :Rs. 45.00 11. Ganesh Lalwani - Pancadasi, Price:Rs. 100.00 12. Rajkumari Begani - Yado ke Aine me. Price :Rs. 30.00 Bengali: 13. Ganesh Lalwani-Atimukta, Price :Rs. 40.00 14. Ganesh Lalwani - Sraman Samskrti Kavita, Price:Rs. 20.00 15. Puran Chand Shyamsukha-Bhagavan Mahavir O Jaina Dharma, Price :Rs. 15.00 Three Journals: Jain Journal A Quarterly research Journal on Jainism yearly Rs. 60.00 Life Membership-Rs. 2000.00 Titthayara A Monthly research Journal on Jainism in Hindi Life Membership-Rs. 1000.00 Sramana A Monthly research Journal on Jainism in Bengali yearly--Rs. 30.. Life Membership--Rs. 500.00 Page #54 -------------------------------------------------------------------------- ________________ BOYD SMITHS PVT. LTD. B-3/5 Gillander House 8 Netaji Subhas Road, Calcutta-700 001 Phone: (O) 220 8105/2139, (R) 329 0629/0319 NAHAR 5/1 Acharya Jagadish Chandra Bose Road, Calcutta-700 020 Phone: 247 6874, Resi : 244 3810 KUMAR CHANDRA SINGH DUDHORIA 7 Camac Street, Calcutta 700 017 Phone: 242 5234/0329 WITH BEST WISHES It is difficult to conquer self. If self is conquered, we shall be happy in this world and afer. TARUN TEXTILES (P) LTD. 203/1 Mahatma Gandhi Road Calcutta-700 007 Phone: 238-8677/1647, 239 6097 ASHOK KUMAR RAIDANI 6, Temple Street Calcutta-700 072 Phone: 237 4132, 236 2072 GLOBE TRAVELS Contact for better & Friendlier Service 11, Ho Chi Minh Sarani, Calcutta-700 071 Phone: 282-8181 MANIK JAIN Philatelia 1 Moti Sil Street Calcutta-700 013 Phone: 228-8549 Page #55 -------------------------------------------------------------------------- ________________ Computer Exchange Park Centre 24 Park Street Calcutta - 700 016 Phone: 229 5047/0911 BALURGHAT TRANSPORT CO. LTD. 170/2C, A.J.C. Bose Road Calcutta-14, Phone : 245 1612-15, 247-4851 2, Ramlochan Mallick Street Calcutta-700 073, Phone : 238 7098/9397 SONA CHAND BOYED & SONS 9/10, Sita Nath Bose Lane Salkia, Howrah - 711 106 Phone, Resi : 665 3666/665 2272 In the Memory of Sohan Raj Singhvi Vinaymati Singhvi 93/4, Karaya Road Calcutta - 700 019 Phone (O) 220 8967 (R) 247 1750 ARIHANT JEWELLERS Mahender Singh Nahata 57, Burtalla Street, Calcutta-700 007 Phone: 232 4978 R.K. KOTHARI N.I. Corporation Photographic, Heavy & Fine Chemicals 44c, Indian Mirror Street, Calcutta-700 013 Phone : 245-5763/64/65 D: 245-5766, Fax: 91-33-2446148 MUSICAL FILMS (P) LTD. 9A Esplanade East Calcutta - 700 069 SWTONE ELECTRONICS 29/1B, Chandni Chowk Street 1st Floor, Calcutta-700 076 Phone : 237 6255 Page #56 -------------------------------------------------------------------------- ________________ Caltronix 12, India Exchange Place 3rd Floor, Calcutta- 700 001 Phone: 22. 1958/4110 M.C.C. INVESTMENT & LEASING CO. LTD. 9, Rabindra Sarani Calcutta-700 073 Phone : 235 7750/0741 DR. ANJULA VINAYAKA M.D. DND, M.R. C,O.G. (London) 12, Prannath Pandit Street Calcutta-700 025, Phone: +74-8008 DELUXE TRADING CORPORATION Distinctive Printers 36, Indian Mirror Street Calcutta-700 013 Phone: 244-4436 GRAPHITE INDIA LTD. Pioneer Carbon/Graphite Industry 31, Chowranghee Road, Calcutta-700 016 Phone : 226 4943, 226 5755, Fax: (033) 242 6420 WILLARD INDIA LTD. Mcleod House, 3 N.S. Road Calcutta-700 001, Tel No. 248-7476 Fax: 248-8184 PIONEER SAFETY PRODUCTS INDIA PVT. LTD. 105, Matheswar Talla Road, Calcutta-700 046 Phone: (O) 328 1541 (R) 2405129, 2804740 Fax: 329 0895 VINEET PVT. LTD. 1, Shakespeare Sarani, Calcutta Phone : 282 7612/7626/7617 Gram-Vineet Page #57 -------------------------------------------------------------------------- ________________ PUSHRAJ PURANMULL 65, Cotton Street, Calcutta-700 007 Phone : Gaddi 239 7343/4577 Office : 220 7969, 221 1907 Resi : 247 1490, 40 3104 MINEX AGENCIES 71, Ganesh Chandra Avenue Calcutta-700 013 Phone: 225 7067, 236 1178 Resi : 534 4392 MINERAL GRINDING INDUSTRIES 23/24 Radha Bazar Street, Calcutta-700 001 Phone: (O) 242 9199/2218/2883/5335 Resi : 240 5119 RELIANCE PRODUCTS PVT. LTD. 15, Chittaranjan Avenue, Calcutta - 700 072 Phone Office : 237 4927/5311 Resi : 241 4538/3719 MAHAVIR COKE INDUSTRIES (P) LTD. 1/1A, Biplabi Anukul Chandra Street Calcutta-700 072 Phone: 215-1297/236-4230/4240 JAISHREE EXPORTS A Govt. of India Recognised Export House 105/4, Karaya Road, Calcutta-700 017 Phone : 247-1810/1751, 240-6447 Fax: 913 3247/2897 L.B. ENGINEERS Off : 26, P.K. Tagore Street Calcutta-700 006, Factory: 7, Graham Road Kamarhatty, Cal-700 058 Phone-Off : 530-7442,530-9520 Fact: 553-3438, 334-2524 SUTRIPTA ASIT KUMAR 2 No. Ratanpur Singur, Hooghly, West Bengal Page #58 -------------------------------------------------------------------------- ________________ MOHAN LAL JAIN 9, India Exchange Place 5th Floor, Room No. 6 Calcutta-700 001 Phone: 220 8255/8528 SAMANT JUTE SUPPLY 12, Pollock Street, Calcutta-700 001 Phone: 235 1001/5000 JAIPUR EMPORIUM 227, A. J.C. Bose Road. Anandlok Building Calcutta Phone: 240 7937, 280 0494 SHIV TRADING CO. 11, Polock Street, Calcutta-700 001 Phone: 335 1423 RAMESH TRADING CO. 17, Armenian Street Calcutta-700 001 Phone: 235 4253 RATAN LAL DUNGARIA 16B, Ashutosh Mukherjee Road Calcutta-700 020 Phone (R): 455 3586 SUDIP KUMAR SINGH DUDHORIA Indian Silk House Agencies 129, Rasbehari Avenue. Calcutta, Phone: 464-1186 HIRALAL MOTILAL BENGANI 21, Burtolla Street 7th Floor, Calcutta-700 007 Phone: 238 1831/3207 Page #59 -------------------------------------------------------------------------- ________________ V.S. JAIN Royal Gems INC. Diamond & Coloured Stones 632, Vine Street, Suit # 421 Cincinnati OH 45202 Phone: 1-800-627-6339 DR. NARENDRA L. PARSON & RITA PARSON 18531 Valley Drive Villa Park, California 92667 U.S.A Phone: 714-998-1447714998-2726 Fax-714 7717607 RAJIV DOOGAR 305, East Tomaras Avenue SAVOY ILLINOIS-61874 U.S.A, (219) 2884652 SAILENDRA NAHAR C/o Impex Enterprises P.O. Box 476, Halton Garden, London Ecin 8DL Phone: 44-171-404-7221 Res. 44-181-3408270 MANOHAR PARSON 18, Aldridge Way Nepean, Ottawa, Canada K2 G4 H8 Phone (613)-726-1231 Fax-(613)-7211343 NIRMAL KUMAR DUGAR 11, Dr. Ashutosh Shastri Road Calcutta-10, Phone No. : 350 2928 CREATIVE LTD. 12, Dargah Road, Post Box 16127 Calcutta-700 017 Phone: 240 3758/3450/1690/0514 S.C. SUKHANI Shanti Niketan Building 4th Floor, Room No. 14, 8, Camac Street, Calcutta-700 017 Phone off: 242 0525, Res: 239 9548, Fax: 242-3818 Page #60 -------------------------------------------------------------------------- ________________ J. KUTHARI PVT. LTD. 12 India Exchange Place, Calcutta-700 001 Phone : (O) 220 3142, 221 4095, (R) 475 0995, 4761803, Fax: 221 4131 SANJAY MINNI Minisoft Private Limited 209, M.G. Road, Calcutta-700 007 Phone : 238-8154, Fax: 91-33-2311690 METROPOLITAN BOOK COMPANY 93, Park Street Calcutta-700 016 Phone : (O) 226 2418 (R) 464 2783 In the memory of Late Narendra Singh Singhi Angoori Devi Singhi 48/3, Gariahat Road Calcutta-700 019, Tel: 464-2851/3511 SURANA MOTORS LTD. 8th Floor, 84 Parijat 24A Shakespeare Sarani Calcutta - 700 071 Phone: 247 7450 Fax: 247-5264 LALCHAND DHARAM CHAND Govt. Recognised Export House 12. India Exchange Place, Calcutta-700 001 Phone : (B) 220 2074/8958, (D) 220 0983/3187 Resi : 464 3235/1541, Fax: 220 9755 C.H. SPINNING & WEAVING MILLS PVT. LTD. Bothra Ka Chowk Gangasahar, Bikaner B.W.M. INTERNATIONAL Peerkhanpur Road, Bhadohi - 221 401 Phone : Off. 05414-25178/778, 79 Fax: 05414-25378 Bikaner 0151-522404, 25973, Fax: 0151-61256 Page #61 -------------------------------------------------------------------------- ________________ AAREN EXPORTERS 12A, Netaji Subhas Road 1st Floor, Room No. 10 Calcutta - 700 001 Phone: 220-1370/3855 KESARIA & COMPANY Jute Tea Blenders & Packeteers since 1921 2, Lal Bazar Street, Todi Chambers, 5th Floor, Calcutta-700 001 Phone Office : 248-8576/0669/1242 Resi : 225 5514, 27-8208, 29-1783 LODHA CHARITABLE TRUST 14, Government Place East Calcutta-700 001 A.K. Chhajes Chhajes & Co. Chartered Accountant 230A Masjid Moth South Extention Part II New Delhi - 110 049 Siddha Niketan Golden chance to book flat in Jaipur Calcutta - 700 071 Phone: 282-2164/4577 Suvighya Boyed 340 Mill Road Apt # 1407 Etobicolse Onterio - m 9 Cly 8 416-622-5583 PRITAM ELECT & ELECTRONICS PVT. LTD. 22, Rabindra Sarani Shop No. G-136 Calcutta-700 073 Phone: (033) 2362210 www.jainelibrary Page #62 -------------------------------------------------------------------------- ________________ R.C. BOTHRA & COMPANY PVT. LTD Steamer Agents, Handling Agents, Commission Agents & Transport Contractors Regd. Office 2, Clive Ghat Street, (N.C. Dutta Sarani) Calcutta-700 001 Phone: 220 9333/6702/6400 Fax: (91) (33) 220-9333 Vizag Office 28-2-47 Daspalla Centre Vishakhapatnam-530020, Phone: 569208/563276 Fax: 91-891-569326 Page #63 -------------------------------------------------------------------------- ________________ HINDUSTAN GAS & INDUSTRIES LTD. ESSEL MINING & INDUSTRIES LTD. Registered Office "Industry House" 10, Camac Street, Calcutta-700 017 Telegram : 'Hindogen' Calcutta Phone : (033) 242-8399/8330/5443 Fax : (91) 33 2424998/4280 Manufacturers of : Engineers' Steel Files & Carbon Dioxide Gas At Tangra (Calcutta) Iron Ore and Manganese Ore Mines In Orissa S.G. Malleable & Heavy Duty Iron Castings At Halol (Gujrat) Ferro Vanadium and Ferro Molybdenum At Vapi (Gujrat) High Purity Nitrogen Gas At Mangalore H.D.P.E./P.P. Woven Sacks At Jagdishpur (U.P.) Page #64 -------------------------------------------------------------------------- ________________ Estd. Quality Since 1940 BHANSALI Quality, Innovation, Reliability BHANSALI UDYOG PVT. LTD. (Formerly: Laxman Singh Jariwala) Balwant Jain-Chairman A-42, Mayapuri, Phase-1, New Delhi-110 064 Phone: 5144496, 5131086, 5132203 Fax: 91-011-5131184 E-mail: [email protected] Page #65 -------------------------------------------------------------------------- ________________ With Best Compliments MARSON'S LTD MARSON'S THE ONLY TRANSFORMER MANUFACTURER IN EASTERN INDIA EQUIPPED TO MANUFACTURE 132 KV CLASS TRANSFORMERS Serving various SEB's Power station, Defence, Coal India, CESC, Railways, Projects Industries since 1957 Transformers type tested both for Impulse/Short Circuit test for Proven design time and again PRODUCT RANGE Manufactures of Power and Distribution Transformer from 25 KVA to 50 MVA upto 132kv level Current Transformer upto 66kv Dry type Transformer * Unit auxiliary and stations service Transformers 18, PALACE COURT 1, KYD STREET, CALCUTTA-700 016. PHONE: 29-7346/4553/226-3236/4482 CABLE-ELENREP TLX-0214366 MEL-IN FAX-00-9133-2259484/2263236 Page #66 -------------------------------------------------------------------------- ________________ "GANGES" FOR QUALITY JUTE GOODS Manufacturers of: Canvas, Tarpaulins, Special & Ordinary i lessian including fine Carpet Backing All Sacking 'Twine THE GANGES MANUFACTURING COMPANY LIMITED Chatterjee International Centre 33A, Jawaharlal Nehru Road, 6th Floor, Flat No. A-1 Calcutta-700 071 Gram "GANGJUTMIL" Fax: + 91-33-245-7591 Telex: 021-2101 GANG IN 226-0881 226-0883 Phone: 226-6283 226-6953 Mill: BANSBERIA Dist : HOOGHLY Pin-712 502 Phone : 6346441/6446442 Fax: 6346287 International ww Page #67 -------------------------------------------------------------------------- ________________ With Best Compliments WHILE PURCHASING HEASIAN, SACKING, YARN AND DECORATIVE FURNISHING FABRICS & OTHER JUTE PRODUCTS, PLEASE INSIST ON QUALITY PRODUCTION. We are, always ready to most the Exact type of your requirement. AUCKLAND INTERNATIONAL LTD. (UNIT: AUCKLAND JUTE MILLS) "KANKARIA ESTATE" 6, Lile Russel Street, Calcu.a-700 071 A RECOGNISED EXPORT HOUSE Cable: SWANAUCK, CALCUTTA Telex: 21-2396 AUCK IN Codes: BENTLEY'S SECOND Phone: 2479921/9720 2402683 Registered Office & 'JUTE MILL' At Jagatdal 24-Parganas BHATPARA 81-2757/2758/2038 Page #68 -------------------------------------------------------------------------- ________________ Voice & Vision of Communication SOBHAGYA ADVERTISING SERVICE 911 Chowringhee Road Calcutta 700 020 Ph: 223-6708/6997/4356/4357 Fax: 223-6863 E-mail : [email protected] * Mumbai * New Delhi * Chennai * Hyderabad * Ahmedabad * Bangalore * Bhubaneswar * Kochi * Patna * Baroda * Lucknow * Jaipur * Indore * Rajkot * Surat * Pune * Thiruvanathapuram * Bhopal * Nagpur * Panaji * Guwahati * Visakhapatnam Page #69 -------------------------------------------------------------------------- ________________ Statement of Ownership The following is a statement of ownership and other particulars about Jain Journal as required under Rule 8 of the Registration of News Papers (Central) Rules 1956. 1. Place of Publication 2. Periodicity of its Publication 3. Printer's Name Nationality and Address 4. Publisher's Name, Nationality and Address 5. Editor's Name, Nationality and Address Form IV 6. Name and address of the owner : Jain Bhawan P-25 Kalakar Street, Calcutta-700 007 : Quarterly : : Satya Ranjan Banerjee Indian P-25 Kalakar Street, Calcutta-700 007 : Satya Ranjan Banerjee C Indian : P-25 Kalakar Street, Calcutta-700 007 : Satya Ranjan Banerjee. Indian : P-25 Kalakar Street, Calcutta-700 007 : Jain Bhawan P-25 Kalakar Street, Calcutta-700 007 1, Satya Ranjan Banerjee, hereby declare that the particulars given above are true to the best of my knowledge and belief. July 15, 2000 Satya Ranjan Banerjee Signature of Publisher Page #70 -------------------------------------------------------------------------- ________________ 28 water supply schemes 315,000 metres of pipelines 110,000 kilowatts of pumping stations 180,000 million litres of treated water 13,000 kilowatts of hydel power plants (And in places where Columbus would have feared to tread) Subhash Projects and Marketing Limited MAN IN PARTNERSHIP WITH NATURE Head Office : 113 Park street, 3rd floor, South Block, Calcutta 700016 Ph: (033) 226 8031, Fax (033) 245 7562, Registered Office : Subhas House, F-27/2 Okla Industrial area, Phase II New Delhi 110 020 Ph : (011) 692 7091-94, Fax: (011) 684 6003. Regional Office : 8/2 Ulsoor Road, Bangalore 560 042, Ph: (080) 559 5508-15, Fax: (080) 559 5580. Laying pipelines across one of the that our credo of when you dare, then nation's driest regions, braving alone you do. Resulting in a string of temperature of 50degC. achievements. Under the most arduous of Executing the entire water intake and conditions. Fulfilling the most unlikely of water carrier system including treatment dreams. and allied civil works for the mammoth Using the most advanced technology Bakreshwar Thermal Power Project. and equipment, we are known for our Building the water supply, fire fighting innovative solutions. Coupled with the and effluent disposal system with deep financial strength to back our guarantees. pump houses in the waterlogged Be it engineering design. Construction seashore of Paradip. work or construction management. Be it Creating the highest head-water environmental, infrastructural, civil and supply scheme in a single pumping power projects. The truth is we design, station in the world at Lunglei in Mizoram build, operate and maintain with - at 880metres, no less. equal skill. Moreover, we follow the Building a floating pumping station on foolproof Engineering, Procurement and the fierce Brahmaputra. Construction System. Simply put, we are Ascending 11,000 feet in snow laden a single point responsibility. A one stop Arunachal Pradesh to create an all shop. powerful hydro-electric plant. So, next time, somebody suggests Delivering the impossible, on time that deserts by definition connote and perfectly is the hallmark of Subhas dryness, you recommend he visit us for a Projects and Marketing Limited. Add to lesson in reality. By the courtesy - ANTARCTICA LIMITED 1A, Vidyasagar Street, Calcutta - 700 009. Phone : 350-2173/351-0564 Lainelibrary.org